CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	0 crisprs	csa3	0	0
NZ_CP025012	Rhizobium leguminosarum strain Norway chromosome, complete genome	3 crisprs	csa3,WYL,cas3,DEDDh	2	6
NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	0 crisprs	csa3,DEDDh	0	44
NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	0 crisprs	NA	0	1
NZ_CP025015	Rhizobium leguminosarum strain Norway plasmid pRLN3, complete sequence	0 crisprs	RT	0	26
NZ_CP025017	Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025012_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025012_1

110994-111137

Orphan

Consensus_repeat	Method
GAAAAAAGAGCTAAAGCGCGTCGCATGTTTCAATTTCAATGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025012_1

>merge|NZ_CP025012|1|110994-111137|CRISPRCasFinder
GAAAAAAGAGCTAAAGCGCGTCGCATGTTTCAATTTCAATGCGATGCGCTAATGCATGACGCCCGGAAGTGTGCGGCGGTTCCGGGATAACGACATGCTCGAAAAAAGAGCTAAAGCGCGTCGCATCTTTCAATTTCAATGCGA

>NZ_CP025012|1|1|110994-111137|CRISPRCasFinder
GAAAAAAGAGCTAAAGCGCGTCGCATGTTTCAATTTCAATGCGA	TGCGCTAATGCATGACGCCCGGAAGTGTGCGGCGGTTCCGGGATAACGACATGCTC
GAAAAAAGAGCTAAAGCGCGTCGCATCTTTCAATTTCAATGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025012.1\|WP_105004797.1\|104415_104862_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380340
NZ_CP025012.1\|WP_105004801.1\|108485_109550_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP025012.1\|WP_105004810.1\|119467_121093_-\|glucose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234679
NZ_CP025012.1\|WP_105004799.1\|105834_107082_-\|ROK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224851
NZ_CP025012.1\|WP_105004806.1\|114320_114962_-\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NZ_CP025012.1\|WP_105004803.1\|111187_112234_+\|dihydroorotase	unknown	unknown	gnl\|CDD\|235474
NZ_CP025012.1\|WP_105004796.1\|102764_104297_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|227903
NZ_CP025012.1\|WP_105004807.1\|115948_116773_-\|NmrA-family-NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|187578
NZ_CP025012.1\|WP_003556145.1\|109552_110335_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP025012.1\|WP_105004805.1\|113782_114319_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319937
NZ_CP025012.1\|WP_105004809.1\|118354_119281_+\|carbohydrate-kinase	unknown	unknown	gnl\|CDD\|238572
NZ_CP025012.1\|WP_105008053.1\|115463_115946_-\|DUF1772-domain-containing-protein	unknown	unknown	gnl\|CDD\|227787
NZ_CP025012.1\|WP_105004808.1\|116873_117527_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380058
NZ_CP025012.1\|WP_105004795.1\|101903_102578_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_105004800.1\|107310_108330_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380628
NZ_CP025012.1\|WP_027681929.1\|105374_105851_-\|transporter	unknown	unknown	gnl\|CDD\|226632
NZ_CP025012.1\|WP_027681919.1\|117602_118292_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234771
NZ_CP025012.1\|WP_105004798.1\|104888_105371_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
NZ_CP025012.1\|WP_105004802.1\|110331_110964_+\|nucleoside-triphosphate-hydrolase	unknown	unknown	gnl\|CDD\|236442
NZ_CP025012.1\|WP_105004804.1\|112414_113593_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635

Protein	Function_ID	Function_description	E-value
NZ_CP025012.1\|WP_105004797.1\|104415_104862_+\|cupin-domain-containing-protein	gnl\|CDD\|380340	cd02210, cupin_BLR2406-like, Bradyrhizobium japonicum BLR2406 and related proteins, cupin domain. This family includes bacterial and fungal proteins homologous to BLR2406, a Bradyrhizobium japonicum protein of unknown function with a cupin beta barrel domain. Proteins in this subfamily appear to align closest to RmlC carbohydrate epimerase which is involved in dTDP-L-rhamnose production, and belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	6.65254e-40
NZ_CP025012.1\|WP_105004801.1\|108485_109550_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	7.42476e-81
NZ_CP025012.1\|WP_105004810.1\|119467_121093_-\|glucose-6-phosphate-isomerase	gnl\|CDD\|234679	PRK00179, pgi, glucose-6-phosphate isomerase; Reviewed.	0
NZ_CP025012.1\|WP_105004799.1\|105834_107082_-\|ROK-family-transcriptional-regulator	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.42687e-47
NZ_CP025012.1\|WP_105004806.1\|114320_114962_-\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	2.52343e-43
NZ_CP025012.1\|WP_105004803.1\|111187_112234_+\|dihydroorotase	gnl\|CDD\|235474	PRK05451, PRK05451, dihydroorotase; Provisional.	0
NZ_CP025012.1\|WP_105004796.1\|102764_104297_-\|transcriptional-regulator	gnl\|CDD\|227903	COG5616, COG5616, Predicted integral membrane protein [Function unknown].	7.32671e-41
NZ_CP025012.1\|WP_105004807.1\|115948_116773_-\|NmrA-family-NAD(P)-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.47116e-51
NZ_CP025012.1\|WP_003556145.1\|109552_110335_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	3.12298e-108
NZ_CP025012.1\|WP_105004805.1\|113782_114319_+\|VOC-family-protein	gnl\|CDD\|319937	cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the larger superfamily, this family contains members with or without domain swapping.	2.33335e-29
NZ_CP025012.1\|WP_105004809.1\|118354_119281_+\|carbohydrate-kinase	gnl\|CDD\|238572	cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.	8.32296e-104
NZ_CP025012.1\|WP_105008053.1\|115463_115946_-\|DUF1772-domain-containing-protein	gnl\|CDD\|227787	COG5500, COG5500, Predicted integral membrane protein [Function unknown].	3.9572e-45
NZ_CP025012.1\|WP_105004808.1\|116873_117527_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380058	pfam17928, TetR_C_22, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present the TetR Transcriptional Repressor present in sco1712 proteins from Streptomyces coelicolo which act as a regulator of antibiotic production.	3.42915e-22
NZ_CP025012.1\|WP_105004800.1\|107310_108330_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380628	cd19973, PBP1_ABC_sugar_binding-like, monosaccharide ABC transporter substrate-binding protein. Periplasmic sugar-binding domain of active transport systems that are members of the type 1 periplasmic binding protein (PBP1) superfamily. The members of this family function as the primary receptors for chemotaxis and transport of many sugar based solutes in bacteria and archaea. The sugar binding domain is also homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR. Moreover, this periplasmic binding domain, also known as Venus flytrap domain, undergoes transition from an open to a closed conformational state upon the binding of ligands such as lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. This family also includes the periplasmic binding domain of autoinducer-2 (AI-2) receptors such as LsrB and LuxP which are highly homologous to periplasmic pentose/hexose sugar-binding proteins.	1.79616e-154
NZ_CP025012.1\|WP_027681929.1\|105374_105851_-\|transporter	gnl\|CDD\|226632	COG4154, FucU, Fucose dissimilation pathway protein FucU [Carbohydrate transport and metabolism].	2.36798e-63
NZ_CP025012.1\|WP_027681919.1\|117602_118292_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|234771	PRK00455, pyrE, orotate phosphoribosyltransferase; Validated.	3.42852e-75
NZ_CP025012.1\|WP_105004798.1\|104888_105371_+\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	9.96681e-52
NZ_CP025012.1\|WP_105004802.1\|110331_110964_+\|nucleoside-triphosphate-hydrolase	gnl\|CDD\|236442	PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed.	1.21846e-104
NZ_CP025012.1\|WP_105004804.1\|112414_113593_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.81375e-56

>NZ_CP025012.1|WP_105004802.1|110331_110964_+|nucleoside-triphosphate-hydrolase
MNARIDEIAGAVLDRAGHSKRFLIAIAGPPGAGKSTMADNLAEALKASGESAEVLPMDGFHMDNAILIERGLLARKGIPETFDVRGFLDIIRAVRLADQEVLVPVFDRSRELAIASARPVSPDHRFIIVEGNYLLFSLGKWAELEGVFDFSIMLAPPIEVLEERLWARWRGYNLTEEAANAKVYGNDLPNGRLILENRRPADVTLEIALA
>NZ_CP025012.1|WP_003556145.1|109552_110335_+|sugar-ABC-transporter-ATP-binding-protein
MAREPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGDNGAGKSSLIKAISGAVTPDEGVITLEGRQVQFRSPMEARDAGIETVYQNLALSPALSIADNMFLGREIRKPGVLGSMFRMLDRPAMEKLARNKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEVADRIHIHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA
>NZ_CP025012.1|WP_105004801.1|108485_109550_+|ABC-transporter-permease
MTGTQEFERVLDGSDKSVASFEHENVSLIKRAQHFLHSTPAAVPLIVLVLAIVIFGITIGGRFFSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMVISAVIMGNVAITYGIPTPIAVAAGMLVGGLCGLLNGFLVAYMKLPPFIVTLGTWNIVMATNFIYSANETIRDTDVDEKAPLLHLFAVSFKLGSAVLTLGVIAMVLLVLVLWYVLNHTAWGRHVYAVGDDPEAAKLSGIQTKKVLLTVYAISGVIAGLAAWVSIGRNGSISPSSAVTDFNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLIIAAVAIDQWIRKVSV
>NZ_CP025012.1|WP_105004800.1|107310_108330_+|sugar-ABC-transporter-substrate-binding-protein
MKKSVLAFGALALGVTFSAPVMAADVAACLITKTDTNPFFVKMKEGATAKAKELGVSLKAYAGKVDGDSESQVAAIESCIADGAKGILIAASDTKGIVSSVKKARDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETMGDKAKDAKVGFLDLLPSQPTVDVLRDQGFMMGFGIDPKDPNKIGDEDDKRVVGHDVTNGNEEGGRKAMENLLQKDPSINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPLMMAALGIEAIKKFADSGEKPKPTEGKSFFDTGVSLVTDKPVSGVKSIDTKEGTDKCWG
>NZ_CP025012.1|WP_105004799.1|105834_107082_-|ROK-family-transcriptional-regulator
MSTLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGALSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGEPVRGRVGQPSIPMHINPDAVYSFGLKMGRRSADLVLMDFVGRIRMQLHRTYAYPLPDEILAFVTSGIRELEDRLDDKQRGRIAGLGIAAPFELWNWAEEVGAPPGAMEVWRDVDLQADIAARVSHPVFMQNDATSACGAELVFGVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRGKNGETMQLLEIASIFVLENMLRERGIDPEPLWYSADGWVDFGEPMEAWIQDSAKALAQAIVAAASIVDFSAAVIDGGFPDWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFARYLTDQNVLFKEVDHAERT
>NZ_CP025012.1|WP_027681929.1|105374_105851_-|transporter
MLKGLDPLLSPELLFTLRAMGHGDEIAIVDGNYPGVEHARRLIRLDGHHLIPVLNAVLSVLPIDDFVTDAIFRSTVKAERDKLDPVHEEMIDCCARHEPHRQVVPLIGQDFYGRVKTAHAVIQTGEPRLYANIILRKGVIYPKEPGTHAAAGVDPFVY
>NZ_CP025012.1|WP_105004798.1|104888_105371_+|RidA-family-protein
MAIIEQHLAEMGLELPEPLKVREGLRMPFVWVRVRGNRAYISGHVACNRDGTLATPLGKVGREISPEQGYASARLVALAHLASLKRAVGDLDRVTAWLRVFAMVNVAPGFDETPLVTNGYSDLILELYGPNVGAHARSSIGMAIPLNAPVNCEAEVEIDG
>NZ_CP025012.1|WP_105004797.1|104415_104862_+|cupin-domain-containing-protein
MKNEAKQPKNPPKNPYVLTAKVVRGSGSHVAVQGSVYRSGVSAESVGSTMLWLGTISLPAGRRTKAHRHEGHETALLMTAGEEIEIWSGSELEQCELVHAGDYLFIPAGVPHVAVNRSPENAEFLGARNDPAANESVVLMPELDNIIP
>NZ_CP025012.1|WP_105004796.1|102764_104297_-|transcriptional-regulator
MNTQHLAFGHFEFIAENGCLFRDNRSVAIGARGASLLAVLLSAQGGVVSKSALMDAVWPGLAVEESNLSVQIAALRKLLGPASDGSEWIVTVPRVGYRFSGPVESRTDAADSGWHAQTGSIPAIAVLPFENLGGDAERQYLADGITDDLIMALVRFRWFRVASRGASFTRRNGSKDPQSSARELGVDFLVDGAVRYIGDRIRISVHLADAAKGATVWSEHYDLQVAEVFAVQDAIAERIAAAVEPELLLRHGLQVAPHTGNITAWDLVRQGTFHFHKVTQSTHLVARRFFREATELDRLLPEAQIWRARVNAGLIAYGWSDNPAADGKEGLDAALRAIYLDARNPYSHYALAIVSAYTGRADQAILAAERSIELGSSFALGYLVLGMARLFSGDAAGARKPLARGLELNPHDPQNGVWFSLLILALFFSGDVENALETGRTALKARPDWPALLRIQACCHTAVGHREQARRFAAAASDLPEAAGDALGPFRDGNKEWASRLDELLREAEL
>NZ_CP025012.1|WP_105004795.1|101903_102578_-|hypothetical-protein
MAPDMSTVPRRSTTGLRKFLAPEQQRDWVEGEADLIDAEERLESLEQRFKYVARFQKLLRRPQAQDVLEILGIYGQTCIPIPRKTERHYWSVSCLPSTSDKPLVRVNASWMELFTLYADGEGLRARFLVHLSHFTTDDSPAQGDVDEAFLEHCVTTPEDVGYFFPRGEDMFGINVRGSASIRKFLAERRILRAIRTFNVTHMNRGRNAYQASHCYSLADNMLAG
>NZ_CP025012.1|WP_105004803.1|111187_112234_+|dihydroorotase
MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPPVVTTTDAKAYRERILKVLPDGHRFQPLMTLYLTEHTSPDDVEEGKNSGLITAVKLYPAGATTNSHGGVRDMEKAMPVLERMAKIGLPLCVHGEVTTPEVDIFDREAVFIETVLDPLRKRLPELKVTMEHVTTSDGVDYIKAAKGNLAGSITTHHLIINRNAILVGGIRPHYYCLPVAKRENHRLALRAAAVSGDARFFLGTDSAPHVDPLKECACGCAGIYTSVNTMSCLAHVFEQESALERLEAFVSLNGPAWYGLQPNEERITLSREAEPVVFPARIETGAGPVTVFDPMFPLHWQVVQQA
>NZ_CP025012.1|WP_105004804.1|112414_113593_+|GGDEF-domain-containing-protein
MTLDYNSLLLALGVSAACLAVTLMGSWIVRRAETVLLTATVGLVLVVSGIFVYSAYVNTPGTWLGVANFVLFHAGFATIWGAGKQFLTGRLSIPAIAIRALAAMVFSVVPMLSGYDGLAFIADNLAIALLLFATARQYWLARAEAPAPILGITALYTLTAISFVLCAAVLIFDGKLVLGKAPSNWAEDLSLAVCIAGMTGIGALSLALHQWRLAARHRLDAITDPLTGLLNRRALFDEYGTRPMGTTTAVIVFDIDHFKSVNDRFGHAAGDRVLKVFAGELAASCRTGDTAARLGGEEFALVLKEIMPGRAELTAERIRRAFEAREIHIDDEVLTCTVSVGVAPGRSKPQDFDAMLSAADKALYVAKRAGRNRVELAGHLQAVPVEAARTAS
>NZ_CP025012.1|WP_105004805.1|113782_114319_+|VOC-family-protein
MRDFRDAKLMAKTLRQALADRDISLTHSETLEIVARQFGLDQWNILSAKIEEAGTSHSVIGIKPPMPIFRIFSVEKAMEFYCGFLGFNLDWEHRFGENFPLYCQVSRDGMALHLSEHSGDASPGAKAFVRVANVRAYHAELAGKDYRYMKPGVEEAPWGLEMTVTDPFSNRIAFCEQT
>NZ_CP025012.1|WP_105004806.1|114320_114962_-|glutathione-S-transferase-family-protein
MFTLHDYLPSQNGWKVRVLLGLLDMPYRSRIVSIFEGESRTEAFLKLNPVGAIPVLELDDGRAIAESNAILTYLAEGTRFLPSDHYLRAKVMQWLFFEQYHVEPVIGSLRFWTLTGRLERNQSMVAGKREAAARALAAIDRGLTDSPFLVGHELTITDIAVYAYSHRAEDCGFSLKSYPAFLAWLERVRDAIGADYPVYPYSIDPHSDAGATP
>NZ_CP025012.1|WP_105008053.1|115463_115946_-|DUF1772-domain-containing-protein
MQIILILSLVAAAIGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAAMNSINVTIVRSPFMGLFVPTAILCIVIAVLALIDWRGGASFLMLAGAALYVLASFVSTIVFNVPMNDALAKVAGNGPEAAQLWTSYVRDWTWWNHVRTIASLLASVAFVRALMIV
>NZ_CP025012.1|WP_105004807.1|115948_116773_-|NmrA-family-NAD(P)-binding-protein
MQTSEIVLVGGSGKTGGRIIKRLEARGLTVRAASRSSARPFDWEARSSWRGALQGASSAYVAFQPDLAVAWAAEAIEALAKVAVDCGLEHIVLLSGRGEESAQRSEAALKASGIDTTILRASWFCQNFSEGAFVEQIIGGRLQLPAGEIGEPFIDTDDIADAAVAALTDPRHRNKTYELTGPRALTFRQAVAEIAAAAGRPIEYQQVSMADFTGGLAAAGLPQGLIDLLEELFGQVLDGRNSSVMGGVAEILGRPATDFSEYARRTAATGIWSA
>NZ_CP025012.1|WP_105004808.1|116873_117527_+|TetR/AcrR-family-transcriptional-regulator
MSEQSVATRRRQQESTGQLRRIPSQQRGRERFEKILAVASQLIESHGSDGLKMSEIVEKAGLSFGALYQYFPDKTSIIRTLAERFNEAGRRCVEAELAKVTDAAGLQGALATIVDEYYGFFRREPVMRDIWHATHTDKLLQQVDAEDMEFHAQAFLAVLVRLWPDRDRKGLLAIARLTMQLLAAGVRYAVSLDAEEGAQAIALFKKMQIADIGRLLL
>NZ_CP025012.1|WP_027681919.1|117602_118292_+|orotate-phosphoribosyltransferase
MIQTTFPDRAVMAELLAKMLWEIKAVHFNAAQPYKLSSGMASPVYIDCRKLLSFPRIRSTVMDFAASTLLRDAGFEQFDCIAGGETAGIPFAALLADRLGLPMIYVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGGSMFKFIDAVRAAGGIVDHGIALFFYGIFGEQRFADGKVRLHHIATWRNVLAVAKEQKLFDDKTLSEVEAFLDAPLAWSGRNGGVSELSL
>NZ_CP025012.1|WP_105004809.1|118354_119281_+|carbohydrate-kinase
MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIPTAFFTGIADDMMGEILLETLKASNVDYSPCAITPRPSTIAFVKLVNGQATYAFYDEGTAGRMITTADLPDLGDDCEALHFGAISLIPSPCGETYEALLDREAARRVISLDPNIRPGFIKDKPSHMARIKRMAAKSDIVKFSDEDLEWFGLQGDHDALAAHWLNHGAKLVVITKGAEGASGYTKERKVTVPSERVTVVDTVGAGDTFDAGILASLKMDNLLTKAQVASLDEKALHNALTLGAKAAAVTVSRAGANPPWAREIGL
>NZ_CP025012.1|WP_105004810.1|119467_121093_-|glucose-6-phosphate-isomerase
MNAIVEQLKSTADATKATDIRAAFAADSQRFSRFSVSLDDLLMDFSKTAVNDDILKLLVKLAEDGGVEKKREEMFSGKAINFTEDRAVLHTALRNRSNTPVLVDGKDVMPDVNAVLAAMGKFADDVRSGTLKGATGKAITDVVNIGIGGSDLGPVMATLALAPFHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFTTVETMTNAQTARNFIAKALGEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAVGPENFGKFLDGAHAVDNHFRKAPITENLPILLGLIGFYHRNVLGYPTRAILPYDQRLSRFPAYLQQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAANAFEPELRHQHQLLISNVLAQSEALMKGRTFAEAKKQLTDKGMDDKKADFIAPHRVFNGNRPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVEGKESAASHDSSTQGLVAALAKLAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025012_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025012_2

572929-573014

Orphan

Consensus_repeat	Method
TTCCAGGAAAAGTGTGGCGCGGTATTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025012_2

>merge|NZ_CP025012|2|572929-573014|CRISPRCasFinder
TTCCAGGAAAAGTGTGGCGCGGTATTCCGTCCGGAATTGCGTAACAGGTTAGAGCTAGTTCCAGGAAAAGTGTGGCGCGGTTTTCC

>NZ_CP025012|2|2|572929-573014|CRISPRCasFinder
TTCCAGGAAAAGTGTGGCGCGGTATTCC	GTCCGGAATTGCGTAACAGGTTAGAGCTAG
TTCCAGGAAAAGTGTGGCGCGGTTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025012.1\|WP_012756247.1\|575060_575396_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_105005105.1\|576962_578795_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP025012.1\|WP_105005100.1\|570596_571220_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169692
NZ_CP025012.1\|WP_003545854.1\|570291_570519_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|181027
NZ_CP025012.1\|WP_105005106.1\|580288_581065_+\|methyltransferase	unknown	unknown	gnl\|CDD\|226608
NZ_CP025012.1\|WP_105005107.1\|581118_582459_-\|divalent-metal-cation-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP025012.1\|WP_062943422.1\|569070_569409_+\|F0F1-ATP-synthase-assembly-protein	unknown	unknown	gnl\|CDD\|227641
NZ_CP025012.1\|WP_105005099.1\|567569_568799_+\|cell-wall-hydrolase	unknown	unknown	gnl\|CDD\|226296
NZ_CP025012.1\|WP_105005101.1\|571223_571712_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169691
NZ_CP025012.1\|WP_018245012.1\|574359_574878_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|237556
NZ_CP025012.1\|WP_105005103.1\|573062_574220_-\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP025012.1\|WP_105005102.1\|572070_572760_-\|ribonuclease-HII	unknown	unknown	gnl\|CDD\|234574
NZ_CP025012.1\|WP_018245017.1\|578929_579946_-\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_CP025012.1\|WP_105008067.1\|575430_575982_-\|molybdenum-cofactor-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|131715
NZ_CP025012.1\|WP_027685805.1\|562718_563885_+\|Mrp/NBP35-family-ATP-binding-protein	unknown	unknown	gnl\|CDD\|378455
NZ_CP025012.1\|WP_003556903.1\|569471_570224_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|223433
NZ_CP025012.1\|WP_003545870.1\|580054_580282_+\|DUF2007-domain-containing-protein	unknown	unknown	gnl\|CDD\|378182
NZ_CP025012.1\|WP_105005104.1\|575981_576893_-\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	unknown	unknown	gnl\|CDD\|237765
NZ_CP025012.1\|WP_018449361.1\|564396_565374_+\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213371
NZ_CP025012.1\|WP_105005098.1\|565392_567291_+\|potassium-transporter-Kup	unknown	unknown	gnl\|CDD\|225700

Protein	Function_ID	Function_description	E-value
NZ_CP025012.1\|WP_105008067.1\|575430_575982_-\|molybdenum-cofactor-biosynthesis-protein-B	gnl\|CDD\|131715	TIGR02667, Molybdenum_cofactor_biosynthesis_protein_B., molybdenum cofactor biosynthesis protein B, proteobacterial. This model represents the MoaB protein molybdopterin biosynthesis regions in Proteobacteria. This crystallized but incompletely characterized protein is thought to be involved in, though not required for, early steps in molybdopterin biosynthesis. It may bind a molybdopterin precursor. A distinctive conserved motif PCN near the C-terminus helps distinguish this clade from other homologs, including sets of proteins designated MogA. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin].	2.9317e-96
NZ_CP025012.1\|WP_105005105.1\|576962_578795_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.01578e-24
NZ_CP025012.1\|WP_105005100.1\|570596_571220_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169692	PRK09174, PRK09174, F0F1 ATP synthase subunit B.	2.15228e-89
NZ_CP025012.1\|WP_003545854.1\|570291_570519_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|181027	PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated.	7.89276e-27
NZ_CP025012.1\|WP_105005106.1\|580288_581065_+\|methyltransferase	gnl\|CDD\|226608	COG4123, COG4123, Predicted O-methyltransferase [General function prediction only].	2.4876e-82
NZ_CP025012.1\|WP_105005107.1\|581118_582459_-\|divalent-metal-cation-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	0
NZ_CP025012.1\|WP_062943422.1\|569070_569409_+\|F0F1-ATP-synthase-assembly-protein	gnl\|CDD\|227641	COG5336, COG5336, Uncharacterized protein conserved in bacteria [Function unknown].	1.74666e-37
NZ_CP025012.1\|WP_105005099.1\|567569_568799_+\|cell-wall-hydrolase	gnl\|CDD\|226296	COG3773, SleB, Cell wall hydrolyses involved in spore germination [Cell envelope biogenesis, outer membrane].	3.98327e-86
NZ_CP025012.1\|WP_105005101.1\|571223_571712_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169691	PRK09173, PRK09173, F0F1 ATP synthase subunit B; Validated.	2.93657e-72
NZ_CP025012.1\|WP_018245012.1\|574359_574878_+\|glycosyl-transferase	gnl\|CDD\|237556	PRK13915, PRK13915, putative glucosyl-3-phosphoglycerate synthase; Provisional.	4.88503e-06
NZ_CP025012.1\|WP_105005103.1\|573062_574220_-\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.41762e-24
NZ_CP025012.1\|WP_105005102.1\|572070_572760_-\|ribonuclease-HII	gnl\|CDD\|234574	PRK00015, rnhB, ribonuclease HII; Validated.	6.23804e-104
NZ_CP025012.1\|WP_018245017.1\|578929_579946_-\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	2.47616e-108
NZ_CP025012.1\|WP_027685805.1\|562718_563885_+\|Mrp/NBP35-family-ATP-binding-protein	gnl\|CDD\|378455	pfam10609, ParA, NUBPL iron-transfer P-loop NTPase. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.	1.16597e-145
NZ_CP025012.1\|WP_003556903.1\|569471_570224_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|223433	COG0356, AtpB, F0F1-type ATP synthase, subunit a [Energy production and conversion].	1.56312e-66
NZ_CP025012.1\|WP_003545870.1\|580054_580282_+\|DUF2007-domain-containing-protein	gnl\|CDD\|378182	pfam09413, DUF2007, Putative prokaryotic signal transducing protein. This is a family of putative prokaryotic signal transducing proteins of Pii-type.	3.811e-22
NZ_CP025012.1\|WP_105005104.1\|575981_576893_-\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	gnl\|CDD\|237765	PRK14608, PRK14608, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.	3.40887e-149
NZ_CP025012.1\|WP_018449361.1\|564396_565374_+\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213371	cd12837, EcCorA-like_u1, uncharacterized subgroup of the Escherichia coli Mg2+ transporter CorA_like subfamily. A uncharacterized subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. The EcCorA_ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA_ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	3.988e-155
NZ_CP025012.1\|WP_105005098.1\|565392_567291_+\|potassium-transporter-Kup	gnl\|CDD\|225700	COG3158, Kup, K+ transporter [Inorganic ion transport and metabolism].	0

>NZ_CP025012.1|WP_105005102.1|572070_572760_-|ribonuclease-HII
MKPRTPPDSPLLFDTVPLVPDFRLELKARKAGHWPVAGADEAGRGPLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDETDIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVAKVTRDRMMARAHNVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKTEDGPETDELLSE
>NZ_CP025012.1|WP_105005101.1|571223_571712_+|F0F1-ATP-synthase-subunit-B
MEFFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKQADAKVQSELFGNAVGQVKTRLN
>NZ_CP025012.1|WP_105005100.1|570596_571220_+|F0F1-ATP-synthase-subunit-B
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHTRISQDLEEAGRLKAEADAAVQTYEGELAAARAKSNAIGSAARDAAKAKAEEDRRAVEASLSEKIKAAELRIGEIKAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA
>NZ_CP025012.1|WP_003545854.1|570291_570519_+|F0F1-ATP-synthase-subunit-C
MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFSLLVALLLLFAV
>NZ_CP025012.1|WP_003556903.1|569471_570224_+|F0F1-ATP-synthase-subunit-A
MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAASAAVAVGFLYFATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFTFVLTANLLGMFPYFFTVTSQIIVTFALALLVIGTVLVYGFYKHGFHFLKVFVPSGVPGALLPLVVLIEMISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMYLNDAIHPGGH
>NZ_CP025012.1|WP_062943422.1|569070_569409_+|F0F1-ATP-synthase-assembly-protein
MADDREESLEKRRAQLGAKLATKRVETGEDEAREARAEVSRKGYAQAMKLSSEFISAIVVGALLGYVLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHPLDDKDDKK
>NZ_CP025012.1|WP_105005099.1|567569_568799_+|cell-wall-hydrolase
MECSRVPCPESVLRRKSPSRSKLRLIPENWVSPVIFGLAGWLIFPSVASHADLAAMLAGLDHEGENWRMVLTNSPAGSIHQAELAFAEPMVTGSISAGAGMVLPDGRKVAFTAKDKGTAKDRGHEDTPDEDRVNRSTKKGRVVAVEKMQPPKDFSAGSILERTKMLFTPSFDLKDRSAFVKPKIQGKEIQIATSFYKTQPVVTDNGVPAMLASLVTSNKADVLATAYAPAAPDYARQSPFDSILAEQDSGRFVPQIGPRDHAWAASVLAPSVFSAREQQCLASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSIKDRVNSEYHWRVARDVAMAVTSGKIWLPQVGSATHYHAVYVRPKWAKTMEKVGRIGLHVFYRTYGGGWS
>NZ_CP025012.1|WP_105005098.1|565392_567291_+|potassium-transporter-Kup
MSEESHPNESHMTPRKLFYLALGSVGVVYGDIGTSPLYAFREALKPVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANGHTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPSLAEYIVPISVVILALLFVVQSRGTGAVAKFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGVVVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFLLVFPALTLNYLGQGALVLGNPATMSDPFYLMYPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETNTGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNWSLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKTRHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVILTIRTINKPRVPSHDRYRVEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMSTSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII
>NZ_CP025012.1|WP_018449361.1|564396_565374_+|magnesium-transporter-CorA-family-protein
MITAYCSNCKSVEIRDLSHAASFPEDVVWIDMIEPTRDEELYVEKILGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVTIRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEISVSRLDILSTHVFGDRARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAKELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLVASIYGMNFQIMPELTWVAGYPYSLALMVISAVIPFFFFRWKGWL
>NZ_CP025012.1|WP_027685805.1|562718_563885_+|Mrp/NBP35-family-ATP-binding-protein
MTDVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSITVPADRAKELEPMRLAAERVIKEMPGVKGALVTLTADKKAAAAAPAARPAPNPPHGHAGHDHGSHAHAPQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARREAERIGVPFLGEVPLTMNIRETSDAGTPLVASEPNGVVAGIYRGIAAKVWEQVAGQSQRPAPTIVFE
>NZ_CP025012.1|WP_105005103.1|573062_574220_-|PA0069-family-radical-SAM-protein
MREQSLAGQAAFAPANTADIADAMIVSSGLRVEVDRRRGRGAGLNPTGRFEALQRETVDDGWQTWEELPPFKTEVQVEKPRTAITRNESPDIPFDRSINPYRGCEHGCIYCFARPTHAYMGLSAGLDFETKLFAKPHAAKLLERELAKPGYKVRVIAIGTNTDPYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLVRVGISVTTLDRKLARTMEPRAATPPRRLETIHTLAEAGIQTAVMAAPLIPALNDHELERILESAKAAGAVEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGAGPYAWQIARRFEMAARRFGLTRRSMPLRDDLFVPPDGSGVQLSLL
>NZ_CP025012.1|WP_018245012.1|574359_574878_+|glycosyl-transferase
MLTVVLECQDQESELAQTLSVLVAGAVEGLVSDVVVLDHGSRDGTSRVADAAGCRFHSQWDIKDIVRSARGEWLLFVEPGARPQAGWIDEIAEYVALNKLPARFTASRGYRRPFFQRVGRAVPPLELGFLLPKKQALAIAKSGMRLTEFVKGQKPRKLASELIPSWVARAAR
>NZ_CP025012.1|WP_012756247.1|575060_575396_+|hypothetical-protein
MARGRIYGVRSMIYGLIAVILPTLVIAHPHSAASQMMRSCAGRPEIVNFLDKNFAEKLTAVGLINENAILEVYAAESGTWTLIVTDVHGISCVLLSGDSWDTMPVLPGLAT
>NZ_CP025012.1|WP_105008067.1|575430_575982_-|molybdenum-cofactor-biosynthesis-protein-B
MAGLDEKRPFIAVGIAVLTISDTRTPETDKSGDTLAARITEAGHRLVDRGIVPDDRAEIAARVKAWTDNKDIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGFSAIFHRISYEKIGTATIQSRATAGVANSTFIFVLPGSPGACRDAWDGILKGQLDYRSAPCNFVEIMPRLDEHLKRGATK
>NZ_CP025012.1|WP_105005104.1|575981_576893_-|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase
MMSSENRSDFSASCSSITEEARAKINLALHVTGQRPDGYHLLDMLVTFADHGDRLDFMRSPTDVFSLSGRFGEVLAGDAGTNLVLKSRDLLREAIGALAFPVRIHLEKNLPVASGIGGGSADAAATLRGLMRLWGTSLPEEALAALALKLGADVPMCLASRPLIARGIGEKIEPVPELPAFAMVLANPLKGVSTPEVFRRLATKNNPALSLAPSPPQTVDWLAAIAAARNDLEPPARELVPEIAAISAMLQVHGALLTRMSGSGATCFGIFATMTDAEDAAAALHGARPDWYFQATETVSGGV
>NZ_CP025012.1|WP_105005105.1|576962_578795_-|tetratricopeptide-repeat-protein
MRQRLAIRLLTSAALAAVLSLGGVGGVNAEDAAKADDAGTAAHFDADSVTTFSGAFLAARTADVDHDYETAIELYKKALQIEPGNPEIRQRLMISLLLNGDIKDGVKYANDLKGDPSVERITTIVRGMDAVRRDDYKTAESILKYKGPNDLDRMMNDLLLAWARVGAGRGKEALTMVEKMKGPDWFRIFQNYNAGAIAIAIGDVKSARQHLNDAVLDKEGGATAPDTFMRAVMALARLEATQGNKQKALDAVSVGDNLLPNYAPLNALRDSVEKNEKQEQQVKTAEEGAAGVLFSVGGALNRDGAEDIVSLYLQTANALDPNSADTLVLLGGIAEKQNQMDRAIALYKKVPENSPMRRISELQLGLALAQGGKVDEARKHLQALIASDPKDIRSYLAYGSVLSDAKDYEAMAANYDKAVEAIGPIPGRANWSVFFQRGIAYERLKKWDQAEPNFRKALELNPDQPQVLNYLGYSWIDMNRNLDEGLGMIKKAVDLRPDDGYIIDSLGWAYFRLNRFDDAVDELERAAQIKAGDATINDHLGDAYWRVGRKLEAVYQWNRALSSEPEAAEIPRIKDKVANGLPPASDDAKAADKKQPDPAPVIPPPVDKKS
>NZ_CP025012.1|WP_018245017.1|578929_579946_-|polyprenyl-synthetase-family-protein
MGVVIPLEESKNKLASIKPLVDLTRADMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRPMLTLASASLFDYRGENHVKLATSVEFMHTATLLHDDVVDESDLRRSKPTARMIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSSAACVIAEGEVLQLSVAKNMETTEDDYLSVIRAKTAALFAAAAEVGPIVAEAGRSGRNALKSYGMNLGLAFQLVDDALDYGGKAADLGKNVGDDFREGKITLPVILAYRRGTEDERAFWRDAIEAGNSTDANLEKALGLITKYGTLSDTIGRAIHYGTIARDALAPLPDTVWKSALMEVIDFCIERVN
>NZ_CP025012.1|WP_003545870.1|580054_580282_+|DUF2007-domain-containing-protein
MHELIRANDPVLLSYAESLMKDAGIHCFIADQGMSVLEGSLGMLSRRLLVDEEMADQARRILTDAGLGGELRERK
>NZ_CP025012.1|WP_105005106.1|580288_581065_+|methyltransferase
MTGEPIDTIDAFHRGAFHVVQPKGRGHRSGMDAMLLAALVADDRPVRVADLGAGAGAAGLAVASRLADTQVVLFERSAEMADYARRSILLPDNAHVAGRVSVVEADVTLTAKARNDAGLTDESFHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAGAIMIPGGQLSLIARPQSIAEIVAACGRRFGGIEITAIHPRPGENAVRILVTTIKGSRARLSLRAPLIMHEEGSHKFSPLVDDFNNGRAAYMRL
>NZ_CP025012.1|WP_105005107.1|581118_582459_-|divalent-metal-cation-transporter
MDVLNPNAKSGWRHERGEGSLSDVYRTVGTGRHSSTWRRAAAFAGPGYMVAVGYMDPGNWATSLAGGSKFGYALLTVALLSNLMAIVLQALCARLAIASGRDLAQACRDAFPRYVSVPLWALAEIAIIATDIAEVIGTAIGLNLLMGIPLELGVLITALDVFVILFLQKLGFRWVEAFIIALLGVIAVCFGVQILLADPQWGAVLTGFFPTTEIVTNPEMLYLALGILGATVMPHNLYLHSGIVQTRAYGHTIPEKKEALTFATIDSTVALCFALLINASILILAAAAFNAHGKTDVVELGEAHSLLSPLLGLAIAPTLFGIALLCCGLNSTVTATLAGQIVMEGFLKIRLKPWVRRLITRAIAIVPAAIVTIWYGDQGTAQLLILTQVVLSLQLSFAVFPLVMFTASKAKMGELVAPRWLSGIAYLIAVVIAGLNVKLLFDFVTG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025012_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025012_3

736515-736596

Orphan

Consensus_repeat	Method
CAGCAATCGATCCAGTGAATCGATTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025012_3

>merge|NZ_CP025012|3|736515-736596|CRISPRCasFinder
CAGCAATCGATCCAGTGAATCGATTGCAGTGGGTGAGCCGCGATGGCGCAACGCGCCAGCAATCGATCCAGTGAATCGATTG

>NZ_CP025012|3|3|736515-736596|CRISPRCasFinder
CAGCAATCGATCCAGTGAATCGATTG	CAGTGGGTGAGCCGCGATGGCGCAACGCGC
CAGCAATCGATCCAGTGAATCGATTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025012.1\|WP_105005214.1\|730948_733654_+\|pyruvate,-phosphate-dikinase	unknown	unknown	gnl\|CDD\|236446
NZ_CP025012.1\|WP_105008079.1\|738647_739100_-\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|225556
NZ_CP025012.1\|WP_105008078.1\|735580_736492_+\|DUF1499-domain-containing-protein	unknown	unknown	gnl\|CDD\|377828
NZ_CP025012.1\|WP_105005222.1\|745605_746214_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_CP025012.1\|WP_105005217.1\|736929_738651_-\|DUF4166-domain-containing-protein	unknown	unknown	gnl\|CDD\|379359
NZ_CP025012.1\|WP_003546062.1\|734234_734432_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182059
NZ_CP025012.1\|WP_105005221.1\|744352_745132_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187654
NZ_CP025012.1\|WP_105005220.1\|743043_744222_+\|DUF4268-domain-containing-protein	unknown	unknown	gnl\|CDD\|379461
NZ_CP025012.1\|WP_105005216.1\|734848_735241_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_105005218.1\|739116_740034_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP025012.1\|WP_105005209.1\|724854_725220_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_027690384.1\|740309_741473_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP025012.1\|WP_105005212.1\|726583_730045_+\|chromosome-segregation-protein-SMC	unknown	unknown	gnl\|CDD\|224117
NZ_CP025012.1\|WP_017990577.1\|742425_742791_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_105005219.1\|741988_742363_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393
NZ_CP025012.1\|WP_003557210.1\|734587_734833_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_105005210.1\|725278_725503_+\|TraY-domain-containing-protein	unknown	unknown	gnl\|CDD\|227054
NZ_CP025012.1\|WP_105005215.1\|733691_733970_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025012.1\|WP_105005211.1\|725710_726487_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372611
NZ_CP025012.1\|WP_105005223.1\|746325_747012_+\|PspA/IM30-family-protein	unknown	unknown	gnl\|CDD\|224755

Protein	Function_ID	Function_description	E-value
NZ_CP025012.1\|WP_105005214.1\|730948_733654_+\|pyruvate,-phosphate-dikinase	gnl\|CDD\|236446	PRK09279, PRK09279, pyruvate phosphate dikinase; Provisional.	0
NZ_CP025012.1\|WP_105008079.1\|738647_739100_-\|DUF393-domain-containing-protein	gnl\|CDD\|225556	COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only].	4.13358e-33
NZ_CP025012.1\|WP_105005219.1\|741988_742363_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	1.1535e-08
NZ_CP025012.1\|WP_105005222.1\|745605_746214_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	3.17609e-09
NZ_CP025012.1\|WP_003546062.1\|734234_734432_-\|hypothetical-protein	gnl\|CDD\|182059	PRK09752, PRK09752, AIDA-I family autotransporter YfaL.	0.00958694
NZ_CP025012.1\|WP_105005217.1\|736929_738651_-\|DUF4166-domain-containing-protein	gnl\|CDD\|379359	pfam13761, DUF4166, Domain of unknown function (DUF4166). This domain is often found at the C-terminus of proteins containing pfam03435.	2.15309e-29
NZ_CP025012.1\|WP_105005220.1\|743043_744222_+\|DUF4268-domain-containing-protein	gnl\|CDD\|379461	pfam14088, DUF4268, Domain of unknown function (DUF4268). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 151 and 387 amino acids in length.	1.65595e-38
NZ_CP025012.1\|WP_027690384.1\|740309_741473_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.47173e-17
NZ_CP025012.1\|WP_105005218.1\|739116_740034_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	5.63509e-90
NZ_CP025012.1\|WP_105005212.1\|726583_730045_+\|chromosome-segregation-protein-SMC	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	0
NZ_CP025012.1\|WP_105005221.1\|744352_745132_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187654	cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs. Daunorubicin is a clinically important therapeutic compound used in some cancer treatments. Daunorubicin C-13 ketoreductase is member of the classical SDR family with a canonical glycine-rich NAD(P)-binding motif, but lacking a complete match to the active site tetrad characteristic of this group. The critical Tyr, plus the Lys and upstream Asn are present, but the catalytic Ser is replaced, generally by Gln. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.21807e-140
NZ_CP025012.1\|WP_105008078.1\|735580_736492_+\|DUF1499-domain-containing-protein	gnl\|CDD\|377828	pfam07386, DUF1499, Protein of unknown function (DUF1499). This family consists of several hypothetical bacterial and plant proteins of around 125 residues in length. The function of this family is unknown.	2.59993e-07
NZ_CP025012.1\|WP_105005210.1\|725278_725503_+\|TraY-domain-containing-protein	gnl\|CDD\|227054	COG4710, COG4710, Predicted DNA-binding protein with an HTH domain [General function prediction only].	1.85881e-13
NZ_CP025012.1\|WP_105005223.1\|746325_747012_+\|PspA/IM30-family-protein	gnl\|CDD\|224755	COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms].	1.93922e-15
NZ_CP025012.1\|WP_105005211.1\|725710_726487_+\|DsbA-family-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	2.65503e-48

>NZ_CP025012.1|WP_105008078.1|735580_736492_+|DUF1499-domain-containing-protein
MAIRFDRPVSNAARFSRLLGAFSLVLALAVMIAHRFGGLATPYLVLLLIAAAGGALLSAMLAAVGLRSLWMTGADGGLAALAALIYAAFPLGLGAYATEKYLTLPDIYDISTDPVSVPDWLSPPHSDQIWLKRNVDVTPEDREKQLAAYPELTGRRYEGALDRVLEAVRKVAKMSGITITKSSGDTEPGRDPEDKPVKPPPASDDAVADAPDIVPVPTPRPYDDDVAKLIRGANGVTLQGTTRTLILGLRFDIIIRLREEAETTFVDIRVASRYGQHDLGFSAEIAGDYLKALDAELLGIAGG
>NZ_CP025012.1|WP_105005216.1|734848_735241_-|hypothetical-protein
MISPEIAARPQASALGGIDHQSEPMLPMELLELELSLEGYAGGDAGFCEAVRQAAARSGGELLFDLPAGGLVQDCRRIAVLRIPDDGQDMRVVLALLDGHGTEIRMQAPDEETAPLVRFADAFIELLERI
>NZ_CP025012.1|WP_003557210.1|734587_734833_+|hypothetical-protein
MALRDRFSKKLSCPQCGNEGFAEASEVDDPKRKHPDFKVDQLPRGFGVQRPSNHQENFVIKCECGRKFPFRSVAEAAAERR
>NZ_CP025012.1|WP_003546062.1|734234_734432_-|hypothetical-protein
MPNRDPIPTPNADTPRGPTPTPGIPDPIQQKPPLTPAQDPADTKNPQDPPLNPALLPIGDPAGAA
>NZ_CP025012.1|WP_105005215.1|733691_733970_-|hypothetical-protein
MRIRLLITVMATIVAGLSACQTMTPEERRAADEQRCLSYGFRRGTDGFATCLQRIDLDRRAESRAQSAEMMNNMAWELNGPYIYRDRWRRHH
>NZ_CP025012.1|WP_105005214.1|730948_733654_+|pyruvate,-phosphate-dikinase
MTKWVYRFGDGQAEGRARDHEILGGKGANLAEMCALGLPVPPGLTIVSDACNTYYKNGRHIEDAVKAEVRAGISAIEAVTGRHFGSVSQPLLLSVRSGARVSMPGMMDTVLNLGLNDETVQALGHDAGDARFAWDSYRRFIQMYADVVMGLGNDAFEEILEDEKAKLGHEFDTELSASEWQHIVSLYKKLIEEELEQEFPQDPEVQLWGAVGAVFSSWMSARAVTYRQLHNIPEGWGTAINIQAMVFGNLGNASATGVAFTRNPSTGESALYGEFLVNAQGEDVVAGIRTPQSITEEGRISSGSEKPSMEKLMPEAFRELCRICTELEIHYRDMQDIEFTIERGRLWMLQTRSGKRSTRAAMKIAVDMVDEGVITEDEAVLRIEPSSLDQLLHPTIDPRVTRQVIGTGLPASPGAATGAIVFTAEEAVEAESEGRKVILLRVETSPEDIHGMHAAEGILTTRGGMTSHAAVVARGMGIPCVVGAGTMRIDQRNERLLGVGVTLKKGDIITIDGSAGQVLKGEVPMIQPALSGDFGRIMGWADRARRMTVRTNADTPADALAARSFGAEGIGLCRTEHMFFEGERIHVMREMILAVDEKGRRVALDKLLPMQRLDFTGLFTVMHGLPVTIRLLDPPLHEFLPKTDDEVAEVAFAMGMEASVLRQRVDALHEFNPMLGHRGCRLAISYPEIVEMQARAIFEAAIAAAQETGAAVVPEIMVPLVGLRSELDYVKARIDDVAGDVMSEAGMKIDYLVGTMIELPRAALRAHVIAEVAEFFSFGTNDLTQTTFGISRDDASAFIPTYQRKGIIEHDPFISLDFDGVGELISIAAERGRRTRNDMKLGICGEHGGDPASIRFCETIGLDYVSCSPFRVPIARLAAAQAVISGLEEIRRGPKDLRGSL
>NZ_CP025012.1|WP_105005212.1|726583_730045_+|chromosome-segregation-protein-SMC
MKFNKLRLVGFKSFVEPTEFIIERGLTGVVGPNGCGKSNLVEALRWVMGENSYKNMRASGMDDVIFSGSGNRPARNTAEVALYLDNGERTAPAAFNDSDEIQVTRRIEREQGSLYRINGKESRAKDVQLLFADASTGARSPSMVGQGRIGELIQAKPQARRQLLEEAAGISGLHSRRHEAELRLRAAEGNLERLDDVTSQLESQIESLKRQARQANRFKTLSADIRAREAMLLHIRWVQAKEAEAEADSALNQATSVVAEKAQMQMEAAKNQGIASLKLPELREGEARAAAALQRLQIARSQLEEDAGRILRRRDELTRRLAQLAEDISREERLVADNAVILARLDAEEAEILEILADSGRYAEETREAFEEAAAKLADSERIFTQLTAERAEAAAGRNQLERAIRDLTDRRMRLERQMDEANQELSAVGEKIAGLPDPDEKRAIVEAGEIAVADAEAAVQVVDQALASARQTEALSRAPVDQARSSLNALETEARTISRMLAAGAAAGKFPPVADELKVDRGFETALGAALGDDLESPLDAEAPAHWSDNGDGAADPALPSGVAPLLTHVRAPAALTRRLRQIGLVAEGEAQSLMAALKPGQRLVTKEGAVYRWDGHVTGADAPSAAALRLAQKNRLAELESEAALARDVLAEAEERQAAAAEAIRAEERRLAEARDMSRLSARHLAEARDALAAAERASGDLIRRRDVVSEAASQLRAQLEEIAVQEENARIELEDAPDLTAIDERLRFQQAEVATDRGALAESRARHESLARENEARQRRIMAIGQERDTWRQRAASAEDHVATLREREEEAREEAAELELAPDEFDDKRRALLSELQKAEEARRQASDLLAEAERIQREADQKATTALSELAERRERRGRAEERLVSAREKRQESEGRIREVLNVAPHEALQLTGRPTMQALPDPREVERELERLRIERERLGAVNLRADEEQKELSEKLEALIKERDDVIDAIRKLRGAIQSLNREGRERLIAAFDIVNAQFQRLFTHLFGGGTAELQLIESDDPLEAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDHNVERYCNLMDEMAASTETRFVIITHNPITMARMNRLFGVTMAEQGVSQLVSVDLQMAERLREIA
>NZ_CP025012.1|WP_105005211.1|725710_726487_+|DsbA-family-protein
MQMSEMQLTKRRLLSGIAIAAAAVALVACNDSKDAADASSSGKTMADGTNVDTMQTAATAATEMPESDGDVDMAEVLKPGTLPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTFDTIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQQIWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFLINGKRYSGDMPVETLSKLIDSLL
>NZ_CP025012.1|WP_105005210.1|725278_725503_+|TraY-domain-containing-protein
MLVLQLPPDIEARLIELSKRTGRSKSFYVRQAILAHLDDLEDVYLAERRLEELRRDEGDTVPLAELTARYGLDD
>NZ_CP025012.1|WP_105005209.1|724854_725220_-|hypothetical-protein
MHSLTKAFLYYVLIASVALAMNVTSAHASEDGGNIVFNQMLRCLKLPADAPSAYNFLIVAVIKDGSADFLSVNFRTPPSEWEKTAAPLIADAITQCEPYSSISGRMEFAVTRELIEAGSKN
>NZ_CP025012.1|WP_105005217.1|736929_738651_-|DUF4166-domain-containing-protein
MSDDRFSLLIIGGYGTFGGRLARLLGDEPRLRLLVAGRSLEKADDFVADLRTPKDGAEGLGSNNLGAMVQAVSFDRDGDLTEQLTRLRPHLVVDASGPFQTFGKDAYKVVEACIGLDIDYADIADSTGFVAGIGGLDAAARAQGTFALSGLSSLPALSFAALDAMAPHFSRIETVSAGIAPSAHVRIGLNVVRAIATYAGRQVTVLRDGRPASGRGLIDAMRVTVAPPGVAPLRSRKFLLVDAPDLALLPQHLADLKSSFTGVGTEPQPLQHLLSLAARLVRLTLLPSLLPFARLLQRASHAFAIGEHRGGMFVRVGGLDHAGQRLSCGWHLIAEGDDGPFIPIIGVDALVRRLLTGTRPENGARPAAGELQLADFEAAFRRFSITSGIRMECEEAPLPLYRRILGSAWERLPPALAALHAGGARVASGRARIERGGGLLARIVAGVIGFPKAGEDVPVTVRFVADGDKEIWTRDFGGTVFRSWQAEGKGRDRHLLAEVFGPFRVLMALVPDGEKLRLVVRSWRFFGIPLPMFLAPGGDTYEEERDGRFHFHVEIGGRLTGLVVRYTGWLVVE
>NZ_CP025012.1|WP_105008079.1|738647_739100_-|DUF393-domain-containing-protein
MTPQADYSYRNDPDVPAFTDDRPLIIFDGECVFCSGWVKFALKHDKRQRYRFLAAQTPLGEALYRHYGLHARDYETNILIENGRAFFKSDGSIRMVAGLGFPYSLIKLFRLLPRRAANALYEFIARNRLKIAGRQSCMVPTPEQRSRFIT
>NZ_CP025012.1|WP_105005218.1|739116_740034_-|MBL-fold-metallo-hydrolase
MDSPAFDLAFEPAYGQAVPVVSGVERVTVNNPGPFTFFGTNSYIVGSSSVAVIDPGPEDEAHYQALMAALAGRAVTHIFVSHTHRDHSPLAKRLQAATGAVTVGQGPHRPARPLREGEINPFSESSDLSFVPDIALGDGQTLSGDGWALTAVLTPGHTANHAAFALAGRDILFSGDHVMAWSTSIVAPPDGSMADYMASLDRLIERDDRLLLPGHGGPVTEPSSFLKALKAHRLRREQAVLARVRAGDERITEMVKVIYRDTDPKLHGAAALSVLAHIEDLLERGEIAADGPPTLAATYRPAPRS
>NZ_CP025012.1|WP_027690384.1|740309_741473_-|IS481-family-transposase
MDERLKFVARVLDGEKIAALCREFGISRKTGHKIISRYNDSGLEGLTDRSRRPYRHANQLPFQIEKLIVRTKQDKPNWGAPKIRERLARLYPDVHTPAISTVHAVLDRNGLVKHGRRRRNRAEGTALSNPGLPNDLWCADYKGEFMLADKRYCYPLTITDFASRYLLACEALHTTKEVYAFTVFERVFKEFGLPKAIRTDNGVPFASPNGLFNLSRLAVWWLRLGIDIERIKPGHPQQNGRHERMHLTLKLETTKPAGDNFLQQQARFDDFVEEFNTERPHQALNMACPAECYDASPRAYRGLPDLDYPLHDQTVTVTTCGRICYKRKKINLSLVFAGQAVGIKQVEDHIWLTSFMDYDLGYFDDETCRLEPLPNPFGPKVLPMSQE
>NZ_CP025012.1|WP_105005219.1|741988_742363_+|nucleotidyltransferase-domain-containing-protein
MQALFETEESRFADILAAVKECASLFGDKVVAAWVFGSVARGEDNASSDLDVAFITDAPDIETIQNGSIDFLAAKGKELSFAPSINTLSITDLKRLRQSDDPLWKAFLNEGLVVLGPRPESITM
>NZ_CP025012.1|WP_017990577.1|742425_742791_+|hypothetical-protein
MIIARGFLESAKLQISSAQAGTLGNPIAATVVNAAIAYTDALTATFANKINQNDHAAVIKTLRDALGNRLPKSQETRLTRILGNKDLAQYGGRFMLLSDAESLFEQLKEYAEWVENEMTRR
>NZ_CP025012.1|WP_105005220.1|743043_744222_+|DUF4268-domain-containing-protein
MFRVDRTENRIARLAQRRFGELALRERDHLQEWLVHQPDALGEELLIIQKEFDGFDETRERLDLLALDKAGNLVVIENKLDDSGRDVTWQALKYTAYVSGLNKQQIVEIYQQYLDRYCGGGSAVERICEFIEVEELQETVLNPGNGQRMMFIAANFRREVTATVLWLLSRGIRAQCFRVVPYSFGDELFIDLQQIIPTPEAADYMIGISSKEVEETNAQGVQARRHQLRLRFWARALERLRADGITLFANVNPSRDHWLNAGSGVRGCPFTMAFARGEVRVEVNLARPDRDENKWLFDRLEADRSAIEARFGGEMSWSRLDERKQSRISYSHPFDGFEADNWPEMLNWLSEHIRKLEGAFRQPLAQYARSIPSVDETAEELARVSESLDPST
>NZ_CP025012.1|WP_105005221.1|744352_745132_-|SDR-family-NAD(P)-dependent-oxidoreductase
MSRIFITGSSDGLGLAAARTLMKEGHDVVLHARSRERASAISEISAATLGLVIGDLASTTETRSIAEQVNAIGRMDAVIHNAGIYLERSRGETPEGHAKTLAVNVLAPYLLTAWITRPDRLVYLTSGMHRSGSSALDDIDWKKRPWNASQAYSESKLYIATLAAAVARHWPNVLSNAVEPGWVPTKMGGAGAPDDLEMGHLTQTWLAASDTGAAKVSGGYWYHRQQREAAAEMTDVGFQDALVGRLAELTGVQLFADGS
>NZ_CP025012.1|WP_105005222.1|745605_746214_-|TetR/AcrR-family-transcriptional-regulator
MAGRREEKREDLKARLIEAARERIARDGLANLRARDITQDAGCALGGLYTVFSDLAELVIHVNSATLKALEARLTLDKAKDRPPTDRLRNLAQGYLSFAVEHRNLWKALFEHFPPESSPTPQWHLNEHLFLMDVIAEPLAELQPDMPPEDRAIRARTLFGAVHGVVSISLEGRFVGLPLERLAREVDELVQTIAAGAERRRG
>NZ_CP025012.1|WP_105005223.1|746325_747012_+|PspA/IM30-family-protein
MFKLISILLRGRAHDAEQALADCHAVPLLSQQIRDAAQSIQSARRSVAVAIAQNEQEKGQHATIVARIADLEVRASAALTKGNEGLAREAAEAIAYLEAERDASEKAQSQFTSAIDKLKGIVRASEARLQELQRGERLARATQEAQKLDVVVAGPGFATLDDAEETLARLRLRQSQNELTAAALKDMEGAIRPAGIIEKLANAGFGAPLRSSADDVLARLKSRITPAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	45281-45310	7	0.767
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	1361-1390	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	508559-508588	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	253387-253416	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	470243-470272	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	390838-390867	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	442943-442972	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	262194-262223	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	297497-297526	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	470245-470274	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	327070-327099	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	306752-306781	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	282105-282134	8	0.733
NZ_CP025012_3	3.1\|736541\|30\|NZ_CP025012\|CRISPRCasFinder	736541-736570	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	407160-407189	8	0.733
NZ_CP025012_1	1.1\|111038\|56\|NZ_CP025012\|CRISPRCasFinder	111038-111093	56	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	132194-132249	9	0.839

1. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
acgtccttgagccgcgccggcgcaacgcgc	Protospacer
  **   ********* .************

2. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

3. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

4. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

5. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

6. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

7. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

8. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

9. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

10. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

11. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

12. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

13. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

14. spacer 3.1|736541|30|NZ_CP025012|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 8, identity: 0.733

cagtgggtgagccgcgatggcgcaacgcgc	CRISPR spacer
tgatgggtgagccgcaatggcgcatcatga	Protospacer
...************.******** *..*

15. spacer 1.1|111038|56|NZ_CP025012|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 9, identity: 0.839

tgcgctaatgcatgacgcccggaagtgtgcggcggttccgggataacgacatgctc	CRISPR spacer
cataccaatgcatgtcgcccggaagtgtgcagcggttccgggataacgacatgcat	Protospacer
....*.******** ***************.*********************** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1264795 : 1273841

Escherichia_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105005626.1\|1264795_1266094_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	9.8e-99	51.5
WP_003547190.1\|1266103_1266580_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_105005627.1\|1266583_1267705_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.0e-35	32.9
WP_027685208.1\|1267704_1268316_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.6e-17	35.1
WP_027685207.1\|1268437_1269307_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	6.8e-96	59.2
WP_105005628.1\|1269317_1270205_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_105005629.1\|1270208_1271264_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.7e-96	51.8
WP_105005630.1\|1271270_1271849_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D8EQH2	Escherichia_phage	1.4e-36	41.0
WP_105005631.1\|1271873_1273841_-	hypothetical protein	A0A0G2Y9S0	Acanthamoeba_polyphaga_mimivirus	2.3e-06	28.1

DBSCAN-SWA_2

1333563 : 1344333

Bacillus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105008112.1\|1333563_1334817_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.0e-12	35.2
WP_003547334.1\|1335193_1335823_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.4e-63	59.2
WP_105005665.1\|1336125_1337403_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-132	58.6
WP_003547341.1\|1337805_1340223_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-204	49.4
WP_011651361.1\|1340429_1340705_+	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	7.1e-07	33.3
WP_105005666.1\|1341139_1342039_+	DMT family transporter	NA	NA	NA	NA
WP_105008113.1\|1342134_1344333_+	esterase-like activity of phytase family protein	M4SLV1	Cyanophage	9.2e-81	43.4

DBSCAN-SWA_3

1592661 : 1606046

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105008121.1\|1592661_1593675_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.8e-23	41.9
WP_105005818.1\|1593693_1594551_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.6e-34	38.5
WP_105005819.1\|1594547_1595264_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-40	47.0
WP_003538990.1\|1595447_1595639_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_027684916.1\|1595690_1596302_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_018241797.1\|1596298_1597126_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.2e-53	46.5
WP_105005820.1\|1597326_1598610_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	45.3
WP_105005821.1\|1598614_1599388_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.1e-23	30.2
WP_105005822.1\|1599384_1600038_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.2e-15	34.1
WP_105005823.1\|1600283_1601888_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_105005824.1\|1602033_1602906_-	ATP-binding protein	NA	NA	NA	NA
WP_003558894.1\|1603112_1603460_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
WP_105005825.1\|1603505_1606046_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.2e-57	48.2

DBSCAN-SWA_4

1857168 : 1868021

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105005992.1\|1857168_1860090_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
WP_018242013.1\|1860373_1860883_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.6e-44	72.9
WP_105005993.1\|1861026_1861572_+	hypothetical protein	NA	NA	NA	NA
WP_018242015.1\|1861594_1862242_-	MarC family protein	NA	NA	NA	NA
WP_105005994.1\|1862478_1865313_+	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	2.0e-75	42.2
WP_105005995.1\|1865948_1866236_-	hypothetical protein	NA	NA	NA	NA
WP_105005996.1\|1866372_1866867_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.8e-24	36.5
WP_105005997.1\|1866909_1867482_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.4e-43	53.2
WP_003559389.1\|1867511_1868021_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-45	59.4

DBSCAN-SWA_5

3028167 : 3042009

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017989039.1\|3028167_3030225_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6
WP_105006841.1\|3030795_3031143_-	GFA family protein	NA	NA	NA	NA
WP_105006842.1\|3031152_3032190_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
WP_105006843.1\|3032378_3033566_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	2.9e-36	27.8
WP_105006844.1\|3033732_3034461_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	8.9e-49	42.0
WP_105006845.1\|3034632_3036501_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	6.6e-72	34.4
WP_105006846.1\|3036500_3038510_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.9e-88	41.9
WP_105006847.1\|3039180_3040071_+	hypothetical protein	NA	NA	NA	NA
WP_012758386.1\|3040074_3040530_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	9.0e-15	38.7
WP_105008202.1\|3040803_3042009_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.1e-40	33.2

DBSCAN-SWA_6

3988371 : 3998352

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105007464.1\|3988371_3989082_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	2.3e-49	48.7
WP_018446446.1\|3989081_3989438_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_105007465.1\|3989434_3990163_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	1.5e-40	38.0
WP_105007466.1\|3990167_3991391_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	1.9e-14	33.1
WP_105008253.1\|3991494_3992469_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	1.4e-137	74.8
WP_105007467.1\|3992557_3994762_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	2.3e-212	52.1
WP_105007468.1\|3994740_3995145_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.5e-17	43.1
WP_018243700.1\|3995159_3995381_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.9e-17	52.1
WP_105007469.1\|3996048_3998352_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.7e-125	40.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025014

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3528

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027687669.1\|1163_2159_+	plasmid partitioning protein RepB	NA	NA	NA	NA
WP_105009218.1\|2313_3528_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	1.4e-17	28.3

DBSCAN-SWA_2

8104 : 10630

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009221.1\|8104_10630_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.3e-83	35.8

DBSCAN-SWA_3

29205 : 37109

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009231.1\|29205_31104_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.6e-23	28.8
WP_105009232.1\|31230_33039_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.1e-47	29.5
WP_105009233.1\|33703_35110_+	hypothetical protein	NA	NA	NA	NA
WP_105009234.1\|35180_37109_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	7.7e-07	21.6

DBSCAN-SWA_4

45401 : 48116

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009241.1\|45401_48116_-	ATP-binding cassette domain-containing protein	A0A1V0SJ29	Klosneuvirus	6.0e-05	24.2

DBSCAN-SWA_5

56083 : 65052

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009247.1\|56083_57973_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.2e-21	32.7
WP_105009248.1\|58128_59472_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_105009249.1\|59924_61262_+	nucleotide sugar dehydrogenase	M1HZW8	Acanthocystis_turfacea_Chlorella_virus	3.8e-37	30.5
WP_105009250.1\|61251_62427_-	DUF3095 domain-containing protein	NA	NA	NA	NA
WP_105009251.1\|62649_63129_+	hypothetical protein	NA	NA	NA	NA
WP_105009252.1\|63261_65052_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.1e-35	27.6

DBSCAN-SWA_6

89704 : 93242

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009273.1\|89704_90469_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-34	38.7
WP_105009274.1\|90513_91581_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_105009275.1\|91585_92416_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_018071491.1\|92474_93242_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	5.7e-22	33.6

DBSCAN-SWA_7

100774 : 102391

Caulobacter_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009285.1\|100774_101284_+	DUF1643 domain-containing protein	K4JQR8	Caulobacter_virus	3.4e-23	40.0
WP_105009286.1\|101243_102391_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.4e-64	46.7

DBSCAN-SWA_8

110088 : 111888

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009290.1\|110088_111888_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.0e-13	35.1

DBSCAN-SWA_9

121473 : 122070

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009298.1\|121473_122070_-	SOS response-associated peptidase	Q8W6R8	Burkholderia_virus	9.7e-09	28.2

DBSCAN-SWA_10

129743 : 134853

Sinorhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018496977.1\|129743_129944_-	hypothetical protein	A0A291AUQ4	Sinorhizobium_phage	1.6e-08	56.6
WP_105009305.1\|130528_131572_+	ATP-dependent DNA ligase	A0A068CDF3	Rhizobium_phage	5.1e-138	69.8
WP_105009306.1\|131585_131885_-	hypothetical protein	NA	NA	NA	NA
WP_105009307.1\|131885_132176_-	CopG family transcriptional regulator	NA	NA	NA	NA
WP_105009309.1\|133493_134195_+	DUF899 family protein	NA	NA	NA	NA
WP_105009310.1\|134223_134853_-	DnaJ domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	1.9e-10	48.3

DBSCAN-SWA_11

138131 : 139667

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009313.1\|138131_139667_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	5.3e-75	36.5

DBSCAN-SWA_12

146757 : 149018

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009321.1\|146757_147534_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.9e-30	35.7
WP_105009322.1\|147530_149018_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	2.3e-43	32.6

DBSCAN-SWA_13

156459 : 162549

Tetraselmis_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009327.1\|156459_158130_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	1.1e-49	31.2
WP_105009328.1\|158327_158591_-	hypothetical protein	NA	NA	NA	NA
WP_105009329.1\|158592_160227_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.4e-94	39.8
WP_105009330.1\|160656_162549_+	HAMP domain-containing histidine kinase	A0A2K9L0Z8	Tupanvirus	6.2e-09	24.5

DBSCAN-SWA_14

172662 : 173505

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009653.1\|172662_173505_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	3.0e-08	35.5

DBSCAN-SWA_15

179700 : 181368

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009654.1\|179700_181368_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-16	32.7

DBSCAN-SWA_16

202844 : 207262

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009365.1\|202844_205088_-	EAL domain-containing protein	G3MA91	Bacillus_virus	7.6e-14	30.8
WP_105009366.1\|205463_206276_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-14	31.7
WP_003548893.1\|206272_207262_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-12	23.4

DBSCAN-SWA_17

222844 : 228823

Diadromus_pulchellus_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009656.1\|222844_223639_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.5e-09	27.8
WP_105009377.1\|223734_225891_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_105009378.1\|225899_226907_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	2.6e-30	29.4
WP_105009379.1\|226903_227782_+	DNA polymerase domain-containing protein	NA	NA	NA	NA
WP_105009380.1\|227794_228526_-	glutathione S-transferase	NA	NA	NA	NA
WP_105009657.1\|228532_228823_-	DUF3175 domain-containing protein	A0A0F6TH17	Sinorhizobium_phage	3.3e-23	61.3

DBSCAN-SWA_18

233219 : 233861

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009382.1\|233219_233861_-	UdgX family uracil-DNA binding protein	A0A2I6PIA1	Pseudomonas_phage	9.7e-15	34.6

DBSCAN-SWA_19

240245 : 246233

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009385.1\|240245_244883_+	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	7.8e-13	25.1
WP_105009386.1\|245342_246233_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.2e-17	27.0

DBSCAN-SWA_20

250460 : 251591

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009391.1\|250460_251591_+	hypothetical protein	A0A2L0V0H8	Agrobacterium_phage	7.9e-20	31.3

DBSCAN-SWA_21

256356 : 263960

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009397.1\|256356_256773_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.2e-05	32.3
WP_105009398.1\|256812_257610_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-24	33.5
WP_105009399.1\|257735_258620_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_105009400.1\|258634_259498_+	TIM barrel protein	NA	NA	NA	NA
WP_158686977.1\|259781_259943_+	hypothetical protein	NA	NA	NA	NA
WP_105009401.1\|259984_260707_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.5e-19	34.0
WP_105009402.1\|260920_261175_+	cupin domain-containing protein	NA	NA	NA	NA
WP_105009403.1\|261391_262402_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158686978.1\|262430_263960_+	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.0e-09	26.3

DBSCAN-SWA_22

277407 : 281762

Streptomyces_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009415.1\|277407_280623_+	DNA polymerase III subunit alpha	A0A0K1Y8T6	Streptomyces_phage	7.4e-87	26.8
WP_105009286.1\|280614_281762_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.4e-64	46.7

DBSCAN-SWA_23

304632 : 308954

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009426.1\|304632_304980_-	hypothetical protein	A0A0S2MVJ2	Bacillus_phage	3.1e-07	37.0
WP_105009427.1\|305313_305646_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_105009428.1\|305795_305999_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	9.5e-09	47.1
WP_105009430.1\|306517_307663_+	hypothetical protein	NA	NA	NA	NA
WP_105009431.1\|307682_308954_+	hypothetical protein	A0A2L0V0P9	Agrobacterium_phage	3.9e-07	37.3

DBSCAN-SWA_24

321346 : 322966

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105005954.1\|321346_322966_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-53	33.2

DBSCAN-SWA_25

326489 : 327662

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009448.1\|326489_327662_+	hypothetical protein	A0A0B5JD48	Pandoravirus	2.3e-14	32.0

DBSCAN-SWA_26

330831 : 336345

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009450.1\|330831_331890_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.3e-24	35.0
WP_105009451.1\|331960_332713_+	metallophosphatase	NA	NA	NA	NA
WP_105009452.1\|332818_334051_+	peptidase T	NA	NA	NA	NA
WP_105009453.1\|334243_335080_-	cell wall hydrolase	A0A142EZU6	Stenotrophomonas_phage	1.7e-06	30.7
WP_105009454.1\|335304_336345_-	sulfate/molybdate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-31	37.8

DBSCAN-SWA_27

341117 : 352885

Bacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009457.1\|341117_341810_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-21	31.1
WP_105009458.1\|341806_344515_-	sensor histidine kinase KdpD	Q8QNA2	Ectocarpus_siliculosus_virus	3.8e-12	34.6
WP_105009459.1\|344625_345195_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_105009460.1\|345229_347290_-	potassium-transporting ATPase subunit KdpB	E4ZFI9	Streptococcus_phage	3.2e-35	27.9
WP_105009461.1\|347499_349203_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_003547774.1\|349272_349362_-	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_105009463.1\|349853_350897_+	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	4.9e-08	24.0
WP_105009464.1\|350910_351480_-	DedA family protein	NA	NA	NA	NA
WP_105009465.1\|351523_352885_-	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	4.8e-64	35.2

DBSCAN-SWA_28

357524 : 363514

Bacillus_virus(25.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027687445.1\|357524_358307_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-15	28.1
WP_105009468.1\|358306_359008_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.4e-13	27.5
WP_105009469.1\|359012_359900_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_105009470.1\|359901_360891_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_105009471.1\|361027_362623_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	4.4e-56	31.2
WP_105009472.1\|362632_363514_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	1.6e-23	29.6

DBSCAN-SWA_29

368092 : 373853

Amsacta_moorei_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009478.1\|368092_369628_-	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.3e-12	25.8
WP_105009479.1\|369701_370697_-	rhamnose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018071139.1\|370745_371558_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.1e-18	28.4
WP_105009480.1\|371756_373853_+	bifunctional rhamnulose-1-phosphate aldolase/short-chain dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	3.5e-05	28.6

DBSCAN-SWA_30

384277 : 385786

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009490.1\|384277_385786_-\|holin	choline-sulfatase	A0A1V0SA98	Catovirus	1.0e-22	25.1

DBSCAN-SWA_31

388800 : 390500

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009495.1\|388800_389700_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-17	31.4
WP_105009496.1\|389696_390500_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-12	25.2

DBSCAN-SWA_32

398733 : 401363

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009504.1\|398733_400422_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	27.6
WP_105009505.1\|400418_401363_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	3.3e-27	29.6

DBSCAN-SWA_33

412870 : 414706

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009515.1\|412870_414706_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	29.2

DBSCAN-SWA_34

429501 : 431130

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009526.1\|429501_431130_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-25	34.2

DBSCAN-SWA_35

442064 : 443198

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009533.1\|442064_443198_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.5e-23	35.0

DBSCAN-SWA_36

453474 : 461136

Bordetella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009543.1\|453474_454215_+	helix-turn-helix transcriptional regulator	A0A291LAM3	Bordetella_phage	7.3e-14	46.1
WP_105009544.1\|454318_455320_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_105009545.1\|455369_456185_-	oxidoreductase	NA	NA	NA	NA
WP_105009546.1\|456275_456752_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_105009547.1\|456838_458860_-	beta-N-acetylhexosaminidase	A0A2H4UUW7	Bodo_saltans_virus	5.2e-06	25.3
WP_105009548.1\|458915_459386_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_105009549.1\|459397_460324_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-18	31.4
WP_105009550.1\|460320_461136_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.6e-12	24.7

DBSCAN-SWA_37

472149 : 475689

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009668.1\|472149_472905_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-20	33.9
WP_105009558.1\|472910_473747_-	5-dehydro-4-deoxy-D-glucuronate isomerase	NA	NA	NA	NA
WP_003548073.1\|474371_474518_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_105009559.1\|474708_475689_-	3'-5' exonuclease	A0A223W0B0	Agrobacterium_phage	6.6e-31	36.9

DBSCAN-SWA_38

478764 : 479655

Vaccinia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009563.1\|478764_479655_-	haloalkane dehalogenase	B9U1C3	Vaccinia_virus	1.2e-44	35.6

DBSCAN-SWA_39

487570 : 487780

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003548109.1\|487570_487780_+	cold-shock protein	A0A218MMZ6	uncultured_virus	8.9e-10	54.7

DBSCAN-SWA_40

496952 : 497837

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009575.1\|496952_497837_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.6e-10	38.7

DBSCAN-SWA_41

501492 : 502401

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009578.1\|501492_502401_-	glutamine amidotransferase family protein	F2Y1G4	Organic_Lake_phycodnavirus	1.1e-06	29.2

DBSCAN-SWA_42

535105 : 535876

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009669.1\|535105_535876_+	glucose 1-dehydrogenase	A0A0N9R355	Chrysochromulina_ericina_virus	1.8e-07	23.4

DBSCAN-SWA_43

550001 : 553725

Yaba_monkey_tumor_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009612.1\|550001_551186_-	serpin family protein	Q6TUM5	Yaba_monkey_tumor_virus	5.8e-13	26.6
WP_105009613.1\|551199_553725_-\|protease	trypsin-like serine protease	Q6JKF3	Neodiprion_sertifer_nucleopolyhedrovirus	2.6e-26	33.1

DBSCAN-SWA_44

569239 : 569644

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027687649.1\|569239_569644_+	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	5.9e-18	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP025016

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

197533 : 206612

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105010153.1\|197533_198589_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.7e-28	35.5
WP_105010154.1\|198588_199368_+	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	1.4e-07	34.3
WP_105010155.1\|199351_200356_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.0e-19	27.7
WP_105010156.1\|200355_201165_+	inositol monophosphatase	NA	NA	NA	NA
WP_105010157.1\|201214_202870_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.8e-19	36.7
WP_105010158.1\|202999_203872_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_105010159.1\|203935_205030_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_105010160.1\|205041_205824_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	31.6
WP_105010161.1\|205820_206612_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-16	31.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP025015

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4989

Ochrobactrum_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009672.1\|1220_2258_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	4.0e-34	33.0
WP_105009673.1\|2448_3663_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	7.0e-22	29.9
WP_105009674.1\|3895_4630_+	NYN domain-containing protein	NA	NA	NA	NA
WP_105009675.1\|4782_4989_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	6.7e-10	48.3

DBSCAN-SWA_2

11241 : 28178

Enterobacteria_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009679.1\|11241_13458_+	CHAT domain-containing protein	A5LH58	Enterobacteria_phage	4.6e-48	27.3
WP_105009680.1\|13483_14878_-	thiamine biosynthesis protein ThiF	NA	NA	NA	NA
WP_105009681.1\|14874_15357_-	hypothetical protein	NA	NA	NA	NA
WP_105009682.1\|15349_15838_-	hypothetical protein	NA	NA	NA	NA
WP_105009683.1\|15842_16340_-	hypothetical protein	NA	NA	NA	NA
WP_105009684.1\|16439_19793_-	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	7.0e-40	25.5
WP_105009685.1\|19789_20431_-	hypothetical protein	NA	NA	NA	NA
WP_105009686.1\|20427_21222_-	hypothetical protein	NA	NA	NA	NA
WP_105009687.1\|21628_24703_-	AAA family ATPase	A0A1Z1LYW7	Serratia_phage	8.8e-05	28.1
WP_105010005.1\|24699_25842_-	exonuclease SbcCD subunit D	A0A076G8Y3	Bacillus_phage	5.6e-05	21.7
WP_158686989.1\|25919_26711_+	hypothetical protein	NA	NA	NA	NA
WP_105009689.1\|27038_28178_-	hypothetical protein	J9Q803	Salmonella_phage	9.7e-34	30.8

DBSCAN-SWA_3

33849 : 34386

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158686992.1\|33849_34386_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2H4J8X5	uncultured_Caudovirales_phage	9.9e-05	30.3

DBSCAN-SWA_4

58227 : 58431

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012760580.1\|58227_58431_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.0e-10	55.2

DBSCAN-SWA_5

73470 : 74025

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009706.1\|73470_74025_+	hypothetical protein	K4JS60	Caulobacter_phage	1.7e-31	44.2

DBSCAN-SWA_6

77227 : 78829

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009709.1\|77227_78829_-	adenylosuccinate synthase	A0A0A7HE19	Vibrio_phage	1.0e-28	29.2

DBSCAN-SWA_7

93832 : 96280

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018484500.1\|93832_94582_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-10	25.0
WP_105009720.1\|94574_95279_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-13	25.6
WP_105009721.1\|95395_96280_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	3.4e-10	38.0

DBSCAN-SWA_8

99979 : 100441

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018484493.1\|99979_100441_-	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	9.1e-23	39.7

DBSCAN-SWA_9

103865 : 104891

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018484489.1\|103865_104891_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	7.6e-62	37.9

DBSCAN-SWA_10

114834 : 126260

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032982976.1\|114834_116049_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	5.7e-24	30.0
WP_062942557.1\|116085_116775_-	ABC transporter permease	NA	NA	NA	NA
WP_018484474.1\|116784_117507_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_105009735.1\|117579_118341_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_105009736.1\|118377_119160_-	ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	9.1e-07	25.4
WP_105009737.1\|119343_120030_-	B3/4 domain-containing protein	NA	NA	NA	NA
WP_105009738.1\|120073_120697_+	helix-turn-helix domain-containing protein	I3VYZ1	Thermoanaerobacterium_phage	3.0e-05	43.1
WP_105009739.1\|120925_122098_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	2.6e-18	32.0
WP_105009740.1\|122179_123532_-	PAS domain S-box protein	NA	NA	NA	NA
WP_105009741.1\|123793_124624_+	alpha/beta fold hydrolase	A0A1D8ET90	Mycobacterium_phage	2.5e-10	29.1
WP_105009742.1\|124637_126260_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	4.3e-43	34.7

DBSCAN-SWA_11

131482 : 132559

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009749.1\|131482_132559_+	helix-turn-helix domain-containing protein	V9LZQ4	Vibrio_phage	2.4e-05	27.7

DBSCAN-SWA_12

140166 : 142655

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009756.1\|140166_141252_-	His-Xaa-Ser system radical SAM maturase HxsC	S5WIP3	Leptospira_phage	5.6e-47	35.4
WP_105009757.1\|141248_142655_-	His-Xaa-Ser system radical SAM maturase HxsB	S5VT21	Leptospira_phage	6.8e-29	22.0

DBSCAN-SWA_13

166016 : 233247

Stx2-converting_phage(22.22%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009776.1\|166016_166721_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_105009777.1\|166799_167141_-	hypothetical protein	NA	NA	NA	NA
WP_158686998.1\|168621_170364_+	two-component system VirA-like sensor kinase	Q8QKV7	Ectocarpus_siliculosus_virus	5.3e-07	36.2
WP_105010009.1\|170981_172256_-	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	4.7e-61	38.0
WP_105009780.1\|173874_174219_+	hypothetical protein	NA	NA	NA	NA
WP_018496488.1\|174342_174762_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_018496487.1\|174761_174998_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_105009781.1\|175282_175528_-	hypothetical protein	NA	NA	NA	NA
WP_105009782.1\|176130_177198_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_105009783.1\|177673_178876_+	cytochrome P450	NA	NA	NA	NA
WP_105009784.1\|179821_180388_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_158686999.1\|180728_180923_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_105009786.1\|181491_182538_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_024323553.1\|182809_183196_+\|transposase	transposase	NA	NA	NA	NA
WP_158687000.1\|183289_183538_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_105010010.1\|183922_184033_+	hypothetical protein	NA	NA	NA	NA
WP_105009788.1\|184320_185682_-	hypothetical protein	NA	NA	NA	NA
WP_105009789.1\|185678_186128_-	hypothetical protein	NA	NA	NA	NA
WP_105009790.1\|186124_186562_-	hypothetical protein	NA	NA	NA	NA
WP_105009791.1\|186554_187262_-	hypothetical protein	NA	NA	NA	NA
WP_105009792.1\|187398_187788_+	Y4oB family protein	NA	NA	NA	NA
WP_105010011.1\|187768_188488_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_105009793.1\|188477_188861_+	hypothetical protein	NA	NA	NA	NA
WP_105009794.1\|188881_191530_+	hypothetical protein	NA	NA	NA	NA
WP_105009795.1\|191526_194838_+	UvrD-helicase domain-containing protein	E3T5J8	Cafeteria_roenbergensis_virus	5.4e-08	28.7
WP_105009796.1\|195328_196990_-	hypothetical protein	NA	NA	NA	NA
WP_105009797.1\|197029_198643_-	hypothetical protein	NA	NA	NA	NA
WP_105009798.1\|199199_200120_-	hypothetical protein	NA	NA	NA	NA
WP_105009799.1\|200160_201090_-	hypothetical protein	NA	NA	NA	NA
WP_105009800.1\|201209_201911_-	hypothetical protein	NA	NA	NA	NA
WP_105010012.1\|201948_202833_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_158687001.1\|203041_204949_+	hypothetical protein	NA	NA	NA	NA
WP_105009802.1\|204980_206189_+	hypothetical protein	NA	NA	NA	NA
WP_105009803.1\|207094_207475_+\|transposase	transposase	NA	NA	NA	NA
WP_105009804.1\|207471_207819_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.7e-27	54.9
WP_105010013.1\|207891_209457_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.9e-113	44.8
WP_105009805.1\|209456_209762_+	hypothetical protein	NA	NA	NA	NA
WP_105010014.1\|210075_211443_-	hypothetical protein	M4QR14	Vibrio_phage	6.5e-08	56.0
WP_105009806.1\|211544_212342_-	NYN domain-containing protein	NA	NA	NA	NA
WP_012760580.1\|212412_212616_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.0e-10	55.2
WP_105009807.1\|212903_214181_-	hypothetical protein	NA	NA	NA	NA
WP_105010015.1\|214249_214747_-	hypothetical protein	NA	NA	NA	NA
WP_105009808.1\|215680_216454_-	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	9.5e-41	38.5
WP_077987990.1\|217642_217843_+	hypothetical protein	NA	NA	NA	NA
WP_028734784.1\|219450_220278_+	hypothetical protein	NA	NA	NA	NA
WP_105009809.1\|220274_221135_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_105009810.1\|221274_221493_-	hypothetical protein	NA	NA	NA	NA
WP_028734789.1\|222835_223546_-	hypothetical protein	NA	NA	NA	NA
WP_028734790.1\|223951_224263_-	hypothetical protein	NA	NA	NA	NA
WP_105009811.1\|225627_226557_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_105010017.1\|227119_227338_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_105009812.1\|227743_228694_+	cysteine synthase family protein	A0A1X9I5K7	Streptococcus_phage	1.1e-49	36.3
WP_105009813.1\|229221_230040_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_158687002.1\|230398_230566_+	hypothetical protein	NA	NA	NA	NA
WP_105009814.1\|230562_231630_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_105009815.1\|232359_233247_+\|protease	omptin family outer membrane protease	NA	NA	NA	NA

DBSCAN-SWA_14

242465 : 244751

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009823.1\|242465_244751_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.1e-80	31.1

DBSCAN-SWA_15

264878 : 268092

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009840.1\|264878_266153_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.4e-25	27.3
WP_105009841.1\|266700_267402_+	hypothetical protein	NA	NA	NA	NA
WP_105009842.1\|267867_268092_+	helix-turn-helix transcriptional regulator	A0A1I9KF49	Aeromonas_phage	1.7e-06	41.9

DBSCAN-SWA_16

276477 : 393614

Stx2-converting_phage(19.05%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009844.1\|276477_276798_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	6.7e-17	46.7
WP_105009845.1\|277095_278340_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_105009846.1\|278378_278759_+	RidA family protein	NA	NA	NA	NA
WP_105010019.1\|279576_280116_+	AAA family ATPase	A0A097BYE2	Leuconostoc_phage	4.3e-08	34.3
WP_105009847.1\|280292_281714_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.6e-68	34.4
WP_105009849.1\|282395_282908_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_105009850.1\|283046_284450_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.9e-16	25.9
WP_105009851.1\|284618_286028_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_105009852.1\|286109_287411_+	aspartate ammonia-lyase	NA	NA	NA	NA
WP_105009853.1\|287705_288968_+	CapA family protein	S4VS02	Pandoravirus	1.1e-14	25.2
WP_105005956.1\|289004_289391_+\|transposase	transposase	NA	NA	NA	NA
WP_105005955.1\|289387_289732_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_105005954.1\|289807_291427_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-53	33.2
WP_105009854.1\|291685_292855_-	amidohydrolase	NA	NA	NA	NA
WP_105009855.1\|293147_294074_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.0e-08	33.3
WP_105009856.1\|294309_295743_-	amidohydrolase family protein	NA	NA	NA	NA
WP_105009857.1\|295780_296953_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_105009859.1\|297789_298497_-	hypothetical protein	NA	NA	NA	NA
WP_105009860.1\|298588_299662_-	DUF2817 domain-containing protein	NA	NA	NA	NA
WP_105009861.1\|299792_300971_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_105009862.1\|301183_302959_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_105009863.1\|302976_304098_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.6e-25	32.5
WP_105009864.1\|304187_305291_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_105009865.1\|305362_306526_-	amidohydrolase	NA	NA	NA	NA
WP_105009866.1\|307024_308053_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.0
WP_105009867.1\|308049_309057_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-11	25.1
WP_105009868.1\|309058_309940_-	ABC transporter permease	NA	NA	NA	NA
WP_105010020.1\|309941_310883_-	ABC transporter permease	NA	NA	NA	NA
WP_105009869.1\|310888_312463_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_105009870.1\|312846_314970_-	S9 family peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	3.6e-13	29.9
WP_105009871.1\|315984_316998_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_105009872.1\|317865_318945_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_105009873.1\|318932_320015_+	MFS transporter	NA	NA	NA	NA
WP_158687004.1\|320071_320419_+	hypothetical protein	NA	NA	NA	NA
WP_105009875.1\|321172_322126_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_105009876.1\|322351_323053_+	CoA transferase subunit A	NA	NA	NA	NA
WP_105009877.1\|323060_323693_+	3-oxoacid CoA-transferase subunit B	NA	NA	NA	NA
WP_105009878.1\|323693_324977_+	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_105009879.1\|324981_326160_+	thiolase family protein	NA	NA	NA	NA
WP_105009880.1\|326209_326698_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_105009881.1\|326841_328149_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_105009882.1\|329102_330920_+	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_105009883.1\|331348_332452_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_105009884.1\|332606_333701_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.7e-25	33.8
WP_105009885.1\|333718_335491_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_105009886.1\|335890_336187_-	hypothetical protein	NA	NA	NA	NA
WP_105009887.1\|336186_337809_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.0e-101	39.6
WP_003554417.1\|337872_338220_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.9e-26	55.2
WP_105009888.1\|338216_338516_-\|transposase	transposase	NA	NA	NA	NA
WP_105008341.1\|340310_341684_-\|transposase	ISNCY family transposase	A1YTJ2	Porcine_endogenous_retrovirus	2.3e-05	26.3
WP_105009889.1\|341938_342964_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_105009890.1\|343487_344060_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_105009891.1\|344994_346074_-	lysine-2,3-aminomutase-like protein	NA	NA	NA	NA
WP_105009892.1\|346545_347256_-	hypothetical protein	NA	NA	NA	NA
WP_105009893.1\|347254_349318_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	1.5e-08	23.8
WP_158687005.1\|349329_350037_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.9e-42	44.4
WP_105009895.1\|350115_350250_-\|transposase	transposase	NA	NA	NA	NA
WP_105009896.1\|350665_351901_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_105010022.1\|352008_353061_-	lysine 2,3-aminomutase	NA	NA	NA	NA
WP_105009897.1\|353265_354537_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_105009898.1\|354882_356517_-	MFS transporter	NA	NA	NA	NA
WP_105009899.1\|357594_359238_-	MFS transporter	NA	NA	NA	NA
WP_105009900.1\|361627_362809_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_105010023.1\|362841_363255_-	hypothetical protein	NA	NA	NA	NA
WP_105009901.1\|363720_364902_-	amidohydrolase	NA	NA	NA	NA
WP_105009902.1\|365092_365644_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_105010024.1\|365653_366979_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_105009903.1\|367209_368094_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_105005956.1\|368691_369078_+\|transposase	transposase	NA	NA	NA	NA
WP_105005955.1\|369074_369419_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_105005954.1\|369494_371114_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-53	33.2
WP_105009904.1\|373086_374232_-	response regulator	NA	NA	NA	NA
WP_105009905.1\|374212_374686_-	response regulator	NA	NA	NA	NA
WP_158687006.1\|374682_377661_-	hypothetical protein	NA	NA	NA	NA
WP_158687007.1\|378293_378590_+\|transposase	transposase	NA	NA	NA	NA
WP_105009909.1\|379199_380408_+	aspartate transaminase	NA	NA	NA	NA
WP_105010025.1\|381372_382350_+	ATP-binding protein	R4TQL5	Phaeocystis_globosa_virus	2.9e-18	29.8
WP_105009911.1\|383011_383863_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_105009912.1\|383880_384981_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_105009913.1\|384999_386307_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_105009914.1\|386319_386616_+	ferredoxin family protein	NA	NA	NA	NA
WP_105009915.1\|386806_388366_+	nif-specific transcriptional activator NifA	NA	NA	NA	NA
WP_105009916.1\|388563_390042_+	nitrogenase cofactor biosynthesis protein NifB	NA	NA	NA	NA
WP_017958634.1\|390071_390266_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_027667872.1\|390525_390732_+	putative nitrogen fixation protein NifT	NA	NA	NA	NA
WP_105009805.1\|390946_391252_-	hypothetical protein	NA	NA	NA	NA
WP_105010013.1\|391251_392817_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.9e-113	44.8
WP_105009804.1\|392889_393237_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.7e-27	54.9
WP_105009803.1\|393233_393614_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_17

400054 : 402404

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105010027.1\|400054_401089_-	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	4.0e-26	38.1
WP_105009922.1\|401126_402404_-	chitooligosaccharide synthase NodC	M1HH03	Paramecium_bursaria_Chlorella_virus	3.1e-12	25.3

DBSCAN-SWA_18

409158 : 410985

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009928.1\|409158_410985_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HQK2	Paramecium_bursaria_Chlorella_virus	9.6e-108	39.0

DBSCAN-SWA_19

419910 : 424695

Powai_lake_megavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105010028.1\|419910_421143_+	insulinase family protein	A0A167R9K4	Powai_lake_megavirus	2.1e-18	23.1
WP_105009931.1\|421162_422446_+	insulinase family protein	G3MBJ8	Bacillus_virus	8.5e-10	23.6
WP_105009932.1\|422547_423426_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_105010029.1\|424377_424695_-	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	1.1e-19	52.4

DBSCAN-SWA_20

439295 : 442037

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009942.1\|439295_442037_-	benzoate-CoA ligase family protein	A0A2K9KZV5	Tupanvirus	3.2e-14	25.8

DBSCAN-SWA_21

448808 : 449396

Bordetella_phage(100.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009949.1\|448808_449396_-\|tail	tail fiber protein	A0A291LA10	Bordetella_phage	4.4e-14	37.8

DBSCAN-SWA_22

454951 : 456157

environmental_halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009951.1\|454951_456157_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	3.9e-33	25.8

DBSCAN-SWA_23

491960 : 493127

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009971.1\|491960_493127_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.3e-20	31.3

DBSCAN-SWA_24

501555 : 502560

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105010034.1\|501555_502560_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-24	34.8

DBSCAN-SWA_25

515334 : 520434

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105010035.1\|515334_520434_+	DEAD/DEAH box helicase family protein	Q6V7L9	Burkholderia_virus	0.0e+00	42.5

DBSCAN-SWA_26

525883 : 540573

Caulobacter_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105009986.1\|525883_526810_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	6.2e-71	47.8
WP_105009987.1\|527444_527756_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_105009988.1\|527888_528215_+	hypothetical protein	NA	NA	NA	NA
WP_105009990.1\|528738_529047_-	WGR domain-containing protein	NA	NA	NA	NA
WP_105009992.1\|529396_530884_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.4e-143	54.0
WP_105010036.1\|531794_532862_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_105009993.1\|533671_534259_-	thermonuclease family protein	O64020	Bacillus_phage	2.6e-06	43.0
WP_105009994.1\|534558_536493_-	Ti-type conjugative transfer system protein TraG	NA	NA	NA	NA
WP_027668129.1\|536479_536695_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_105009995.1\|536699_536993_-	TraC family protein	NA	NA	NA	NA
WP_105009996.1\|537246_540573_+	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	2.5e-13	33.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025012

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025014

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP025016

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP025015

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection