CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	1 crisprs	csa3	0	1	2	0
NZ_CP027402	Enterococcus faecium strain FDAARGOS_323 chromosome, complete genome	1 crisprs	DinG,cas3,csa3,DEDDh,cas14j	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027402_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027402_1

2349535-2349644

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027402_1

>merge|NZ_CP027402|1|2349535-2349644|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>NZ_CP027402|1|1|2349535-2349644|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027402.1\|WP_002287792.1\|2357881_2358847_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP027402.1\|WP_002291638.1\|2348091_2348514_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP027402.1\|WP_002294588.1\|2350272_2350641_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP027402.1\|WP_002289897.1\|2344072_2344978_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP027402.1\|WP_002303471.1\|2351517_2352720_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP027402.1\|WP_002291634.1\|2349716_2350220_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP027402.1\|WP_002294585.1\|2347080_2347749_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP027402.1\|WP_002294577.1\|2342215_2342860_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP027402.1\|WP_002294593.1\|2356653_2357793_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP027402.1\|WP_105882772.1\|2352910_2354443_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP027402.1\|WP_002287793.1\|2358896_2361056_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP027402.1\|WP_002287787.1\|2354676_2355378_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP027402.1\|WP_002294548.1\|2341656_2342160_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_CP027402.1\|WP_002294580.1\|2343468_2344014_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP027402.1\|WP_002294578.1\|2343021_2343174_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP027402.1\|WP_002294589.1\|2350746_2351436_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP027402.1\|WP_002294587.1\|2348617_2349307_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP027402.1\|WP_002294584.1\|2346195_2347068_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP027402.1\|WP_002294579.1\|2343197_2343368_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP027402.1\|WP_002287788.1\|2355631_2356345_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204

Protein	Function_ID	Function_description	E-value
NZ_CP027402.1\|WP_002287792.1\|2357881_2358847_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP027402.1\|WP_002291638.1\|2348091_2348514_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP027402.1\|WP_002294588.1\|2350272_2350641_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP027402.1\|WP_002289897.1\|2344072_2344978_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	9.73807e-81
NZ_CP027402.1\|WP_002303471.1\|2351517_2352720_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
NZ_CP027402.1\|WP_002291634.1\|2349716_2350220_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP027402.1\|WP_002294585.1\|2347080_2347749_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP027402.1\|WP_002294577.1\|2342215_2342860_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP027402.1\|WP_002294593.1\|2356653_2357793_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
NZ_CP027402.1\|WP_105882772.1\|2352910_2354443_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.76931e-169
NZ_CP027402.1\|WP_002287793.1\|2358896_2361056_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP027402.1\|WP_002287787.1\|2354676_2355378_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP027402.1\|WP_002294548.1\|2341656_2342160_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	1.05399e-35
NZ_CP027402.1\|WP_002294580.1\|2343468_2344014_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP027402.1\|WP_002294578.1\|2343021_2343174_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP027402.1\|WP_002294589.1\|2350746_2351436_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
NZ_CP027402.1\|WP_002294587.1\|2348617_2349307_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP027402.1\|WP_002294584.1\|2346195_2347068_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP027402.1\|WP_002294579.1\|2343197_2343368_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP027402.1\|WP_002287788.1\|2355631_2356345_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49

>NZ_CP027402.1|WP_002294587.1|2348617_2349307_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP027402.1|WP_002291638.1|2348091_2348514_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP027402.1|WP_002294585.1|2347080_2347749_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP027402.1|WP_002294584.1|2346195_2347068_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP027402.1|WP_002289897.1|2344072_2344978_+|alpha/beta-fold-hydrolase
MERKRCMTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP027402.1|WP_002294580.1|2343468_2344014_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP027402.1|WP_002294579.1|2343197_2343368_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP027402.1|WP_002294578.1|2343021_2343174_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP027402.1|WP_002294577.1|2342215_2342860_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP027402.1|WP_002294548.1|2341656_2342160_+|QueT-transporter-family-protein
MQKTKSRQRLSVIVVNGIIMALYLALTILVAPVSSGPIQFRISESLNHLVVFNRKLLWGVLGGVIVYNAFFGFGIMDVVFGGGQTLLSLGLTALLQNKVKNVKMRLVLNTIFFTISMGLIAYMLVPTGGQAFWTTYGTLALSEFIVMAVSAPLMYYLDRALDFEKRV
>NZ_CP027402.1|WP_002291634.1|2349716_2350220_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP027402.1|WP_002294588.1|2350272_2350641_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP027402.1|WP_002294589.1|2350746_2351436_+|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP027402.1|WP_002303471.1|2351517_2352720_+|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>NZ_CP027402.1|WP_105882772.1|2352910_2354443_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIDEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP027402.1|WP_002287787.1|2354676_2355378_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP027402.1|WP_002287788.1|2355631_2356345_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP027402.1|WP_002294593.1|2356653_2357793_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP027402.1|WP_002287792.1|2357881_2358847_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP027402.1|WP_002287793.1|2358896_2361056_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

112332 : 120804

Streptococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|112332_112977_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|112991_113321_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_002288071.1\|113334_114273_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|114308_115133_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|115125_115473_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|115541_116414_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|116522_117644_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|117697_118300_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|118614_120804_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_2

502072 : 511133

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288023.1\|502072_503368_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002297115.1\|503547_503925_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|504180_504909_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|504908_505163_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|505164_505836_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_105882646.1\|505836_508059_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.2e-150	41.3
WP_002288013.1\|508043_509483_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288011.1\|509505_510558_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|510554_511133_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_3

960751 : 1074784

124

Enterococcus_phage(26.92%)

protease,head,tail,tRNA,terminase,portal,integrase,transposase,holin,capsid

attL 1014986:1015009|attR 1053571:1053594

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002301259.1\|960751_961675_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_063285916.1\|962043_964407_-	phosphoketolase family protein	NA	NA	NA	NA
WP_002288514.1\|964854_965028_+	hypothetical protein	NA	NA	NA	NA
WP_002294142.1\|965184_965532_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002294141.1\|965558_967865_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
WP_002288509.1\|967877_968189_-	YlxQ-related RNA-binding protein	NA	NA	NA	NA
WP_002288501.1\|968185_968479_-	YlxR family protein	NA	NA	NA	NA
WP_002319370.1\|968500_969676_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002326917.1\|969698_970172_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_002319369.1\|970315_974668_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	3.9e-22	41.4
WP_002319368.1\|974879_976589_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002326916.1\|976656_977925_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002296531.1\|978085_978886_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|978882_979695_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002293875.1\|979889_980447_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|980449_981172_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|981307_982189_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|982287_983070_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|983428_983908_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326915.1\|984124_985216_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002326914.1\|986337_988029_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.3e-74	32.8
WP_002339976.1\|988448_989396_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|989510_990530_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|990620_991850_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|992310_993012_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002322592.1\|993620_994637_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.4
WP_002288445.1\|994633_995098_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002339975.1\|995104_995647_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|995630_996455_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|996543_997524_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|997547_999032_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|999043_1000033_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1000281_1000449_+	DUF3042 family protein	NA	NA	NA	NA
WP_063285919.1\|1000510_1002322_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1002318_1002684_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1002846_1003242_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1003259_1004222_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1004221_1004434_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|1004454_1005153_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1005172_1005715_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002319727.1\|1005846_1006851_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1006847_1007837_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002319728.1\|1007833_1008640_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1008805_1009762_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1009838_1010357_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1010444_1010594_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1010821_1011268_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002293915.1\|1011462_1013358_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002317802.1\|1013682_1014657_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	6.6e-23	29.7
1014986:1015009	attL	NA	NA	NA	NA
WP_105882681.1\|1015216_1016236_-	peptidoglycan recognition protein	A0A1G5SA77	Enterococcus_phage	5.4e-60	66.1
WP_002302122.1\|1016246_1016444_-\|holin	phage holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
WP_002322123.1\|1016459_1016702_-	hemolysin XhlA family protein	D2J075	Enterococcus_phage	2.1e-23	68.4
WP_002323938.1\|1016771_1017581_-	glycerophosphodiester phosphodiesterase family protein	A0A0S2MYI4	Enterococcus_phage	1.7e-08	23.1
WP_002323937.1\|1017623_1018346_-	glycerophosphodiester phosphodiesterase family protein	A0A0S2MYI4	Enterococcus_phage	3.9e-12	30.6
WP_105882682.1\|1018345_1020622_-	hypothetical protein	A0A096XSZ6	Enterococcus_phage	1.1e-60	33.7
WP_002334517.1\|1020645_1022937_-\|tail	phage tail protein	A0A1D3SNL1	Enterococcus_phage	2.3e-90	30.2
WP_105882683.1\|1022946_1023684_-\|tail	phage tail protein	NA	NA	NA	NA
WP_002347402.1\|1023720_1024674_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002334515.1\|1024801_1028221_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	8.7e-78	41.5
WP_016925825.1\|1028237_1028420_-	hypothetical protein	NA	NA	NA	NA
WP_002286510.1\|1028422_1028785_-	hypothetical protein	NA	NA	NA	NA
WP_002318244.1\|1028806_1029412_-	hypothetical protein	Q8W5Z9	Listeria_phage	6.7e-34	41.2
WP_002286516.1\|1029423_1029828_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002318246.1\|1029820_1030222_-	hypothetical protein	A0A1B1P759	Bacillus_phage	3.0e-14	34.1
WP_002334514.1\|1030211_1030565_-\|head	phage head closure protein	NA	NA	NA	NA
WP_002334513.1\|1030554_1030866_-	hypothetical protein	A0A1B1P751	Bacillus_phage	1.8e-11	43.5
WP_002337504.1\|1030862_1031738_-	hypothetical protein	D2IYX3	Enterococcus_phage	2.5e-130	73.9
WP_002318250.1\|1031747_1032908_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.7e-100	50.4
WP_002334510.1\|1032907_1033594_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	6.1e-31	40.2
WP_002334509.1\|1033556_1034735_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.9e-80	40.2
WP_002286533.1\|1034754_1036449_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286538.1\|1036426_1036741_-\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_105882684.1\|1036842_1037124_-	hypothetical protein	NA	NA	NA	NA
WP_002305386.1\|1037128_1037473_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.0e-26	58.1
WP_192574436.1\|1037498_1037666_-	hypothetical protein	NA	NA	NA	NA
WP_105882685.1\|1037975_1038200_+	hypothetical protein	NA	NA	NA	NA
WP_104775162.1\|1038473_1038890_-	autolysin	C9E2P5	Enterococcus_phage	1.8e-46	67.4
WP_002323916.1\|1038966_1039263_-	hypothetical protein	NA	NA	NA	NA
WP_105882686.1\|1039259_1039463_-	toxin PIN	NA	NA	NA	NA
WP_104887982.1\|1039469_1039700_-	hypothetical protein	A0A0S2MYD2	Enterococcus_phage	3.0e-11	50.7
WP_104833043.1\|1041171_1041474_-	MazG-like family protein	D2IZY1	Enterococcus_phage	1.7e-33	71.7
WP_105882687.1\|1041598_1041913_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	1.6e-10	37.4
WP_002343499.1\|1041912_1042203_-	hypothetical protein	D2IZR3	Enterococcus_phage	1.4e-13	43.4
WP_080343616.1\|1042196_1042508_-	hypothetical protein	NA	NA	NA	NA
WP_105882688.1\|1042504_1042666_-	antitoxin	NA	NA	NA	NA
WP_002321420.1\|1042680_1043040_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	1.1e-18	48.3
WP_002323158.1\|1043036_1043888_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.2e-25	28.7
WP_105882689.1\|1043904_1044744_-	phage replisome organizer N-terminal domain-containing protein	J7KBV5	Streptococcus_phage	1.8e-48	75.4
WP_105882690.1\|1044750_1045437_-	hypothetical protein	C9E2N1	Enterococcus_phage	4.1e-88	69.1
WP_002286557.1\|1045442_1046114_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_105882691.1\|1046106_1046448_-	hypothetical protein	NA	NA	NA	NA
WP_002323904.1\|1046594_1047002_+	hypothetical protein	NA	NA	NA	NA
WP_010725635.1\|1047115_1047301_-	hypothetical protein	NA	NA	NA	NA
WP_010725634.1\|1047380_1047725_+	hypothetical protein	NA	NA	NA	NA
WP_010725633.1\|1047707_1047890_-	hypothetical protein	NA	NA	NA	NA
WP_010725632.1\|1047933_1048104_-	hypothetical protein	NA	NA	NA	NA
WP_002323902.1\|1048152_1048413_-	hypothetical protein	NA	NA	NA	NA
WP_010722962.1\|1048552_1048756_-	hypothetical protein	NA	NA	NA	NA
WP_002343597.1\|1048770_1049547_-	phage antirepressor KilAC domain-containing protein	A0A1Q1PVU2	Staphylococcus_phage	1.9e-73	54.5
WP_002290615.1\|1049846_1050167_+	helix-turn-helix transcriptional regulator	A0A1B0Y3N1	Lactobacillus_phage	5.0e-12	35.1
WP_002329428.1\|1050184_1050607_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002329429.1\|1050689_1051325_+	DUF4352 domain-containing protein	A0A2H4PQN2	Staphylococcus_phage	5.1e-32	52.6
WP_002332474.1\|1051512_1052169_-	hypothetical protein	NA	NA	NA	NA
WP_002333665.1\|1052322_1053471_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	1.2e-68	38.9
WP_002296332.1\|1053809_1054376_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
1053571:1053594	attR	NA	NA	NA	NA
WP_002296335.1\|1055928_1056279_+	hypothetical protein	NA	NA	NA	NA
WP_002317579.1\|1056370_1056790_-	cupin domain-containing protein	NA	NA	NA	NA
WP_002296337.1\|1056790_1057135_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002287776.1\|1057484_1058081_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002317578.1\|1058204_1060004_+	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1060281_1060494_-	hypothetical protein	NA	NA	NA	NA
WP_002293931.1\|1060933_1061083_+	hypothetical protein	NA	NA	NA	NA
WP_002288573.1\|1061350_1061737_+	YxeA family protein	NA	NA	NA	NA
WP_002288574.1\|1062044_1063391_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002317577.1\|1063502_1064852_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288576.1\|1064968_1066222_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288577.1\|1066292_1066778_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002293935.1\|1066800_1067559_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	8.5e-26	36.9
WP_002322842.1\|1067574_1068753_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.1e-102	48.9
WP_002288584.1\|1068982_1071103_+	LTA synthase family protein	W6LM83	Streptococcus_phage	2.8e-220	58.1
WP_002326907.1\|1071325_1072051_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1072040_1072550_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1072619_1074068_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002293942.1\|1074067_1074784_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7

DBSCAN-SWA_4

2368809 : 2431329

Enterococcus_phage(38.1%)

protease,head,tail,bacteriocin,terminase,portal,integrase,holin,plate,capsid

attL 2391846:2391864|attR 2432997:2433015

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002304799.1\|2368809_2369007_+\|bacteriocin	leucocin A/sakacin P family class II bacteriocin	NA	NA	NA	NA
WP_002287810.1\|2369008_2369320_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002294600.1\|2369423_2369570_+\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002348775.1\|2369645_2370893_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_002294602.1\|2370907_2371660_+	response regulator transcription factor	NA	NA	NA	NA
WP_002294603.1\|2372362_2372578_-\|bacteriocin	Blp family class II bacteriocin	NA	NA	NA	NA
WP_002303465.1\|2372596_2372833_-	hypothetical protein	NA	NA	NA	NA
WP_105882774.1\|2373090_2375244_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.1e-41	27.8
WP_002348772.1\|2375212_2376628_+	HlyD family secretion protein	NA	NA	NA	NA
WP_002294607.1\|2376660_2377695_+	signal peptide peptidase SppA	A0A1C9LW82	Vibrio_phage	6.6e-13	29.2
WP_002294608.1\|2377696_2378218_+	RDD family protein	NA	NA	NA	NA
WP_002294609.1\|2378214_2378601_+	DUF4064 domain-containing protein	NA	NA	NA	NA
WP_002322652.1\|2379550_2380120_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_002294132.1\|2380106_2380967_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	4.6e-12	24.4
WP_002288850.1\|2381156_2381861_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_105882775.1\|2381865_2383701_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.2e-37	37.7
WP_002288852.1\|2383697_2385014_+	hypothetical protein	NA	NA	NA	NA
WP_002288853.1\|2385014_2385884_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_002288854.1\|2385938_2386748_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
WP_002288856.1\|2386850_2387480_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_002288858.1\|2387649_2388942_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002288860.1\|2389017_2389680_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002288862.1\|2389904_2390189_+	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002290607.1\|2390239_2391865_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.8
2391846:2391864	attL	NA	NA	NA	NA
WP_029743868.1\|2391953_2393102_-\|integrase	site-specific integrase	A0A1B1IMP1	Lactococcus_phage	5.1e-91	48.4
WP_002318510.1\|2393196_2393898_-	hypothetical protein	NA	NA	NA	NA
WP_002318512.1\|2394022_2394454_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_070872871.1\|2394471_2394795_-	helix-turn-helix transcriptional regulator	Q9AZJ7	Lactococcus_phage	1.2e-13	51.9
WP_002321800.1\|2395086_2395278_+	hypothetical protein	NA	NA	NA	NA
WP_002326799.1\|2395292_2396048_+	phage antirepressor KilAC domain-containing protein	A0A1S5SE89	Streptococcus_phage	1.8e-92	70.1
WP_002318516.1\|2396007_2396307_+	hypothetical protein	NA	NA	NA	NA
WP_002323127.1\|2396354_2396639_+	hypothetical protein	NA	NA	NA	NA
WP_002311421.1\|2396659_2396848_+	hypothetical protein	D2IZW5	Enterococcus_phage	1.7e-07	58.6
WP_010725637.1\|2397172_2397514_+	hypothetical protein	NA	NA	NA	NA
WP_024635664.1\|2397506_2398253_+	DUF1071 domain-containing protein	A0A2I7RDU5	Vibrio_phage	4.4e-43	52.2
WP_010725638.1\|2398258_2398945_+	hypothetical protein	C9E2N1	Enterococcus_phage	6.4e-89	70.0
WP_104841932.1\|2398947_2399697_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.3e-31	54.0
WP_033647178.1\|2399708_2399978_+	hypothetical protein	NA	NA	NA	NA
WP_002318523.1\|2399983_2400148_+	hypothetical protein	NA	NA	NA	NA
WP_104841933.1\|2400140_2400446_+	hypothetical protein	NA	NA	NA	NA
WP_002311437.1\|2400439_2400730_+	hypothetical protein	D2IZR3	Enterococcus_phage	1.8e-13	43.4
WP_104841934.1\|2400729_2401191_+	hypothetical protein	NA	NA	NA	NA
WP_104841935.1\|2401174_2401357_+	hypothetical protein	NA	NA	NA	NA
WP_104841936.1\|2401356_2401638_+	hypothetical protein	NA	NA	NA	NA
WP_104841937.1\|2401634_2402057_+	hypothetical protein	Q4ZD40	Staphylococcus_phage	4.6e-13	37.0
WP_002330295.1\|2402049_2402553_+	DUF1642 domain-containing protein	A0A0E3T929	Enterococcus_phage	5.4e-37	60.7
WP_002330294.1\|2402549_2402852_+	hypothetical protein	NA	NA	NA	NA
WP_002330293.1\|2402848_2403034_+	hypothetical protein	NA	NA	NA	NA
WP_002330292.1\|2403030_2403240_+	hypothetical protein	NA	NA	NA	NA
WP_002330291.1\|2403236_2403524_+	hypothetical protein	NA	NA	NA	NA
WP_002330289.1\|2404115_2404583_+	ArpU family phage transcriptional regulator	D7RWH7	Brochothrix_phage	3.2e-07	28.5
WP_025481898.1\|2405359_2405590_+	hypothetical protein	NA	NA	NA	NA
WP_104841938.1\|2405733_2406396_+	hypothetical protein	NA	NA	NA	NA
WP_104841939.1\|2406442_2407291_+\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	1.2e-84	63.8
WP_005879783.1\|2407277_2408522_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	4.3e-200	81.2
WP_002323927.1\|2408534_2410034_+\|portal	phage portal protein	A0A097BY86	Enterococcus_phage	2.1e-222	78.9
WP_002330284.1\|2410038_2410947_+\|capsid	minor capsid protein	A0A1L2JXH2	Streptococcus_phage	4.8e-92	59.1
WP_104841940.1\|2411055_2411292_+	hypothetical protein	NA	NA	NA	NA
WP_002322712.1\|2411440_2412043_+	DUF4355 domain-containing protein	A0A097BY91	Enterococcus_phage	1.1e-36	52.5
WP_002322711.1\|2412055_2412979_+\|capsid	phage major capsid protein	A0A1B1V000	Enterococcus_phage	1.8e-139	77.5
WP_002322710.1\|2412996_2413260_+	hypothetical protein	D2J062	Enterococcus_phage	5.0e-10	72.9
WP_010725226.1\|2413271_2413601_+\|head,tail	phage head-tail connector protein	A0A0S2MYD5	Enterococcus_phage	3.8e-39	76.4
WP_104841941.1\|2413597_2413924_+	hypothetical protein	C9E2J7	Enterococcus_phage	9.2e-38	70.2
WP_104841942.1\|2413907_2414246_+	HK97 gp10 family phage protein	Q77K21	Lactococcus_phage	7.3e-30	58.9
WP_002311462.1\|2414245_2414638_+	hypothetical protein	Q77K20	Lactococcus_phage	2.2e-49	76.2
WP_002311463.1\|2414648_2415161_+\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	7.4e-58	66.3
WP_002293018.1\|2415206_2415575_+\|tail	tail assembly chaperone	Q77RZ7	Lactococcus_phage	8.6e-24	54.8
WP_002318903.1\|2415628_2415916_+	hypothetical protein	D7RWD7	Brochothrix_phage	2.4e-13	44.3
WP_104841943.1\|2415932_2419052_+\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	1.4e-167	79.5
WP_104841951.1\|2419084_2419852_+\|tail	phage tail family protein	D7RWD9	Brochothrix_phage	2.6e-59	45.1
WP_104841944.1\|2419848_2422680_+	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8BMB8	Lactococcus_phage	0.0e+00	60.7
WP_181055079.1\|2422693_2424439_+\|plate	BppU family phage baseplate upper protein	Q9AZX4	Lactococcus_phage	8.2e-40	41.4
WP_002323707.1\|2424451_2425210_+	hypothetical protein	A0A067XGT4	Enterococcus_phage	1.5e-27	32.5
WP_104841946.1\|2425225_2427451_+\|plate	BppU family phage baseplate upper protein	A0A060AI60	Enterococcus_phage	7.4e-62	40.2
WP_104841947.1\|2427462_2427909_+	hypothetical protein	NA	NA	NA	NA
WP_002290625.1\|2427910_2428048_+	XkdX family protein	NA	NA	NA	NA
WP_002400897.1\|2428085_2428379_+	hypothetical protein	NA	NA	NA	NA
WP_002302122.1\|2428401_2428599_+\|holin	phage holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
WP_104841948.1\|2428609_2429629_+	peptidoglycan recognition protein	A0A1G5SA77	Enterococcus_phage	1.9e-60	66.7
WP_104841949.1\|2429727_2431329_+	SIR2 family protein	A0A1S5SA14	Streptococcus_phage	1.0e-76	41.5
2432997:2433015	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP027401

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027401_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027401_1

109382-109510

Orphan

Consensus_repeat	Method
GGTATGATTTTCATACCCTCTTGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP027401_1

>merge|NZ_CP027401|1|109382-109510|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGATTTATCAACGTTTTGGCACGGTATGATTTTCATACCCTCTTGAGCCCCAAGGGATTCAGCGCCTGATTTTTCGTCGAGGGTGGGTATGATTTTCATACCCTCTGAT

>NZ_CP027401|1|1|109382-109510|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGAT	TTATCAACGTTTTGGCAC
GGTATGATTTTCATACCCTCTTGA	GCCCCAAGGGATTCAGCGCCTGATTTTTCGTCGAGGGTG
GGTATGATTTTCATACCCTCTGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027401.1\|WP_002288620.1\|119122_120364_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238625
NZ_CP027401.1\|WP_002296840.1\|120421_121609_-\|IS256-like-element-IS16-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP027401.1\|WP_002322486.1\|107725_108058_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027401.1\|WP_016631145.1\|104297_104969_-\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP027401.1\|WP_002288618.1\|118376_119087_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP027401.1\|WP_105882608.1\|100730_101486_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027401.1\|WP_002290394.1\|113725_114043_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP027401.1\|WP_002290397.1\|113470_113725_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NZ_CP027401.1\|WP_002314405.1\|100457_100718_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027401.1\|WP_002310966.1\|97879_98344_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027401.1\|WP_002288613.1\|116514_117483_+\|SIS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225132
NZ_CP027401.1\|WP_016631144.1\|102268_104245_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP027401.1\|WP_002293487.1\|101501_102254_-\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP027401.1\|WP_002347362.1\|106359_106599_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027401.1\|WP_002288615.1\|117493_118309_+\|fructoselysine-6-kinase	unknown	unknown	gnl\|CDD\|238915
NZ_CP027401.1\|WP_002347402.1\|114751_115705_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP027401.1\|WP_002322851.1\|106054_106294_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027401.1\|WP_002298077.1\|122143_123544_+\|putative-basic-amino-acid-antiporter-YfcC	unknown	unknown	gnl\|CDD\|224207
NZ_CP027401.1\|WP_016631142.1\|98370_100461_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|375475
NZ_CP027401.1\|WP_010726498.1\|110816_111995_-\|IS256-like-element-ISEf1-family-transposase	unknown	unknown	gnl\|CDD\|307151

Protein	Function_ID	Function_description	E-value
NZ_CP027401.1\|WP_002288620.1\|119122_120364_+\|amidohydrolase-family-protein	gnl\|CDD\|238625	cd01300, YtcJ_like, YtcJ_like metal dependent amidohydrolases. YtcJ is a Bacillus subtilis ORF of unknown function. The Arabidopsis homolog LAF3 has been identified as a factor required for photochrome A signalling.	2.7745e-15
NZ_CP027401.1\|WP_002296840.1\|120421_121609_-\|IS256-like-element-IS16-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	0
NZ_CP027401.1\|WP_016631145.1\|104297_104969_-\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	4.17584e-45
NZ_CP027401.1\|WP_002288615.1\|117493_118309_+\|fructoselysine-6-kinase	gnl\|CDD\|238915	cd01940, Fructoselysine_kinase_like, Fructoselysine kinase-like. Fructoselysine is a fructoseamine formed by glycation, a non-enzymatic reaction of glucose with a primary amine followed by an Amadori rearrangement, resulting in a protein that is modified at the amino terminus and at the lysine side chains. Fructoseamines are typically metabolized by fructoseamine-3-kinase, especially in higher eukaryotes. In E. coli, fructoselysine kinase has been shown in vitro to catalyze the phosphorylation of fructoselysine. It is proposed that fructoselysine is released from glycated proteins during human digestion and is partly metabolized by bacteria in the hind gut using a protein such as fructoselysine kinase. This family is found only in bacterial sequences, and its oligomeric state is currently unknown.	3.56664e-128
NZ_CP027401.1\|WP_002290397.1\|113470_113725_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.45571e-07
NZ_CP027401.1\|WP_002293487.1\|101501_102254_-\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	9.64363e-61
NZ_CP027401.1\|WP_002288613.1\|116514_117483_+\|SIS-domain-containing-protein	gnl\|CDD\|225132	COG2222, AgaS, Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane].	1.09756e-82
NZ_CP027401.1\|WP_016631144.1\|102268_104245_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.71978e-30
NZ_CP027401.1\|WP_002290394.1\|113725_114043_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP027401.1\|WP_002288618.1\|118376_119087_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.53313e-71
NZ_CP027401.1\|WP_002347402.1\|114751_115705_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	9.7253e-54
NZ_CP027401.1\|WP_002298077.1\|122143_123544_+\|putative-basic-amino-acid-antiporter-YfcC	gnl\|CDD\|224207	COG1288, COG1288, Predicted membrane protein [Function unknown].	2.81386e-149
NZ_CP027401.1\|WP_016631142.1\|98370_100461_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|375475	pfam17998, AgI_II_C2, Cell surface antigen I/II C2 terminal domain. This is the second domain (C2) located in the C-terminal region found in antigen I/II type adhesin protein AspA from S. pyogenes. Together with C3, these two domains form an elongated structure, each domain adopts the DEv-IgG fold. Similar to the classical IgG folds, it is comprised of two major antiparallel beta-sheets, designated ABED and CFG. For the C2-domain, there are two additional strands on the CFG sheet. Furthermore, sheets ABED and CFG are interconnected by several cross-connecting loops and one alpha-helix (DH1). The side chains of D982 and N996 in the C2-domain are involved in hydrogen bonding with the side chains of R1264 and N1295 in the C3 domain. Main chain hydrogen bonding can also be observed between S992 in C2 and N1189/G1191 in C3, furthermore stabilizing the interaction between the domains. The C2 domain contains one bound metal ion, modeled as Ca2+, and both the C2- and C3-domains are stabilized by conserved isopeptide bonds, which connect the beta-sheets of the central DEv-IgG motifs.Other members of this family include Major cell-surface adhesin PAc from Streptococcus mutans and SspB from Streptococcus gordonii.	2.7901e-15
NZ_CP027401.1\|WP_010726498.1\|110816_111995_-\|IS256-like-element-ISEf1-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	7.54174e-110

>NZ_CP027401.1|WP_002322486.1|107725_108058_-|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP027401.1|WP_002347362.1|106359_106599_-|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWRTYNGIKDLKPARPVVKRKKKITQE
>NZ_CP027401.1|WP_002322851.1|106054_106294_-|hypothetical-protein
MNCKEIENRKKVSKEMEEKLLKTMKQKHLKRLSVMQYISDMQITGKEKACLLGSMKNFEQLRRTYVKISSNCQLLLEVS
>NZ_CP027401.1|WP_016631145.1|104297_104969_-|class-A-sortase
MKKWLFGFLGVTLIVFCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIKMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP027401.1|WP_016631144.1|102268_104245_-|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLIGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPTEDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKASVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLESAEFAAKNAEGKYYGGLVDTDKNGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP027401.1|WP_002293487.1|101501_102254_-|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLEPNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKKQKLSWKWLLGSTVFLSVMIIGSLFVYKKKK
>NZ_CP027401.1|WP_105882608.1|100730_101486_-|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGHEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKDRVKKLSSDQLKLVSNGETKTIDQQTGVFEFSVEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNGEFLKDVWIYPKSEASQPKEEVKKIVSNGVKKNFFENCWDFVTHLFSRD
>NZ_CP027401.1|WP_002314405.1|100457_100718_-|hypothetical-protein
MKLIKLLLFNLSCLTAVFLYCGLLFSKLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG
>NZ_CP027401.1|WP_016631142.1|98370_100461_-|isopeptide-forming-domain-containing-fimbrial-protein
MNFKHSWTRRLKYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKNIRYPSFQKEYGETNLVLEGVTTNTKVNINYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIVYHSTQMNVQLVATYEDGSPVQFSGDTFISFNSLNPAGGKSTDLKGEYVHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKLTQADNDFNNLHDKLGDPKFGQGTVSFKISEANPTFVIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKVNRLGVDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSGEVTYDKTKHQVKYAAKADTLKNRMKYNGETYELVINVKVNELANQNSVAKNQGTSIINKVEKNTNIITVYFPKIPVKEVQQNGKDVNGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDAASDHYKQFSIQDPIEARLTYKEGSAQVIDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPLQSEKNIDNQAVVAVDNVSNKTNVVTIGVDPNLPQVIVPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI
>NZ_CP027401.1|WP_002310966.1|97879_98344_-|hypothetical-protein
MKKLIIVVTSLIAMIVILVGCSNEKNKQTNQDNGVLKSGTMWKEEVGGLVYNLKIIDETTWEYSESVWHPDPVQITVKRQKDYKGLERYKIVDSAGVREFINKSDSLFIVVPYEKNGVKKIIFLGSSKDEKRTKEKLIHDGSQSNKYKLQKTSE
>NZ_CP027401.1|WP_010726498.1|110816_111995_-|IS256-like-element-ISEf1-family-transposase
MNDFTTEIVQTLVTKGDLNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFNSGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKSRALNDKYVAIFMDATYIPLKRQTVSKEAIYIAIGIREDGTKEVLSYAIAPTESTYVWNELLQDINSRGVQEVLLFITDGLKGMKDTIHQIYPKAKYQHCCIHVSRNIAHKVRVKDRKEICDDFKAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIENQDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRSSRRKEQFQNEESLERFLVSIFDTYNQKFLNRSHKGFQQVTDTLVSMFTE
>NZ_CP027401.1|WP_002290397.1|113470_113725_+|AbrB-family-transcriptional-regulator
MGKELKVRKIGNSVGVILPSSLGLKSGDTIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP027401.1|WP_002290394.1|113725_114043_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP027401.1|WP_002347402.1|114751_115705_-|IS30-family-transposase
MTYTHLTPNELVMIEAYFHQETPVAIVAKQLKRGRQTIYNVYNFLKCGGTALEYFEQYKENKRRCGRTEIIFPAEEKEYFAKRSTEGWTPDVIIGRAERTFSCSVSTLYRRFKTGEFNVLHLPMQGKRKPNGYKEKRGKQAFKRNISERKKDYVVFEEEFGHLEGDTIVGIHHKSAVITLVERLSKAIIALKPEGRKAVDIENSINEWLQSVPKNLFKSITFDCGKEFSNWKSISNTNDIDIYFADPGTPSQRGLNEHSNGLLRKDGLPKEMDFNQVNQGFISSVASKRNHIPRKSLNYQTPLEVFLSYVNGKFCLT
>NZ_CP027401.1|WP_002288613.1|116514_117483_+|SIS-domain-containing-protein
MDVAKTVNAIVEKNDGEISGIYLVACGGSLVDMYVSDYFLKAEASKCITGLYTANEFNHVTPKQLDDKSVVILCSHGGNTAETVKAGEVAQARGAVTVGLTHNKTADLLKVSDHSFLYEWGDDAKIVNNPMAIILDLTVSLVNVTETFEHYGKFREGMKVIDTVIENGIKQVQDRIKVFADKYKDETMFYILGSGPSYGHAYGFSICSLMEMQWLDSTSVHSGEFFHGPFEVTDKDTNFILLMSIGRTRALDERAKRFLDKYAERVEIVDAKELGLDMISDEVSEFFNPILFYSILSEYRSALADARNHDLDVRRYMGKVEY
>NZ_CP027401.1|WP_002288615.1|117493_118309_+|fructoselysine-6-kinase
MKVLGLGDNVVDKYENLGIMYPGGNSLNFAVFAKKLGHESSFMGVFGSDEEAAHVLSAIKEIGLDNSHSRFEKGENGCARVKIDEGDRIFLGSNSGGVTREYPIQLTEEDREYLNQFELIHMGLYSHVNHLLEELQNVSGKISYDFSDDFTEEEVQRAIDKVDFGFFSIEDFSDEEVKQFLMKHFCERNDVLIATRGEKTAIGYDGAKFYEVNPVLEEPVDTMAAGDSFLTAFLLYFLEGDDIVTAMKKGNEFAGKSCLVDGSFGFGIHYD
>NZ_CP027401.1|WP_002288618.1|118376_119087_+|GntR-family-transcriptional-regulator
MLDTNAQLPLYLQLKEILKNKINTGEYPENTKIPAESELIESYEVSRITVRKAVEELVEEGYLLKKQGKGTFVNRHKVFRKIEYVMGFSESCKSNGFTPTSIVLERKIIPATEGMAKKLDIAQGDDVLYIQRKRMADNIPIMLENNYFSYERYSFLMEEELTDSLYEVLKVQGTLAINPGETALEIVTADDQIAKIMEVAVGTPFFFMDTLINDQNNIPIHVGNQYYLGEVYRFYL
>NZ_CP027401.1|WP_002288620.1|119122_120364_+|amidohydrolase-family-protein
MKQILRSKMIFDGEQPPFKGYIVINEGIIEKVENNWNYSDLLNENTELIAYDDQFVMPAIHDNHVFFSGYLAMNAGIDLSDTSSANEAVERIKAVMNHKKADEPIYAHGWDAALWKTDPSEELLNEINHFGPITAIDKNRSHCWMNAIAKQTYGFTEKETSAESRVLLIKEMLANKKLLAEVYAEFEALLLSKGVISMKEIVFDDAEFLSNIPQRKILSNLYVQAVQEPLQHELLYEYKEKVFPEKVRFGGVKIMVDGVVADRSGDIYGVYQSGVASPEIDYEAIKAEVAAFNEVEIPCCLTTEGDKAGYKAASILVEFGKRLPEGVFNSISDLEMVTQKTAEKMNEGQVVAEVYPQILGLNQTLEEAYMSTVIKNESSPQSCVKVQPHQKHNVLRCEPNCHAFLSEERGQEQ
>NZ_CP027401.1|WP_002296840.1|120421_121609_-|IS256-like-element-IS16-family-transposase
MTQVHFTFESEEIQAIINESGANDTAKTLMTIMFNQLMEEQRNQYIQANAYERSEERQSQRNGYYDRSFTTRIGTLELHVPRTRDGKFSPTIFERYQRSEKALIAAMIEMVISGVSTRKVTKTVELLTDGATVSKSFVSNLMKQLDPFVFEWRNRSLEGSEYPFFMCDALYMKVRENHRIVSKGVYIGIGIDSDGRRTILGFDVQDGESEDNWDTVFQSFVQRGLFGVKLVISDAHKGLVKAVRKNFLGASWQRCQAHFLRNIFDKLPKKVSSDVKDELKSIFKASELELTRERKEHFLEKYGCDSKLSAACDILENGFEDAIQILSFPENIRRRIRTTNVLERLNEEIRRRERVIRIFPNINSITRIIGTLLMEKDTEWLASPRKYLEFNSNNI
>NZ_CP027401.1|WP_002298077.1|122143_123544_+|putative-basic-amino-acid-antiporter-YfcC
METMKRKFTFPHSYTLIFILIILAAILTWIIPSGQFETVVENVAGMEKTTVVPGTYHQIDKADYGQGFSSILMAPAEGIISAVEVVAFVLIVGGAFGIILKTGAIDRGLFTLAKVLGDKGILVIPMSMILFSLGGSTFGMSEEVIPLFAVFISLMFSLGYDSMTAILILFLSTQAGYVGSTINPFNVLIAQGVAGVYGNPLLWFRMLSWIVITGISIVFTMLYASRVKKNPLSSIVYESDLKVKHKFQNFDTEKEFSTQDKLIIAGFIVGLGIMIWGIISKGWYMVEISALFLGLGLFAGGIARFSQKEIAEAFVEGCSDFAYAAVIIGLARGVLVILEGGMIIDTILNSLANLLGGLPKFLFTTILLISQVIVSFFVPSSSGAAALTMPVMAPLGDLMNVSRDVVVLSNQFGNGLMNIISPTSGVLLAGLAIAEINFSKWFKVGFKIFAILTLVSAVLLYIATLF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109448-109486	0	1.0
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-491	0	1.0
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-491	0	1.0
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221216-221254	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-490	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244164	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27921	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96585	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-492	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95092-95130	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358205-358243	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119937-119975	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111408	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126972	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153621-153659	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129212-129250	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71307	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249118-249156	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107236	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91402-91440	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102426-102464	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1435	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60362-60400	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97677-97715	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52637-52675	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102651-102689	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200668	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56543-56581	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65333-65371	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67366	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14572-14610	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178936	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33082-33120	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105747	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39887-39925	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35203	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225650	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92046-92084	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17089-17127	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86205	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61691	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5122	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177316	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244164	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192113-192151	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-491	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168263-168301	1	0.974
NZ_CP027401_1	1.2\|109448\|39\|NZ_CP027401\|CRISPRCasFinder	109448-109486	39	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47629-47667	2	0.949

1. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
***************************************

2. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
***************************************

3. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
***************************************

4. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

5. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

6. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

7. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

8. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

9. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

10. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

11. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

12. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

13. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

14. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

15. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

16. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

17. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

18. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

19. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

20. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

21. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

22. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

23. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

24. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

25. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

26. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

27. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

28. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

29. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

30. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

31. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

32. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

33. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

34. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

35. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

36. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

37. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

38. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

39. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

40. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

41. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

42. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

43. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

44. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

45. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

46. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

47. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

48. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

49. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

50. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

51. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

52. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

53. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

54. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

55. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

56. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

57. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

58. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

59. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

60. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

61. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

62. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

63. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

64. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

65. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

66. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

67. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

68. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

69. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

70. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

71. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

72. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

73. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

74. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

75. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

76. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

77. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

78. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

79. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

80. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

81. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

82. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

83. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

84. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

85. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

86. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

87. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

88. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

89. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

90. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

91. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

92. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

93. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

94. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

95. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

96. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

97. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

98. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

99. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

100. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

101. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

102. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

103. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

104. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

105. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

106. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

107. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

108. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

109. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

110. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

111. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

112. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

113. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

114. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

115. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

116. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
******************.********************

117. spacer 1.2|109448|39|NZ_CP027401|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 2, identity: 0.949

gccccaagggattcagcgcctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgaggatg	Protospacer
******************.*****************.**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

393 : 69647

Streptococcus_phage(58.33%)

integrase,transposase,holin

attL 28332:28355|attR 52378:52401

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002403341.1\|393_993_+	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	7.4e-33	41.9
WP_105882601.1\|1920_2121_+	helix-turn-helix transcriptional regulator	A0A2K5B261	Erysipelothrix_phage	1.8e-12	55.6
WP_105882602.1\|2169_5427_+	DEAD/DEAH box helicase family protein	A0A2K5B2B9	Erysipelothrix_phage	0.0e+00	81.0
WP_105882603.1\|5427_6150_+	DUF4391 domain-containing protein	A0A2K5B2C0	Erysipelothrix_phage	1.7e-68	50.9
WP_105882604.1\|6177_8157_+	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	1.8e-139	42.9
WP_105882605.1\|8177_11168_+	DEAD/DEAH box helicase family protein	A0A2K5B2C2	Erysipelothrix_phage	0.0e+00	70.6
WP_105882610.1\|11334_11649_+	hypothetical protein	NA	NA	NA	NA
WP_098188703.1\|12291_13454_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002296840.1\|15069_16257_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_079504102.1\|16927_17836_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002316138.1\|17891_18389_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_079504103.1\|18385_19120_-	hypothetical protein	NA	NA	NA	NA
WP_002295761.1\|19862_20417_+\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002347402.1\|21480_22434_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-35	35.9
WP_002297440.1\|24495_25581_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_002297441.1\|25913_26147_+	addiction module antitoxin	NA	NA	NA	NA
WP_002297442.1\|26143_26551_+	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	2.3e-14	39.1
28332:28355	attL	NA	NA	NA	NA
WP_002290348.1\|28390_28741_-	hypothetical protein	NA	NA	NA	NA
WP_010726502.1\|28733_30059_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	1.7e-98	43.2
WP_002338090.1\|32120_33338_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	1.1e-232	99.8
WP_000814511.1\|33419_33623_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_000857133.1\|34083_34314_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|34310_34733_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_001227347.1\|35237_35591_+	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000336323.1\|35650_35818_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_000691749.1\|35936_37856_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.4
WP_001814923.1\|37871_37988_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224318.1\|38232_39165_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_000769868.1\|39161_40163_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|40159_42337_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_002338091.1\|42339_44787_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	99.4
WP_000506270.1\|44770_45277_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|45251_45749_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|45865_46087_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|46129_47335_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|47357_47510_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|47512_48898_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|48926_49313_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|49328_49643_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_086956687.1\|49880_51043_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002298365.1\|52451_53084_-	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	7.8e-09	28.4
52378:52401	attR	NA	NA	NA	NA
WP_002347642.1\|53096_55820_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002347643.1\|55956_56922_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002298371.1\|56975_57788_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002298373.1\|57801_58575_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298375.1\|58588_59059_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002343823.1\|59055_59472_-	hypothetical protein	NA	NA	NA	NA
WP_016631195.1\|59796_60639_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010726506.1\|60942_62457_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-45	38.3
WP_002285820.1\|63482_64688_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.5e-35	30.7
WP_179188977.1\|64741_65425_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-124	98.2
WP_005874952.1\|65752_66433_-	hypothetical protein	NA	NA	NA	NA
WP_010726507.1\|67120_67759_-	hypothetical protein	NA	NA	NA	NA
WP_002320550.1\|67751_68189_-	hypothetical protein	NA	NA	NA	NA
WP_002320549.1\|68204_68456_-	hypothetical protein	NA	NA	NA	NA
WP_002296239.1\|68455_68662_-	hypothetical protein	NA	NA	NA	NA
WP_010726508.1\|69110_69371_-	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	6.9e-12	50.7
WP_002295624.1\|69524_69647_+\|holin	putative holin-like toxin	NA	NA	NA	NA

DBSCAN-SWA_2

81403 : 137218

Staphylococcus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002301399.1\|81403_82363_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.0e-31	35.5
WP_105882606.1\|82326_82533_-	hypothetical protein	NA	NA	NA	NA
WP_010730955.1\|83040_84072_-	hypothetical protein	NA	NA	NA	NA
WP_002316063.1\|84091_84322_-	hypothetical protein	NA	NA	NA	NA
WP_002293510.1\|84344_85151_-	hypothetical protein	NA	NA	NA	NA
WP_002339834.1\|85161_85806_-	hypothetical protein	NA	NA	NA	NA
WP_105882607.1\|85821_87027_-	glucosaminidase domain-containing protein	Q6SEC2	Lactobacillus_prophage	4.8e-31	41.8
WP_002340490.1\|87026_89051_-	hypothetical protein	NA	NA	NA	NA
WP_002340492.1\|89213_89807_-	hypothetical protein	NA	NA	NA	NA
WP_002340493.1\|89807_90140_-	hypothetical protein	NA	NA	NA	NA
WP_010706253.1\|90191_92570_-	hypothetical protein	NA	NA	NA	NA
WP_002331344.1\|92566_95176_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_016631141.1\|95175_97251_-	hypothetical protein	NA	NA	NA	NA
WP_002295662.1\|97320_97623_-	hypothetical protein	NA	NA	NA	NA
WP_002305229.1\|97640_97883_-	DUF5415 family protein	NA	NA	NA	NA
WP_002310966.1\|97879_98344_-	hypothetical protein	NA	NA	NA	NA
WP_016631142.1\|98370_100461_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002314405.1\|100457_100718_-	hypothetical protein	NA	NA	NA	NA
WP_105882608.1\|100730_101486_-	hypothetical protein	NA	NA	NA	NA
WP_002293487.1\|101501_102254_-	class C sortase	NA	NA	NA	NA
WP_016631144.1\|102268_104245_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_016631145.1\|104297_104969_-	class A sortase	NA	NA	NA	NA
WP_002322851.1\|106054_106294_-	hypothetical protein	NA	NA	NA	NA
WP_002347362.1\|106359_106599_-	hypothetical protein	NA	NA	NA	NA
WP_002322486.1\|107725_108058_-	hypothetical protein	NA	NA	NA	NA
WP_002323095.1\|108897_109938_-	replication initiator protein A	NA	NA	NA	NA
WP_010726498.1\|110816_111995_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002290397.1\|113470_113725_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002290394.1\|113725_114043_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002347402.1\|114751_115705_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-35	35.9
WP_002288613.1\|116514_117483_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002288615.1\|117493_118309_+	fructoselysine 6-kinase	NA	NA	NA	NA
WP_002288618.1\|118376_119087_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002288620.1\|119122_120364_+	amidohydrolase family protein	NA	NA	NA	NA
WP_002296840.1\|120421_121609_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002298077.1\|122143_123544_+	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
WP_002322961.1\|123576_123744_+	hypothetical protein	NA	NA	NA	NA
WP_002292678.1\|124752_125082_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002300557.1\|125071_125359_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292680.1\|125644_126502_+	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002292681.1\|126502_127051_+	hypothetical protein	NA	NA	NA	NA
WP_002300609.1\|127988_128939_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002298230.1\|129540_131385_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289584.1\|131440_132907_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_002289586.1\|132943_133786_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002298232.1\|133997_135290_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002338106.1\|136045_137218_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-133	99.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP027402

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP027401

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection