CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021259	Legionella pneumophila strain D-7708 chromosome, complete genome	2 crisprs	csa3,DEDDh,DinG,cas3,WYL,PD-DExK	0	1	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021259_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021259_1

1808740-1808855

Orphan

Consensus_repeat	Method
AATGGCTTTTATCAACTAAGCGCTGAACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021259_1

>merge|NZ_CP021259|1|1808740-1808855|CRISPRCasFinder
AATGGCTTTTATCAACTAAGCGCTGAACAACTGACAGCAGTGCTGATCAATATTCCAGAAAGCATCACCACGCTTAACTTGAGTGATAATGGCTTTTATCAACTAAGCGCTGAACA

>NZ_CP021259|1|1|1808740-1808855|CRISPRCasFinder
AATGGCTTTTATCAACTAAGCGCTGAACA	ACTGACAGCAGTGCTGATCAATATTCCAGAAAGCATCACCACGCTTAACTTGAGTGAT
AATGGCTTTTATCAACTAAGCGCTGAACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021259.1\|WP_027221790.1\|1804243_1804618_-\|Y4oB-family-protein	unknown	unknown	gnl\|CDD\|378249
NZ_CP021259.1\|WP_106225319.1\|1808372_1808558_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021259.1\|WP_106225313.1\|1795869_1796604_-\|L,D-transpeptidase-family-protein	unknown	unknown	gnl\|CDD\|182341
NZ_CP021259.1\|WP_106225314.1\|1796664_1798683_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236864
NZ_CP021259.1\|WP_027221798.1\|1814049_1814997_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133381
NZ_CP021259.1\|WP_106225322.1\|1812988_1813966_+\|aminoglycoside-phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|366736
NZ_CP021259.1\|WP_106225321.1\|1811081_1812152_-\|glutamate-5-kinase	unknown	unknown	gnl\|CDD\|235460
NZ_CP021259.1\|WP_027227102.1\|1809819_1811073_-\|glutamate-5-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|234685
NZ_CP021259.1\|WP_106225317.1\|1804804_1805461_+\|methyltransferase	unknown	unknown	gnl\|CDD\|226608
NZ_CP021259.1\|WP_192877198.1\|1805681_1807997_+\|phosphoenolpyruvate-carboxylase	unknown	unknown	gnl\|CDD\|225227
NZ_CP021259.1\|WP_027227096.1\|1802029_1803454_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021259.1\|WP_106225315.1\|1798675_1799995_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|181265
NZ_CP021259.1\|WP_106225327.1\|1819867_1821328_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP021259.1\|WP_106225325.1\|1817133_1818090_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|377252
NZ_CP021259.1\|WP_106225324.1\|1816138_1817137_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP021259.1\|WP_106225326.1\|1818093_1819875_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP021259.1\|WP_027227097.1\|1803564_1804242_-\|RES-family-NAD+-phosphorylase	unknown	unknown	gnl\|CDD\|378053
NZ_CP021259.1\|WP_106225316.1\|1800158_1801205_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375919
NZ_CP021259.1\|WP_027227104.1\|1812335_1812761_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP021259.1\|WP_106225323.1\|1815320_1816070_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133381

Protein	Function_ID	Function_description	E-value
NZ_CP021259.1\|WP_027221790.1\|1804243_1804618_-\|Y4oB-family-protein	gnl\|CDD\|378249	pfam09722, DUF2384, Protein of unknown function (DUF2384). Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. The function is unknown.	1.89824e-05
NZ_CP021259.1\|WP_106225321.1\|1811081_1812152_-\|glutamate-5-kinase	gnl\|CDD\|235460	PRK05429, PRK05429, gamma-glutamyl kinase; Provisional.	9.92012e-129
NZ_CP021259.1\|WP_106225313.1\|1795869_1796604_-\|L,D-transpeptidase-family-protein	gnl\|CDD\|182341	PRK10260, PRK10260, L,D-transpeptidase; Provisional.	8.91806e-46
NZ_CP021259.1\|WP_106225314.1\|1796664_1798683_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236864	PRK11154, fadJ, fatty acid oxidation complex subunit alpha FadJ.	4.15578e-165
NZ_CP021259.1\|WP_027221798.1\|1814049_1814997_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	1.42202e-39
NZ_CP021259.1\|WP_106225322.1\|1812988_1813966_+\|aminoglycoside-phosphotransferase-family-protein	gnl\|CDD\|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	1.90848e-09
NZ_CP021259.1\|WP_027227102.1\|1809819_1811073_-\|glutamate-5-semialdehyde-dehydrogenase	gnl\|CDD\|234685	PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional.	0
NZ_CP021259.1\|WP_106225317.1\|1804804_1805461_+\|methyltransferase	gnl\|CDD\|226608	COG4123, COG4123, Predicted O-methyltransferase [General function prediction only].	9.91768e-18
NZ_CP021259.1\|WP_192877198.1\|1805681_1807997_+\|phosphoenolpyruvate-carboxylase	gnl\|CDD\|225227	COG2352, Ppc, Phosphoenolpyruvate carboxylase [Energy production and conversion].	5.41162e-56
NZ_CP021259.1\|WP_106225315.1\|1798675_1799995_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|181265	PRK08170, PRK08170, acetyl-CoA C-acetyltransferase.	0
NZ_CP021259.1\|WP_106225327.1\|1819867_1821328_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	6.91967e-86
NZ_CP021259.1\|WP_106225325.1\|1817133_1818090_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	3.68493e-75
NZ_CP021259.1\|WP_106225324.1\|1816138_1817137_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.82057e-09
NZ_CP021259.1\|WP_106225326.1\|1818093_1819875_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	6.93846e-134
NZ_CP021259.1\|WP_027227097.1\|1803564_1804242_-\|RES-family-NAD+-phosphorylase	gnl\|CDD\|378053	pfam08808, RES, RES domain. This presumed domain contains 3 highly conserved polar groups that could form an active site. These are an arginine, glutamate and serine, hence the RES domain. The domain is found widely distributed in bacteria. The domain is about 150 residues in length.	1.67994e-28
NZ_CP021259.1\|WP_106225316.1\|1800158_1801205_-\|hypothetical-protein	gnl\|CDD\|375919	pfam18493, DUF5617, Domain of unknown function (DUF5617). This is a C-terminal domain of unknown function found in gammaproteobacteria.	0.00433323
NZ_CP021259.1\|WP_027227104.1\|1812335_1812761_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	7.29365e-12
NZ_CP021259.1\|WP_106225323.1\|1815320_1816070_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	1.71317e-48

>NZ_CP021259.1|WP_106225319.1|1808372_1808558_-|hypothetical-protein
MMFTLLLCLDTHDLQDLAQRLMHKKRLPYVASHAEKRLHLGLKNNGLLMYNQRFREGKRQE
>NZ_CP021259.1|WP_192877198.1|1805681_1807997_+|phosphoenolpyruvate-carboxylase
MKQDVSHLPRELSRMVFWSLTRLKKAIAEVYGKETYERIEQIRLSMQDTIGSELFALGKALHSLQIELSKLDKKQLYQIAHGFSLMMELINTCENAYRIFRINQRKEPVYSDRPQGIHYVLTAHPTEARTNEFLKLFKEIRDYLVEVLKSPYLMNESHLDQMLKISLQINISYHEKPSVEDEAQYIYQYALHPLNIKLYHFFLAKGVPIQLRTWVGGDKDGHSGVNEKIMLKSLELSRSFFIAYIQECLKEALGIIKLSTALNKNKFLADQIGQLVKKANGLKKIQPKDHEKVSAFKKELTAIQSNTLKFLNFEPEQFSIISSIFHLYPTLVMPIELREDSAIVKESLTSIKKTTITKMLEQVHSITHGTDPKNYIRGFILSMVESAEDIKNGINLVKQVFKSYALPVVPLFENQLALTNADTILNDSITEDIRQKHLRQWDGNYEVMLGYSDSSKENGVLPSRLMIAKSLKNIQSTLENKNLRPIFFHGSGGSIERGGGDIKEQTASWSKEMMSNYKVTVQGEMVARLFGSSSILKSQIDKFLDIYSQKSKSNDNDYPEELSLFSTRVSQKYKTLIQSDWFWQIVEQASPYHFLKELKIGSRPTKRKSGPDQRKLRAIPWILCWTQTRLLFPTWWGIGSTWSELNGIEKNRLKALYKENALFAAFVKQLGVTLSKVYLPVWEHYLLQLTGSIEYLKPFQSELESTVLFFYQITGEKDFCFHQPWLGESIQLRSTLIHPLNLIQIEAMKRKDLPLLRKTVTGISCGMLTTG
>NZ_CP021259.1|WP_106225317.1|1804804_1805461_+|methyltransferase
MIDAVQNEPNIHFTYNYKQPDEYHFSLDSIHLAKFVAKQLKPYRDLGSLRVLDLCAGCGVIGIELSWHLQAIRQIDFIEIQDIYTEYFYQNIANVNRPDLQLRWHLLNYDELHEKKWEGTFDLIISNPPYFQPGHGMLSPSKFKNRCRFYLDSSFQNYIRALENSLANKGRAYFLLRPLQHHGLDLFSDIQKVLQETSVTAKKISHIRGSDIILLEKR
>NZ_CP021259.1|WP_027221790.1|1804243_1804618_-|Y4oB-family-protein
MQTNTSSLQNIPDDVVWKSLTNLVERFDLKESEARILMGDMPRSTYTSHKAKLNRDQKERVSYLLGIYKSLRILFEDGEQARTWINRKNNLPPFNGLTPKEYMLEGGIVRLADVRKFLDFWRGY
>NZ_CP021259.1|WP_027227097.1|1803564_1804242_-|RES-family-NAD+-phosphorylase
MYSYIDFSEKVHRLIPSKFPPVTLFDWADSAEELEQIALLEGLTNERILAELGKINLIDKEDWIGGPGSTPIMAAFTHTGFESRFSDGSFGVYYAASSLETAIKETCFHRARFYSASNEKPCSISMREYVATIKKPLIDIRDKRYKELFNPDPAYYGKSQEFGKKVHEKKEWGLLYPSVRNLNGLCMAVLRPPALTLPRQGCHLRYIWDGEKISDVYKESKIANV
>NZ_CP021259.1|WP_027227096.1|1802029_1803454_+|hypothetical-protein
MIVIFVHGWSVTHTNTYGELPQWLENQSKQGKLDIQVGNVYLGRYISFDDTVTVDDIARAFDQALRDEIADKLRDGERFACITHSTGGPIVRKWMDLYFKNNLAKCPLSHFIMLAPANHGSALAQLGKSRLARIKSFFEGVEPGKYVLDWLELGSNMSWQLNESWLDYDCTANGIYCFVLTGQKIDRQLYDALNSYTGEAGSDGVVRVAATNMNYSLLKLHQEGDNGESLVVAKMTRTQPMAFGVLPGLSHSGKNIGIIRSITIANAATHPTAIWVLRCLQVKSRDSYNTLVQELDKITKETQKNEHTEFVKTLVFKREYITNRYSMIIFRLIDDRGNHLVDYDLYLTAGPQYSEQALPAGFFIDRQRNLNNRGKLTYFLDYDIMEGGINTPKMQGNLGFRVKAYPESSDQALAYYRLLDFHSSLADIHKILHPNETVMVEIMLQRRVDRTVFRITNNLAPAKISVKTTGKKVD
>NZ_CP021259.1|WP_106225316.1|1800158_1801205_-|hypothetical-protein
MWYDTLLEYLGEKICPSNKEKARLLISQLLKLLKEDPDFGKNFEPEFIFGVMVALYDYSTNHGNQNVSLDEFGKYCIGLIMVFSKISEDLSVYCSDFIYILSDKTIVQELKIKEELANIRKDYLEKKRVNPDVTPFIDQKDVENPFKIYRRIGELAKIDLLKQFESHTLACLNFSVKIQTEKIVSMLNDLLNHMKNQQVIVSELYQYLLPYKGKDDLFDALILSLQRGLKKLTKTQLPSTSKINLVLIPALKLDHLPRYNPEIVNICEKLENYVFKGSSKKGSFFSAKNYCNHTKEVNEIVQKILKGDLLTIEAILHELAKINIENRKDELILLIKELQNERACIRKL
>NZ_CP021259.1|WP_106225315.1|1798675_1799995_-|acetyl-CoA-C-acetyltransferase
MKHQSNLSGRNVYVVDGSRTPFLKAKGVGPFSGSDLAVAAGTTLLNRQPFSPDELDEVIIGSAMPGPDEANIARVIALRLGCGDKVPAFTVMRNCASGMQALDNAAIQIATGRSNLVLAGGTDAMSHAPLLFNEKMASWLANWFAAKSMGQKLALITKFKPSYLAPVIALLRGLTDPIVGLNMGQTAEKVAYRFNITREQMDEFAAQSHLRIAQAYAENRMSEVAPIIDYKGCIYPQDDGIRADSTVEKLSKLKPFFDKKYGMVTPGNSSQITDGACLLLLASAEAVKKYALPVLGRIVDSQWAALDPSQMGLGPVHAATPILERHNLKPQDLDCWEINEAFAAQVLGCLAAWDDEEYCKTQLGLKEAIGAPSLERLNRDGGAIALGHPIGASGARIVLHVLKSLEQRNESRGMAAICIGGGQGGAMYLERVTEVKGHE
>NZ_CP021259.1|WP_106225314.1|1796664_1798683_-|enoyl-CoA-hydratase/isomerase-family-protein
MNNYKHWDLQRDKDAILWLGLNRRDAAVNSINEEVLDELNSLLHEISHDKKAMGLIIYSLKEKGFIAGADVNAFSQFESSSQAVDFLQKGQAVFARLQALSIPSVAMIDGFCMGGGYELALACTYRIATDDKDTRIGLPEVMLGIHPGWGGTVRLPQLIGGFKALSQVILTGSAIPSVKAKSLGMIDEVVPVRQLRRAAVYFIKNKPPRHKPSFIESLTNSSLLRKPIAYLLRYNVAKRVRKEHYPAPYAVIDLWEKEGGVGERAYLKEADSIEKLVSQSDTAKNLIRAFLLRERLKGFAKDSQFKAVHVHVIGAGVMGGDIAAWCALRGLQVTLQDKSYEQIAPAIGRAHKLYSKKLRKPRLIQAAMDRLIADPEGHGVKRADVIIEAVFENLAVKQEIMKTVEKNAKKDAIIATNTSSIPLDEISSVMSKPERLVGIHFFNPVAKMDLVEIVSSSSTAKKIQQNSCAFVNQIGKLPLPVKSSPGFLINRVLMPYLMECVQLLDEGYSAETIDEAALQFGMFMGPVELADTVGMDVCLAVAENLTSHFGGTIPQRLRDLVKEGKLGRKTGEGFYKYKNGKAIKKKTPAHVDKTIADRLILRMVNESAACIRERVVEDSDLLDAGMIFATGFAPFRGGPMNYAKDFGKDKLETLFKTFESKYGERFKVDTSL
>NZ_CP021259.1|WP_106225313.1|1795869_1796604_-|L,D-transpeptidase-family-protein
MEQKSKSIIGVWYLILLLSQYSFANVYVLPESGNTVGEIQVAFSEFGETIDEVGRRFNVGYYEMVRANPGVNARYPLAANTKLIIPSRFVLPNVPRKGIVINLAEYRLYYFPPDDNVVITYPVGIGKKGWETPLGLSKITSKEINPTWRPTVKLQKAAESIGAPIPSEFPPGPYNPLGQYVLRLGWPTILIHGSNRVDGIGAKVSAGCIRMLPEDIEHLYGLVAIGTPVRIINDSLQRPAALNQ
>NZ_CP021259.1|WP_027227102.1|1809819_1811073_-|glutamate-5-semialdehyde-dehydrogenase
MNTHVVNQLRAAKKATTDLSLIQSDTRTEVLKTLAANLEKHLENIIQENQKDLSLMPEQDPRYDRLLLSKERILSLANDVRKVADLPNPLGVNLLEKSMPSGLSIKKITVPLGVIAVIYESRPNVTIDIFSLCFKSGNVSILKGGKEAYFTNSYLVLLIKNTLKNFNINTDLVCLLPPERALMTQLLNATGFVDLCIPRGSQNLINFVRDNAKIPVIETGAGIVHTYFDKSGDLEKGKKIINNAKTRRVSVCNALDTLIIHTDRLKDLPELVEALSKNNVIIYADKEAYQALDKSYPEQLLMRAKPQDFGHEFLDYKLAIKTVPNIQAAIDHIQQFSSHHSEAIIAEEESAIDKFLIEVDAAAVYANASTAFTDGGEFGLGAEIGISTQKVHARGPMGLDALTSYKWVIRGTGQIRN
>NZ_CP021259.1|WP_106225321.1|1811081_1812152_-|glutamate-5-kinase
MKIIIKVGTQSILSADGSPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSLGKTYGDTVGEKQLLASIGQPELMNLYSNLFKNENILVSQLLLTKQDFHTRQHYLNIARLLTELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPNDPEAKLINTIDPNLGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTAIANVNVESIVLKILDREAVGTIILASKRKSSIKRWIAFSHRTSLPSIVINDNLIALLRNGNRVMSILPIGIENFRGECKKGDLIDILNSNNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDHLHIL
>NZ_CP021259.1|WP_027227104.1|1812335_1812761_-|GNAT-family-N-acetyltransferase
MNYQFELVVDTKLLEQQDKMIRDGIVNFNAPFTGSKPERYSIYVKDNENNIVGGAIVYAHKSSIYVDVLWVSEKYRGQGIGAELLRSVETEAVKRGILESTLDTFSFQAEGFYLKQGYKHLGTIKNYLEGHDRIYLRKKLK
>NZ_CP021259.1|WP_106225322.1|1812988_1813966_+|aminoglycoside-phosphotransferase-family-protein
MMRRNELLFSDEELIDYLYQGYQIKAVRLYFVNMGSFYGFIVETKENKKYFLKVYPKDQSLVPSPPTIESLHQTGIALNRFKQEFGMNNLSCMLPDVKENYCFTTNRLILTLFDYIEGIHPSYAPNQLLSDKMAALLFQLHHIPASAFPVFARENFNIDYALGMSEWIGHSIDIIDTTHAPSMFSKLNENKEQLLDGLIQLQQWSERFSKMSLLFVITHGDPHHYNVLQTPLDVWLIDWDGIKIAPRERDLWHYLNTPLIKAYSKISPQCTINKSLCEFYRLQRFFEDCRYYLEQVLLGKNTTAMQSEEDKNSFLTHWGWSVCLK
>NZ_CP021259.1|WP_027221798.1|1814049_1814997_-|MerR-family-transcriptional-regulator
MTQWFVKDLSQLTGVSVQTLHHYDRIGLLKPSLRLANGYRVYSEKDLLKLQQIIALKFFGFELSQIKTLLAEESNALSHFNSQARLLEQKASTLLEGAKTLRRIIDTVDKNQSIPWETIIQLIEVYKMTEHLEHGWVKEIFTPDELKQYVEFEKEMKANATPEQKAAMENNWSQLVNEVKNNLKQDPDSKTGVYLGKKIMDWVNGVYGKKYAHLRTKKFEQGFGEGKGLDEVGLTPEIVSWMDKAMDAYWRDRIYGILEQVGKTSSSIVLNLWNEMLVDMYGEETSRKNAIYEIALNDDKVSPEAKAWLRNILNS
>NZ_CP021259.1|WP_106225323.1|1815320_1816070_-|MerR-family-transcriptional-regulator
MAYTVKQLAKISNVSVRTLHWYDEIGLLKPAYQGANGYRYYEEKQCLKLQQILFFRELGFPLNDIQKLLMQDDFDHIKALEAHKQILERDINRKNQLIATIDKTIQHLRGKHKMSNEELYYGFDSQRQKQYERELVKEGVVSQDWMDKYKKKINQWTQADKDRFIQEGKEINQLLISAINNQLKPSSPEVQAIIHRHHAWVGWNPTKEGYIGLSQRYLTPEFRKFYEQQHPALLEFIIEGMLFYANKNL
>NZ_CP021259.1|WP_106225324.1|1816138_1817137_-|GNAT-family-N-acetyltransferase
MIQIEKITGELAQALCSTITKDLPEYFGLPEVNEHYAIGVRTRTNFAAKKGNDVIGLISIDFPYPNNANIYWMAVRRDFHRQGVGKQLIEAACYFAKTQRAITITVETLSPSESEDNYLKTYQFYQSVGFHSLFDLKPKSYEWSMVYMVKELGISIEPQQANVIIKVLELSEIPILVNAFQKANWQKPASLFEAYYQEQQKFLRVVWVAYFREQIAGYVTLKWISQYQSFAHQQIPEIMDLNVLPSFRKQGVGTALLQAAEEKAASESDVVGIGVGLYGGHDGGYGQAQRLYVNRGYIPDGLGVTYGYKPTVPGQVYPLDDDFILWFTKKLR
>NZ_CP021259.1|WP_106225325.1|1817133_1818090_-|GNAT-family-N-acetyltransferase
MSVKQEQHLIKVVPYDSSWSMQFEQEAEQIKKALGNNCIDIHHIGSTSVPGLAAKPVIDMIPVILDLSKVDSANTAMRTLGYEAKGEYGIPFRRYFQKGDNQRTHHAHVFELGNSEIERHLKFRDWMRSHPEDREAYARLKQELARQYSDDITAYCLGKEDFIAIIDKKAGFNGLRMVKALTPREWDKVRHFRQFYFFDKAGLSDPYTWTFEHDAHVHFVLFQGSEIIGYTHLQLWPHNRAALRIIVIDELKRNHQYGNRFLTLCEKWLKSQGYQSLHVESSPDALRFYRNNGYIDMSFDDPDGYEGDARDTAVGKIL
>NZ_CP021259.1|WP_106225326.1|1818093_1819875_-|ABC-transporter-ATP-binding-protein
MTNRLPNHLGSFVWHFLKPYRNIVMLFILFALLAGFWGPFNSLLVKSFINTLAAKASKDLSSLYWIAGLLVLNFIVFDNITWRTLGYLNYKYEAVIKNQIISQTFEYVLGGSTQFFQDNLSGRIADQITTLADNLEIILHRVSVDFLRGASLLVVSFITAYFVNVLFFYILFLWFIAFASFSIWMSARLVQLSDDHASSESQLSGQLVDSLANQSNIRIFSRKIYEVERMNAFFRMVQRAFQRKELFIVLLCCAQGGMIAVMMGFASITLIHLYGKGLVSIGDFALILGLSMELGHMMWYTMYQVDQFNQALGKAKQSLNALVIPHEIKDKGNASQLVVTQGQIEFSRVKFHYQGGYSLFQNKSVTIKAGQKVGLVGYSGSGKSTFVNLILRLYEVVEGQILIDGQNLSEVTQESLRQAIAMIPQDPTLFHRSLMDNIRYGRTDATDEEVILASRKAHAHEFISLLPEGYKTLVGERGVKLSGGQRQRIAIARAILKNAPILMLDEATSQLDSITESNIQESLWELMQGKTTLVIAHRLSTLLHMDRILVFDKGHIVEDGNHDELLKRGGLYKTLWNAQVGGFLPDQQNEKGE
>NZ_CP021259.1|WP_106225327.1|1819867_1821328_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MNHKPIQFKDLSLIYPHKTCFQDFSGEIHFADRIALIGRNGSGKSTLLKMLCGLFLAPAGEIKIPHDVRFGHLPQVLEDCPDLSGGQRLNRVLSKILSDEPNVLLLDEPTNHLDSRNRRSLMRMLEHYPGTLIIASHDTELINTVTDTLWHIDLGQVTVFRGIYFDYQQILEDKKASIEQELSRIARQKKESHLALMKEQERNKRARVQGEKKIAQRKWPTIRSHTRLGSAITTGNKRLSDICHKKQQLIEELSSLNLTEVIQPKFKLKGLEHHKPLIRIQDASIAYESGVILKDIYFHLSGCERVALHGNNASGKSTFVKAILGDSQIKRTGEWAVPNCNTIGYLDQHYQHLNLNETVLDLMSSKMPHATYAEIRAHLNDFLFRKNEEVEIKVKSLSGGEKARLSLALIAAQPPKLLILDEITNNVDLETRTHIIEVLSEFPGAMLVISHDHDFLESIHIETKYQIHQGKLYGFNDAYLEVIHHD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021259_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021259_2

2697242-2697409

Orphan

Consensus_repeat	Method
TAAATTTACCGCCATAACAGTAATTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021259_2

>merge|NZ_CP021259|2|2697242-2697409|CRISPRCasFinder
TAAATTTACCGCCATAACAGTAATTTTATAAATTTAACATAAATAAATACACAGAAAATTAGAAAATCGAGTAAATTTACCGCCATAACAGTAATTTATGGTGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATCATTTTTACTGCTATAACAGTAATAT

>NZ_CP021259|2|2|2697242-2697409|CRISPRCasFinder
TAAATTTACCGCCATAACAGTAATTT	TATAAATTTAACATAAATAAATACACAGAAAATTAGAAAATCGAG
TAAATTTACCGCCATAACAGTAATTT	ATGGTGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAAT
CATTTTTACTGCTATAACAGTAATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021259.1\|WP_027227411.1\|2694527_2694839_-\|cupin	unknown	unknown	gnl\|CDD\|380355
NZ_CP021259.1\|WP_106225651.1\|2693003_2693864_+\|DUF2608-domain-containing-protein	unknown	unknown	gnl\|CDD\|378542
NZ_CP021259.1\|WP_061504501.1\|2690373_2691495_-\|ISAs1-family-transposase	unknown	unknown	gnl\|CDD\|379382
NZ_CP021259.1\|WP_027227416.1\|2697654_2697963_+\|HipA-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|274416
NZ_CP021259.1\|WP_106225654.1\|2700349_2701537_-\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|224316
NZ_CP021259.1\|WP_027227414.1\|2696072_2696990_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP021259.1\|WP_106225649.1\|2689120_2690341_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	unknown	unknown	gnl\|CDD\|341492
NZ_CP021259.1\|WP_106225656.1\|2705264_2706167_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021259.1\|WP_106225657.1\|2706328_2707783_+\|symporter	unknown	unknown	unknown
NZ_CP021259.1\|WP_063720028.1\|2702427_2702784_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021259.1\|WP_106225655.1\|2702824_2703757_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021259.1\|WP_027227413.1\|2695409_2695883_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021259.1\|WP_027227407.1\|2688906_2689134_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
NZ_CP021259.1\|WP_031301595.1\|2694854_2695103_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180883
NZ_CP021259.1\|WP_106225652.1\|2697959_2698898_+\|lpg2370-family-Dot/Icm-T4SS-effector	unknown	unknown	gnl\|CDD\|377920
NZ_CP021259.1\|WP_106225653.1\|2699194_2700358_+\|serine-kinase	unknown	unknown	unknown
NZ_CP021259.1\|WP_106225650.1\|2692007_2692913_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP021259.1\|WP_027227415.1\|2697430_2697658_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
NZ_CP021259.1\|WP_106225938.1\|2691611_2691968_-\|preprotein-translocase	unknown	unknown	gnl\|CDD\|271182
NZ_CP021259.1\|WP_011214444.1\|2701661_2701829_-\|DUF3309-domain-containing-protein	unknown	unknown	gnl\|CDD\|378708

Protein	Function_ID	Function_description	E-value
NZ_CP021259.1\|WP_027227411.1\|2694527_2694839_-\|cupin	gnl\|CDD\|380355	cd02226, cupin_YdbB-like, Bacillus subtilis YdbB and related proteins, cupin domain. This family includes bacterial proteins homologous to YdbB, a Bacillus subtilis protein of unknown function. It also includes protein Nmb1881 From Neisseria meningitidis, also of unknown function. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.62088e-10
NZ_CP021259.1\|WP_106225651.1\|2693003_2693864_+\|DUF2608-domain-containing-protein	gnl\|CDD\|378542	pfam11019, DUF2608, Protein of unknown function (DUF2608). This family is conserved in Bacteria. The function is not known.	2.81655e-66
NZ_CP021259.1\|WP_061504501.1\|2690373_2691495_-\|ISAs1-family-transposase	gnl\|CDD\|379382	pfam13808, DDE_Tnp_1_assoc, DDE_Tnp_1-associated. This domain is frequently found N-terminal to the transposase, IS family DDE_Tnp_1, pfam01609 and its relatives.	6.82255e-34
NZ_CP021259.1\|WP_031301595.1\|2694854_2695103_-\|hypothetical-protein	gnl\|CDD\|180883	PRK07206, PRK07206, hypothetical protein; Provisional.	4.2641e-28
NZ_CP021259.1\|WP_106225654.1\|2700349_2701537_-\|fatty-acid-desaturase	gnl\|CDD\|224316	COG1398, OLE1, Fatty-acid desaturase [Lipid metabolism].	5.54443e-86
NZ_CP021259.1\|WP_027227414.1\|2696072_2696990_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.49817e-54
NZ_CP021259.1\|WP_106225649.1\|2689120_2690341_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	gnl\|CDD\|341492	cd17793, HipA, type II toxin-antitoxin sytem toxin HipA and similar proteins. This family contains type II toxin-antitoxin (TA) system HipA family toxins similar to Escherichia coli and Shewanella oneidensis HipA, which is a serine/threonine-protein kinase that phosphorylates Glu-tRNA-ligase (GltX), preventing it from being charged, leading to an increase in uncharged tRNA(Glu). This induces amino acid starvation and the stringent response via RelA/SpoT and increased (p)ppGpp levels, which inhibits replication, transcription, translation and cell wall synthesis, reducing growth and leading to persistence and multidrug resistance. HipA is the toxin component of the HipA-HipB TA module that is a major factor in persistence and bioflim formation; its toxic effect is neutralized by its cognate antitoxin HipB. HipA, with HipB, acts as a a corepressor for transcription of the hipBA promoter. Structures of HipAB:DNA complexes from both Escherichia coli and Shewanella oneidensis reveal distinct complex assembly.	5.06636e-165
NZ_CP021259.1\|WP_106225650.1\|2692007_2692913_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.1359e-52
NZ_CP021259.1\|WP_027227407.1\|2688906_2689134_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	2.73488e-18
NZ_CP021259.1\|WP_027227416.1\|2697654_2697963_+\|HipA-N-terminal-domain-containing-protein	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	2.48908e-43
NZ_CP021259.1\|WP_106225652.1\|2697959_2698898_+\|lpg2370-family-Dot/Icm-T4SS-effector	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	6.06004e-59
NZ_CP021259.1\|WP_027227415.1\|2697430_2697658_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	3.72777e-23
NZ_CP021259.1\|WP_106225938.1\|2691611_2691968_-\|preprotein-translocase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.91007e-13
NZ_CP021259.1\|WP_011214444.1\|2701661_2701829_-\|DUF3309-domain-containing-protein	gnl\|CDD\|378708	pfam11752, DUF3309, Protein of unknown function (DUF3309). This family is conserved in bacteria but its function is not known.	1.02464e-06

>NZ_CP021259.1|WP_027227414.1|2696072_2696990_+|LysR-family-transcriptional-regulator
MDKLNLNLLRALYALLTCRHLTLASKKMGISQSSMSIYLKQLREHFHDDLLVRGQGSIMQLTPLANSLIGKARQALSLIETLFNTIETFNPLISERSFSIGMTDLMSILLTPSLIKRLEQEAPGVKLNIKHPSYLNTVEVFESGDIDLMIGMFERVPESLKQQKLFQDEAVIVGGSNHPGIQKGKICIEELFKYPLIQFSLRETPFYNYFDRYLRQLGHDKRVSISLGQGIMPLFVLTDSHYLTLSIRKVAEKLSHLIPLSIASVPFEVDSFNCYQYWHQKDDADPGHRWLREMVLSIAKKSHLK
>NZ_CP021259.1|WP_027227413.1|2695409_2695883_+|hypothetical-protein
MRSRTEKLSSKRSIINHDHLITDEVCMIGIYREGGDLSIYAESPEGIEHFSINRGNNLDMVILPHTLVGTWRHHQLLRTVEQAAQIRTLRIRSHDYIEQSVTRTELEQFKEVFMLACKEEISNQPEIEDYLQTALGKLHGEAEMTYKPKFTEQCSIL
>NZ_CP021259.1|WP_031301595.1|2694854_2695103_-|hypothetical-protein
MLDEHQNLEYIKKLISFVTLKLNVRPGKYLKKTVDLFSMPGLLILSHESKEQVESDYNLVRKLEQKGLFVLAASQESKTTKI
>NZ_CP021259.1|WP_027227411.1|2694527_2694839_-|cupin
MQIIKSSLFTGDFTWQALDIAQISDASIRLHWADQPYIWHKNDGDEVFVVLSGKVIMHYREGGVENQKELNSGDICYLKEGCEHVAYPKGAARILVIEKAGSI
>NZ_CP021259.1|WP_106225651.1|2693003_2693864_+|DUF2608-domain-containing-protein
MRFIIIFIYLLLLNPVFAEVIHYQTDTFAKIAAQYKKLGTDPKTTLMVFDLDDTLITMTQPLGSVGWWDWQHELQKQGGGSDKLFTKDYQQLVRIQNILFQLVKMEVTDEYVLPFLKDAANQGTTLMGLTARGKEHLSATLMQLKDNQFTIDDKLLFRKKGLKLNNNKTSVAGNFHCPQFSREVIYQQGIMFLDGEDKGEALLCILANTKQDIKTILFVDDAKRNIVSMDNAFANRDEFLVLNVFYTKENAKELEIQTNPHLQAQVFEQWNFIKENLNNVIIRSNF
>NZ_CP021259.1|WP_106225650.1|2692007_2692913_-|LysR-family-transcriptional-regulator
MINNSLNLNDLAIFALVVKKRSFTQAALEAGISKAWVSQKISQLEGKLDIKLLNRTTRSLSLTLGGEILFEHCQTMLKEVIHAENHLREYAKAPSGKLVITCPEISGLDLFPTLLHQFKLLYPQIKIRLIITDQFVDLTQQGIDFAFRTGKLTDSGLVSRYIGAVPRCLVASPEYLSNNSPIKNPADLFNHQLLKHSSLPDWLLKKEEEVFKMHVKNPVIESNSLIFLHKMSCLHHGIAFLPYYLCSDALKHKTLVKVLPDWLNVDNEYYMVYHKEKSVLYIHQLFKDFILQSDLNKMISN
>NZ_CP021259.1|WP_106225938.1|2691611_2691968_-|preprotein-translocase
MSDFVYVLMERRGRNKTSEFVFPDESRTGYIYEPQKAVNRVVELYGVPFTKHDFRRTFVTIADSLDLPADALKRLVNHKMNNDVTAGYIMKDVERLRKPMQQVANFILEHMMETAELS
>NZ_CP021259.1|WP_061504501.1|2690373_2691495_-|ISAs1-family-transposase
MSFVENFSILKDPRSEINQRHNLLDILFLAGTAVMSGAEGWKDIKDFGEEKLDWLRQYRDFKHGIPADDTIARVISALDSEQFTLCFVNWVNELRSKDGREQIAIDGKTLRRSYTGDRTTALHSITAWSKRNGLILAQMRSNGKANEKASVLEMLDLLELKGAIVTADAMNTEKKIAKKIHDKGGDYVLCVKNNHKKLLNEIKDYFHIMQRDHREIWSQNYFEEVDAGHGRIETRTCRQIAISPWIEGYAEWQGLQTVIEVTRTREINEKTNTEVQYYISSLPLEPKQIADAIREHWAVENKAHWVLDVTYKEDDSRIRRDNAAENLALLRRFALNLARLHPQKNSMKGKLKKAMWSDKFRSELLIGQIQGKV
>NZ_CP021259.1|WP_106225649.1|2689120_2690341_+|type-II-toxin-antitoxin-system-HipA-family-toxin
MKNHKLDVYLNQTLTGQLRIDTHGEMSFVYDEGYLENNKNLPLSHSLPLQQAPYSTKQCRPFFSGLLPEAHMRTAIARQLGISEKNDFALLAAIGGECAGAVMILPQDTSITQLKPDYKIIKKQDVLEILQTMHQRPMIVGEDGIRLSLAGAQDKLPVAIIEGNLAIPMNGAPSTHILKPINRDFPSLIENESFCLNLAQKIGLNAVDASIHYADGTPYLLVKRYDRVETKQGIQRLHQEDFCQAMGISPEMKYQREGGPQISECFGLIREISSLPVLDIKELLQGILFNVIIGNNDAHSKNFSLLYHGSKVRLAPFYDLISTVYYPNLASKMAMKVGSKYDFDGLFPRHFIQMAEEARLSGALVRKEVLNLISKIQKNITASPFTSIILQRADKLFQKFQKASTG
>NZ_CP021259.1|WP_027227407.1|2688906_2689134_+|helix-turn-helix-transcriptional-regulator
MIQSPENIGRYIRKVRKELNVTQKDLALTAGTGLRFIIDLENGKPTCQIGKMLQVLQVLGIQLNLSHTDFENEKS
>NZ_CP021259.1|WP_027227415.1|2697430_2697658_+|helix-turn-helix-transcriptional-regulator
MRTHEIANLVHYYRKQSGLSQQELARLAGVGKTVIYDIEKGKESVRLNTLLKVLDVLNIQMKFETPFPQTTDNNS
>NZ_CP021259.1|WP_027227416.1|2697654_2697963_+|HipA-N-terminal-domain-containing-protein
MRKAYVSVNGIKAGTLEELQGGKYQFTYFDDYQGAPVSLTMPLTNKVYYFDVFPPFFEGLLPEGIMLEALLRKYKIDRNDYFGQLVIVGQDVVGAVTIEELR
>NZ_CP021259.1|WP_106225652.1|2697959_2698898_+|lpg2370-family-Dot/Icm-T4SS-effector
MKRCPITYERISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSIQGVQKKLSAKLKIKEGCFEIVDQNGHYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKSSMEKVIAVVEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEEIALPLKGKKNNLTKSDFLKYFAIEKLGLNQKVIDGIVQEFHQIIPEWRKLVGFSFLSQQMQEKYLQLLEQRCKRLNFFD
>NZ_CP021259.1|WP_106225653.1|2699194_2700358_+|serine-kinase
MYSLPLKSKSLRFFNLVFIALVLSFYLLANANAAGIKRYDFGEMSSKVTKAWDQDVALYVARRFAAENGFDEKEITVKKLEAGATNHFIYLMFINNQLKFVLKGLGTEKEAEALFALQNYSKIPDIQNNPQAATVTLSKTINSYEVKNDRKTYYFAILEAAQGKELFKIMTYELLQHKDINTLKDVFYRIGQQTSELHKTIIGHDQFITPRDLVTVIHDDFHPENTFYNLETNVFSLIDNESMGDSITNPLPIIRELYGFYEVPIIRWPSEKITVDLLKDADPHDIASIYYDFVLGMASVYHDSQDAKRVLIAAIIDLNNMAIAFLKDRYSEPWMFNPSDKHEAHIVWGKLAKVADNPQLAELYINKLAIINTDLQSLSGLWLQQLH
>NZ_CP021259.1|WP_106225654.1|2700349_2701537_-|fatty-acid-desaturase
MFFGILNLTLWGYVLAIFVLTQITIASVTLYLHRYQTHRALTMHPIVSHFFRFWIWLTTGMVTRVWVAIHRKHHAMTDVEGDPHSPQIFSIKKVFWQVPELYREAAKDKDMIEKYSHGTPNDWIERKLYSRYSSKGILLMFLIDLLLFGFPGITIWAIQMIWIPLSAGVVNGLGHYWGYRNFECSDRSTNVFPLGILIGGEELHNNHHTYASSAKFSVKWWEFDLGWFYIRCLSFLGLAKVKKLPPKLARDDTKQCVDLNTVKAIISNRFQIMSDYYKRVTIPILKNEKRNCNYIKNRKEWHLFKEAKRLLRQETTKANAHLQILLNRFEQLQLVYNYRQSLQQIWLKKVSSQKELIESLNQWCKKAEQSGLDVLHQFSLQLKSYVLIGTDGSSV
>NZ_CP021259.1|WP_011214444.1|2701661_2701829_-|DUF3309-domain-containing-protein
MLGTILLILLILLLLGSVPRWGYSRSWGYTPMGLIGLILVIYLILVLLGKVPIGF
>NZ_CP021259.1|WP_063720028.1|2702427_2702784_+|hypothetical-protein
MNLSVFSASELFAGADPEKVIQELTMVSKSYGSAISYHRLPAGSTKDLSEHSKYYLNLIDKAIEDVNLSLDDNSKATYSLRFALLQPLLVNLVAAAEVLKNEKTQEQEQKSSHSVRFM
>NZ_CP021259.1|WP_106225655.1|2702824_2703757_-|hypothetical-protein
MKKNQLNSLTNYYPALTRLRNIQDAQELGEMAHTLPWRQADELIECLFNNEEEFNRLIWSPYDISIVAKKFPKFADKLIDIFISNPEKFKKIIHFSSELGQVVDALNPRVANKLMDFIFCNENKIYKHIIRDSYNLCRFLFHRNLRQYSDRLINHILKDPDYFKLVVGDMGNLLRLAINHPQHADTLINMVIKDKEHFKKLISNRSNWSEQLSHFPKYEKIFANNVPIDENEKNRQLYLANAPRAEIRKNARLFAQAERTHSGQFFFSEAMPRELRIIIAGLTRDSCLCNEEEANQIAQENFSRPMKNAQ
>NZ_CP021259.1|WP_106225656.1|2705264_2706167_-|hypothetical-protein
MFPPLQDPWSELEELGFNPEYLKRLKERAATSIELTKNIEMLAGYYERFKAAGFTDRDLARIVSLVSFTSDNRLSNIGSRMMLTLVCGGLDLLKAPLNFNSHNLTNMMVSLNGLEKLRQLVKINQSHIIPFKNQAEFKAVFEKKCKKYPMLRVVWCYSDKEELYLENRRQDAIYKDWLSEEELHQLFRLRRVSKSQDLYYWERDELRPAFLSDNYYSREDLGQTREEFEKALDNADAVESWCDSWANPFDQNLIPKLAKSLEQSNQKNTSKIPFFTAVDNNEKSSVIDEQYSKYFSNYSK
>NZ_CP021259.1|WP_106225657.1|2706328_2707783_+|symporter
MKNKTRALNFLNRIERCIVPQSNPLIMKQLLSALGLDNINTGNEEYKFFIQTIKRKAIDLNPLINKIKSDILKNKSLCTLLAYIEENELIDDAEIENASSTIQLQINLLCLLEAITITMANSNDFAHDIYNHMMKQRGEGATGNPFYNFLFGIPSRATLFERLKLISIDPGLTSIIFHRQMGANPETQADLNDFVSQNRLSGWNADIELANFDVASTSTLPAMGVNILEAVWEDSTGHNKNTSGIPNAQAGLGLIAIMEEKEYTTSFKLAETTLPQGTTLHSDLGYSLIPELKVDNSPKKVSQFHIDEQWMNLYNSWNLCFVIANIDPVFVPLKLLIPSVFSAEPSNYKETRVLTLFLVANLFLNQQTLNNPLFSNNFSFQNGAAILKKWGEINRNHASELMQQSSPKTGKEPEALYNRVLGKHAHLNFGLKLLSYFQDSHQFRLTKKAKQSALNDHSFFSGTAASADNLEQLHLASQPSLNKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021259_2	2.2\|2697339\|45\|NZ_CP021259\|CRISPRCasFinder	2697339-2697383	45	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	257659-257703	2	0.956

1. spacer 2.2|2697339|45|NZ_CP021259|CRISPRCasFinder matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 2, identity: 0.956

atggtgaattaatgcaaaaaaatgcaataataaatttattttaat	CRISPR spacer
atggtgaattaatgcaaataaatgcaataataaatttatttttat	Protospacer
****************** *********************** **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1001422 : 1008261

Acinetobacter_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106224977.1\|1001422_1002199_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.5e-57	48.6
WP_061692139.1\|1002191_1003226_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	2.7e-75	47.6
WP_061637689.1\|1003203_1003782_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.0e-55	53.2
WP_010946572.1\|1003815_1004541_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-17	28.3
WP_011215024.1\|1004537_1005047_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_011215025.1\|1005027_1005597_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_011213328.1\|1005593_1006121_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.4e-27	47.7
WP_061692138.1\|1006134_1007097_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.1e-38	34.4
WP_011215026.1\|1007463_1008261_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-21	33.8

DBSCAN-SWA_2

1101870 : 1171592

Bandra_megavirus(10.0%)

protease,integrase,tRNA,transposase

attL 1165864:1165879|attR 1172566:1172581

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027221274.1\|1101870_1104666_+\|tRNA	isoleucine--tRNA ligase	A0A2K9V7W4	Bandra_megavirus	4.9e-87	27.8
WP_027221275.1\|1104662_1105127_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_027221276.1\|1105266_1105830_-	multidrug DMT transporter permease	NA	NA	NA	NA
WP_027221277.1\|1106004_1108194_-	hypothetical protein	NA	NA	NA	NA
WP_106224993.1\|1108439_1111565_-	hypothetical protein	NA	NA	NA	NA
WP_032828879.1\|1111829_1112717_+	GTPase Era	NA	NA	NA	NA
WP_027221280.1\|1112706_1113396_+	DNA repair protein RecO	NA	NA	NA	NA
WP_027221281.1\|1113460_1114636_-	DUF5617 domain-containing protein	NA	NA	NA	NA
WP_027221282.1\|1114797_1115685_-	GALA protein	NA	NA	NA	NA
WP_027221283.1\|1115984_1116731_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_027221284.1\|1116717_1118535_+	2-oxoacid:acceptor oxidoreductase subunit alpha	NA	NA	NA	NA
WP_192877332.1\|1118518_1119487_+	2-oxoacid:ferredoxin oxidoreductase subunit beta	NA	NA	NA	NA
WP_011946039.1\|1120030_1120306_+	hypothetical protein	NA	NA	NA	NA
WP_106224996.1\|1120296_1120503_+	hypothetical protein	NA	NA	NA	NA
WP_014841292.1\|1120802_1121477_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	3.1e-27	44.5
WP_027227651.1\|1121695_1122502_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_106224997.1\|1122513_1123956_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_106224998.1\|1124001_1124880_+	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_106224999.1\|1124906_1126574_+	AMP-binding protein	A0A1V0SBX8	Catovirus	7.3e-46	26.7
WP_106225000.1\|1126552_1130014_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_028377962.1\|1130090_1131353_-	DNA recombination protein RmuC	NA	NA	NA	NA
WP_028377963.1\|1131356_1132535_-	DUF4785 family protein	NA	NA	NA	NA
WP_192877333.1\|1132531_1133431_-	hypothetical protein	NA	NA	NA	NA
WP_192877334.1\|1133617_1135639_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	2.6e-138	42.5
WP_192877381.1\|1135768_1137925_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_106225004.1\|1137921_1138899_+	ABC transporter permease	NA	NA	NA	NA
WP_192877335.1\|1138922_1140269_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_027227662.1\|1140343_1143790_+	DNA polymerase III subunit alpha	A0A291AWR1	Streptomyces_phage	2.3e-187	36.0
WP_027227663.1\|1143872_1145123_-	hypothetical protein	NA	NA	NA	NA
WP_027227664.1\|1145598_1146483_+	decaprenyl-phosphate phosphoribosyltransferase	NA	NA	NA	NA
WP_192877336.1\|1146482_1147991_+	protein LphB	NA	NA	NA	NA
WP_027227666.1\|1148045_1149923_+	polysaccharide biosynthesis protein	L7Y3T9	Megavirus	1.8e-24	29.1
WP_106225007.1\|1150069_1150663_-	hypothetical protein	NA	NA	NA	NA
WP_106225008.1\|1151032_1152727_-	hypothetical protein	NA	NA	NA	NA
WP_027227669.1\|1153139_1153880_+	hypothetical protein	NA	NA	NA	NA
WP_027227670.1\|1153979_1155443_-	amino acid permease	NA	NA	NA	NA
WP_106225009.1\|1155822_1156968_+	multidrug DMT transporter permease	NA	NA	NA	NA
WP_106224842.1\|1157099_1158086_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.2e-33	31.1
WP_106225010.1\|1158631_1159390_+	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_106225011.1\|1159460_1160528_+	hypothetical protein	NA	NA	NA	NA
WP_106225012.1\|1160583_1162257_-	hypothetical protein	NA	NA	NA	NA
WP_152687500.1\|1162253_1162988_-	hypothetical protein	NA	NA	NA	NA
WP_106225015.1\|1163394_1163997_-	hypothetical protein	NA	NA	NA	NA
WP_106225016.1\|1164171_1164678_-	antirestriction protein ArdA	A0A1I9S7Y0	Rhodococcus_phage	1.4e-16	36.0
WP_106225017.1\|1164743_1165166_-	single-stranded DNA-binding protein	A0A077SK05	Escherichia_phage	2.1e-18	41.4
WP_106225018.1\|1165266_1165461_-	hypothetical protein	NA	NA	NA	NA
1165864:1165879	attL	NA	NA	NA	NA
WP_192877337.1\|1165871_1166411_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106225020.1\|1166582_1167842_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_106225021.1\|1167834_1168827_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_106225022.1\|1168829_1169837_+\|integrase	tyrosine-type recombinase/integrase	S5M872	Bacillus_phage	1.3e-10	24.5
WP_106225023.1\|1170084_1170594_+	hypothetical protein	NA	NA	NA	NA
WP_192877338.1\|1170692_1171592_-\|integrase	integrase domain-containing protein	NA	NA	NA	NA
1172566:1172581	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1260970 : 1282821

Pseudomonas_phage(25.0%)

transposase,integrase

attL 1262413:1262432|attR 1270550:1270569

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106225101.1\|1260970_1262152_-\|integrase	site-specific integrase	A0A0M4QX09	Salmonella_phage	6.5e-41	29.7
1262413:1262432	attL	NA	NA	NA	NA
WP_106225102.1\|1262885_1264079_+	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_106225103.1\|1264283_1266038_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	5.1e-66	32.8
WP_061692146.1\|1266115_1266367_-	hypothetical protein	NA	NA	NA	NA
WP_106225105.1\|1266790_1267150_+	transcriptional regulator	NA	NA	NA	NA
WP_106225106.1\|1267391_1267838_+	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	1.4e-25	45.5
WP_106225107.1\|1267841_1268411_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	9.4e-54	58.5
WP_106225108.1\|1268596_1269277_+	hypothetical protein	NA	NA	NA	NA
WP_106225109.1\|1269297_1270515_-\|integrase	integrase family protein	A0A0M3LRG1	Mannheimia_phage	4.6e-05	24.4
WP_106224842.1\|1270774_1271761_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.2e-33	31.1
1270550:1270569	attR	NA	NA	NA	NA
WP_106225110.1\|1271930_1272704_+	hypothetical protein	NA	NA	NA	NA
WP_106225111.1\|1272884_1273256_+	hypothetical protein	NA	NA	NA	NA
WP_011215191.1\|1273255_1273615_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_106225112.1\|1273683_1273947_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_061504501.1\|1274357_1275479_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_106225113.1\|1275463_1276480_-\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	2.7e-152	78.5
WP_106225114.1\|1276579_1276780_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_027221326.1\|1277144_1277648_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106225115.1\|1277650_1278832_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_106225116.1\|1279006_1279297_+	hypothetical protein	NA	NA	NA	NA
WP_161499092.1\|1279445_1279619_-	hypothetical protein	NA	NA	NA	NA
WP_011214444.1\|1279730_1279898_+	DUF3309 domain-containing protein	NA	NA	NA	NA
WP_161499093.1\|1280385_1281309_+	fatty acid desaturase	NA	NA	NA	NA
WP_027221328.1\|1281431_1281683_-	hypothetical protein	NA	NA	NA	NA
WP_027221329.1\|1281703_1281910_-	CsbD family protein	NA	NA	NA	NA
WP_106225118.1\|1282020_1282374_-	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_106225119.1\|1282608_1282821_-\|transposase	transposase	A0A1B0Z042	Pseudomonas_phage	1.1e-07	47.6

DBSCAN-SWA_4

1379082 : 1388578

Staphylococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027227755.1\|1379082_1380411_+	sigma-54-dependent Fis family transcriptional regulator	W8CYM9	Bacillus_phage	1.7e-08	26.8
WP_011213531.1\|1380585_1380831_+	hypothetical protein	NA	NA	NA	NA
WP_027227756.1\|1381141_1382578_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_027227757.1\|1382640_1383714_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.8e-29	26.9
WP_027227758.1\|1383698_1384313_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	4.6e-22	38.4
WP_027227759.1\|1384309_1385518_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.9e-98	48.7
WP_106225156.1\|1385525_1385993_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	9.2e-23	49.1
WP_028378484.1\|1386119_1387757_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.2e-155	52.5
WP_027227762.1\|1387753_1388578_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.1e-54	44.3

DBSCAN-SWA_5

2328177 : 2338294

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106225504.1\|2328177_2329860_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.1e-16	30.4
WP_062726360.1\|2329993_2331001_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_106184006.1\|2331125_2332451_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	6.2e-48	31.4
WP_027229220.1\|2332469_2333618_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.7e-126	58.2
WP_027229221.1\|2333820_2334933_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	4.7e-49	34.4
WP_027229222.1\|2335031_2336171_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.6e-23	26.7
WP_106225505.1\|2336359_2338294_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021259

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection