CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP027848	Staphylococcus muscae strain ATCC 49910 chromosome, complete genome	3 crisprs	DEDDh,csa3,cas3,DinG,WYL,cas14j	2	15	7	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027848_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027848_1

174424-177065

Orphan

Consensus_repeat	Method
TCNGANTCNGANTCNCTNTCAGAATCNGANTC	CRT

33 spacers

The CRISPR arrays of NZ_CP027848_1

>merge|NZ_CP027848|1|174424-177065|CRT
TTAGAATCTGAGTTACTGTCAGAATCCGAGTCGCTGTCAGAATCGCTGTCAGAGTCTGAGTCGCTATCTGAATCAGAGTCACTATCAGAATCGGAATCGCTGTCCGAATCTGAGTCACTATCAGAATCTGAATCACTGTCCGAATCAGAATCGCTATCAGAGTCTGAGTCACTATCCGAGTCAGAATCGCTATCAGAATCCGAATCGCTGTCGGAATCCGAATCGCTGTCAGAATCTGAGTCGCTATCAGAATCGGAGTCACTATCAGAGTCAGAGTCACTGTCGGAGTCGGAATCGCTGTCCGAATCTGAGTCGCTATCAGAATCACTGTCAGAGTCGGAATCGCTGTCAGAATCCGAGTCGCTATCCGAATCAGAATCACTGTCAGAATCCGAGTCACTATCAGAATCTGAGTCGCTATCCGAATCAGAATCACTGTCAGAATCCGAGTCACTATCAGAATCTGAGTCGCTATCAGAATCTGAGTCACTATCCGAGTCGGAATCACTGTCGGAGTCAGAGTCGCTGTCAGAATCAGAATCGCTGTCTGCATCCGAATCGCTATCCGAGTCAGAATCGCTATCAGAATCCGAATCGCTGTCGGAATCCGAATCGCTGTCCGAATCTGAGTCGCTATCAGAATCTGAGTCACTATCAGAATCGCTGTCAGAATCCGAGTCGCTATCGGAGTCTGAATCACTGTCGGAGTCTGAGTCACTATCAGAATCCGAGTCACTGTCCGAGTCCGAATCACTGTCAGAGTCGGAATCGCTATCTGAGTCAGAATCGCTATCTGCATCCGAATCGCTATCTGCATCAGAATCGCTGTCAGAGTCAGAGTCGCTATCAGAATCAGAGTCGCTATCTGCATCAGAATCGCTATCTGCATCAGAATCACTGTCAGAGTCAGAGTCACTATCCGAATCAGAGTCACTGTCGGAGTCGGAATCGCTGTCAGAATCAGAGTCGCTGTCGGAATCCGAGTCACTATCTGCATCAGAATCACTGTCGGAATCCGAATCGCTATCAGAATCTGAGTCACTATCCGAGTCAGAGTCGCTGTCGGCATCAGAGTCGCTATCGGAGTCTGAATCACTATCAGAATCCGAATCACTGTCAGAATCCGAATCACTGTCAGAATCCGAGTCAGAGTCGCTGTCCGAATCGCTGTCAGAATCCGAGTCACTATCAGAATCGGAATCACTGTCAGAATCAGAATCGCTATCCGAGTCTGAGTCACTATCAGAGTCCGAGTCGCTATCGGAGTCCGAGTCGCTATCTGCATCCGAATCGCTGTCAGAATCCGAGTCGCTATCAGAATCAGAATCACTGTCTGCATCAGAATCGCTGTCAGAATCCGAGTCGCTGTCAGAATCCGAGTCACTATCAGAATCGCTGTCGGAGTCAGAATCACTGTCGGAGTCAGAATCACTGTCGGAATCAGAATCGCTGTCGGAGTCAGAGTCACTATCAGAATCGGAATCGCTGTCCGAGTCCGAATCGCTGTCGGAATCAGAATCGCTGTCGGAATCAGAATCGCTATCAGAATCCGAGTCACTGTCGGAGTCAGAGTCGCTGTCCGAATCTGAGTCGCTGTCGGAATCAGAATCGCTATCAGAATCCGAGTCGCTGTCAGAGTCCGAATCACTATCTGAGTCAGAGTCACTATCAGAATCGGAATCACTGTCGGAGTCAGAATCACTGTCGGAATCTGAATCACTGTCGGAATCAGAATCACTGTCAGAATCCGAGTCGCTATCTGAATCAGAATCACTATCCGAATCGCTGTCAGAGTCCGAATCACTATCAGAATCAGAATCGCTGTCAGAGTCCGAGTCGCTGTCGGAGTCGGAATCGCTGTCAGAATCCGAGTCGCTATCAGAATCCGAGTCGCTATCAGAATCTGAGTCACTATCCGAATCCGAATCGCTGTCTGAGTCAGAATCGCTATCCGAATCTGAGTCGCTGTCAGAATCCGAGTCGCTGTCAGAATCCGAGTCACTATCGGAGTCGGAATCGCTGTCGGAGTCAGAATCACTGTCAGAGTCACTATCAGAATCCGAATCACTATCAGAATCTGAATCACTGTCGGAGTCCGAGTCGCTGTCAGAATCAGAATCGCTATCGGAATCCGAGTCAGAATCGCTGTCGGAGTCGGAATCGCTGTCGGAGTCGGAATCGCTGTCGGAATCCGAGTCAGAGTCGCTATCAGAATCCGAGTCACTATCGGAATCGCTGTCAGAGTCAGAATCGCTGTCAGAATCTGAGTCACTGTCAGAATCCGAATCACTGTCAGAATCCGAATCACTGTCAGAATCCGAATCACTGTCAGAATCCGAATCACTATCAGAATCTGAATCACTGTCGGAATCCGAGTCACTGTCAGAATCCGAGTCGCTGTCAGAATCCGAGTCGCTGTCAGAATCCGAGTCAGAATCGCTGTCGGCATCAGAATCACTGTCAGAATCTGAATCGCTATCCGAGTCAGAGTCGCTGTCCGAGTCTGAGTCACTGTCAGAATCCGAGTCGCTATCTGCATCCGAGTCGCTATCGGAATCAGAATCAGAATCCGAATCGCTGTCCGAGTCAGAGTCGCTATCGGAGTCGCTATCTGCATCCGAGTCACTGTCGGAATCTGAGTC

>NZ_CP027848|1|1|174424-177065|CRT
TTAGAATCTGAGTTACTGTCAGAATC	CGAGTCGCTGTCAGAATCGCTGTCAGAGTCTGAGTCGCTA
TCTGAATCAGAGTCACTATCAGAATC	GGAATCGCTGTCCGAATCTGAGTCACTATCAGAATCTGAATCACTG
TCCGAATCAGAATCGCTATCAGAGTC	TGAGTCACTATCCGAGTCAGAATCGCTATCAGAATCCGAATCGCTGTCGGAATCCGAATCGCTG
TCAGAATCTGAGTCGCTATCAGAATC	GGAGTCACTATCAGAGTCAGAGTCACTGTCGGAGTCGGAATCGCTG
TCCGAATCTGAGTCGCTATCAGAATC	ACTGTCAGAGTCGGAATCGCTGTCAGAATCCGAGTCGCTATCCGAATCAGAATCACTG
TCAGAATCCGAGTCACTATCAGAATC	TGAGTCGCTATCCGAATCAGAATCACTGTCAGAATCCGAGTCACTA
TCAGAATCTGAGTCGCTATCAGAATC	TGAGTCACTATCCGAGTCGGAATCACTGTCGGAGTCAGAGTCGCTGTCAGAATCAGAATCGCTGTCTGCATCCGAATCGCTA
TCCGAGTCAGAATCGCTATCAGAATC	CGAATCGCTGTCGGAATCCGAATCGCTGTCCGAATCTGAGTCGCTA
TCAGAATCTGAGTCACTATCAGAATC	GCTGTCAGAATCCGAGTCGCTATCGGAGTCTGAATCACTG
TCGGAGTCTGAGTCACTATCAGAATC	CGAGTCACTGTCCGAGTCCGAATCACTG
TCAGAGTCGGAATCGCTATCTGAGTC	AGAATCGCTATCTGCATCCGAATCGCTATCTGCATCAGAATCGCTG
TCAGAGTCAGAGTCGCTATCAGAATC	AGAGTCGCTATCTGCATCAGAATCGCTATCTGCATCAGAATCACTG
TCAGAGTCAGAGTCACTATCCGAATC	AGAGTCACTGTCGGAGTCGGAATCGCTG
TCAGAATCAGAGTCGCTGTCGGAATC	CGAGTCACTATCTGCATCAGAATCACTGTCGGAATCCGAATCGCTATCAGAATCTGAGTCACTA
TCCGAGTCAGAGTCGCTGTCGGCATC	AGAGTCGCTATCGGAGTCTGAATCACTATCAGAATCCGAATCACTGTCAGAATCCGAATCACTGTCAGAA
TCCGAGTCAGAGTCGCTGTCCGAATC	GCTGTCAGAATCCGAGTCACTATCAGAATCGGAATCACTGTCAGAATCAGAATCGCTA
TCCGAGTCTGAGTCACTATCAGAGTC	CGAGTCGCTATCGGAGTCCGAGTCGCTATCTGCATCCGAATCGCTG
TCAGAATCCGAGTCGCTATCAGAATC	AGAATCACTGTCTGCATCAGAATCGCTG
TCAGAATCCGAGTCGCTGTCAGAATC	CGAGTCACTATCAGAATCGCTGTCGGAGTCAGAATCACTGTCGGAGTCAGAATCACTG
TCGGAATCAGAATCGCTGTCGGAGTC	AGAGTCACTATCAGAATCGGAATCGCTGTCCGAGTCCGAATCGCTG
TCGGAATCAGAATCGCTGTCGGAATC	AGAATCGCTATCAGAATCCGAGTCACTGTCGGAGTCAGAGTCGCTGTCCGAATCTGAGTCGCTG
TCGGAATCAGAATCGCTATCAGAATC	CGAGTCGCTGTCAGAGTCCGAATCACTATCTGAGTCAGAGTCACTATCAGAATCGGAATCACTG
TCGGAGTCAGAATCACTGTCGGAATC	TGAATCACTGTCGGAATCAGAATCACTGTCAGAATCCGAGTCGCTATCTGAATCAGAATCACTATCCGAATCGCTG
TCAGAGTCCGAATCACTATCAGAATC	AGAATCGCTGTCAGAGTCCGAGTCGCTGTCGGAGTCGGAATCGCTG
TCAGAATCCGAGTCGCTATCAGAATC	CGAGTCGCTATCAGAATCTGAGTCACTATCCGAATCCGAATCGCTGTCTGAGTCAGAATCGCTATCCGAATCTGAGTCGCTG
TCAGAATCCGAGTCGCTGTCAGAATC	CGAGTCACTATCGGAGTCGGAATCGCTGTCGGAGTCAGAATCACTGTCAGAGTCACTATCAGAATCCGAATCACTATCAGAATCTGAATCACTG
TCGGAGTCCGAGTCGCTGTCAGAATC	AGAATCGCTATCGGAATCCGAGTCAGAATCGCTGTCGGAGTCGGAATCGCTGTCGGAGTCGGAATCGCTGTCGGAA
TCCGAGTCAGAGTCGCTATCAGAATC	CGAGTCACTATCGGAATCGCTGTCAGAGTCAGAATCGCTGTCAGAATCTGAGTCACTGTCAGAA
TCCGAATCACTGTCAGAATCCGAATC	ACTGTCAGAATCCGAATCACTGTCAGAATCCGAATCACTATCAGAATCTGAATCACTGTCGGAA
TCCGAGTCACTGTCAGAATCCGAGTC	GCTGTCAGAATCCGAGTCGCTGTCAGAATCCGAGTCAGAATCGCTGTCGGCA
TCAGAATCACTGTCAGAATCTGAATC	GCTATCCGAGTCAGAGTCGCTGTCCGAG
TCTGAGTCACTGTCAGAATCCGAGTC	GCTATCTGCATCCGAGTCGCTATCGGAATCAGAATCAGAA
TCCGAATCGCTGTCCGAGTCAGAGTC	GCTATCGGAGTCGCTATCTGCA
TCCGAGTCACTGTCGGAATCTGAGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027848.1\|WP_095116284.1\|184559_185495_+\|methionyl-tRNA-formyltransferase	unknown	unknown	gnl\|CDD\|234567
NZ_CP027848.1\|WP_095116275.1\|167583_169290_-\|fibronectin-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|336217
NZ_CP027848.1\|WP_095116277.1\|170199_170409_+\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|224672
NZ_CP027848.1\|WP_095116281.1\|171733_174142_+\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|224119
NZ_CP027848.1\|WP_095116268.1\|164807_165416_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234771
NZ_CP027848.1\|WP_095116287.1\|186797_187892_+\|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN	unknown	unknown	gnl\|CDD\|237717
NZ_CP027848.1\|WP_095116298.1\|192872_193529_+\|ribulose-phosphate-3-epimerase	unknown	unknown	gnl\|CDD\|235515
NZ_CP027848.1\|WP_095116300.1\|193528_194173_+\|thiamine-diphosphokinase	unknown	unknown	gnl\|CDD\|153431
NZ_CP027848.1\|WP_095116290.1\|187898_188642_+\|Stp1/IreP-family-PP2C-type-Ser/Thr-phosphatase	unknown	unknown	gnl\|CDD\|223704
NZ_CP027848.1\|WP_095116269.1\|165528_165969_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP027848.1\|WP_095116296.1\|191997_192873_+\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234631
NZ_CP027848.1\|WP_095116291.1\|188638_190711_+\|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP027848.1\|WP_157728679.1\|190776_191694_-\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379142
NZ_CP027848.1\|WP_095116276.1\|169576_170200_+\|guanylate-kinase	unknown	unknown	gnl\|CDD\|234719
NZ_CP027848.1\|WP_095116267.1\|164115_164814_+\|orotidine-5'-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|234695
NZ_CP027848.1\|WP_095116282.1\|184078_184567_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|184757
NZ_CP027848.1\|WP_095116279.1\|170531_171737_+\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	unknown	unknown	gnl\|CDD\|235513
NZ_CP027848.1\|WP_095116285.1\|185491_186796_+\|16S-rRNA-(cytosine(967)-C(5))-methyltransferase-RsmB	unknown	unknown	gnl\|CDD\|237857
NZ_CP027848.1\|WP_095116273.1\|166982_167396_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|369157
NZ_CP027848.1\|WP_095116271.1\|165965_166790_+\|N-acyl-homoserine-lactonase-family-protein	unknown	unknown	gnl\|CDD\|293815

Protein	Function_ID	Function_description	E-value
NZ_CP027848.1\|WP_095116284.1\|184559_185495_+\|methionyl-tRNA-formyltransferase	gnl\|CDD\|234567	PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed.	4.53699e-151
NZ_CP027848.1\|WP_095116275.1\|167583_169290_-\|fibronectin-binding-domain-containing-protein	gnl\|CDD\|336217	pfam05833, FbpA, Fibronectin-binding protein A N-terminus (FbpA). This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein. Fibronectin binding is considered to be an important virulence factor in streptococcal infections. Fibronectin is a dimeric glycoprotein that is present in a soluble form in plasma and extracellular fluids; it is also present in a fibrillar form on cell surfaces. Both the soluble and cellular forms of fibronectin may be incorporated into the extracellular tissue matrix. While fibronectin has critical roles in eukaryotic cellular processes, such as adhesion, migration and differentiation, it is also a substrate for the attachment of bacteria. The binding of pathogenic Streptococcus pyogenes and Staphylococcus aureus to epithelial cells via fibronectin facilitates their internalisation and systemic spread within the host.	1.74624e-169
NZ_CP027848.1\|WP_095116277.1\|170199_170409_+\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|224672	COG1758, RpoZ, DNA-directed RNA polymerase, subunit K/omega [Transcription].	1.39459e-14
NZ_CP027848.1\|WP_095116281.1\|171733_174142_+\|primosomal-protein-N'	gnl\|CDD\|224119	COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair].	0
NZ_CP027848.1\|WP_095116268.1\|164807_165416_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|234771	PRK00455, pyrE, orotate phosphoribosyltransferase; Validated.	1.3911e-76
NZ_CP027848.1\|WP_095116287.1\|186797_187892_+\|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN	gnl\|CDD\|237717	PRK14455, PRK14455, ribosomal RNA large subunit methyltransferase N; Provisional.	0
NZ_CP027848.1\|WP_095116298.1\|192872_193529_+\|ribulose-phosphate-3-epimerase	gnl\|CDD\|235515	PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated.	1.19884e-117
NZ_CP027848.1\|WP_095116300.1\|193528_194173_+\|thiamine-diphosphokinase	gnl\|CDD\|153431	cd07995, TPK, Thiamine pyrophosphokinase. Thiamine pyrophosphokinase (TPK, EC:2.7.6.2, also spelled thiamin pyrophosphokinase) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamine) to form the coenzyme thiamine pyrophosphate (TPP). TPP is required for central metabolic functions, and thiamine deficiency is associated with potentially fatal human diseases. The structure of thiamine pyrophosphokinase suggests that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis.	4.7428e-64
NZ_CP027848.1\|WP_095116290.1\|187898_188642_+\|Stp1/IreP-family-PP2C-type-Ser/Thr-phosphatase	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	1.44393e-73
NZ_CP027848.1\|WP_095116269.1\|165528_165969_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.41645e-14
NZ_CP027848.1\|WP_095116296.1\|191997_192873_+\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234631	PRK00098, PRK00098, GTPase RsgA; Reviewed.	1.03718e-128
NZ_CP027848.1\|WP_095116291.1\|188638_190711_+\|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.63664e-120
NZ_CP027848.1\|WP_157728679.1\|190776_191694_-\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	2.22637e-10
NZ_CP027848.1\|WP_095116276.1\|169576_170200_+\|guanylate-kinase	gnl\|CDD\|234719	PRK00300, gmk, guanylate kinase; Provisional.	5.33334e-115
NZ_CP027848.1\|WP_095116267.1\|164115_164814_+\|orotidine-5'-phosphate-decarboxylase	gnl\|CDD\|234695	PRK00230, PRK00230, orotidine-5'-phosphate decarboxylase.	2.00214e-129
NZ_CP027848.1\|WP_095116282.1\|184078_184567_+\|peptide-deformylase	gnl\|CDD\|184757	PRK14595, PRK14595, peptide deformylase; Provisional.	1.32327e-69
NZ_CP027848.1\|WP_095116279.1\|170531_171737_+\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	gnl\|CDD\|235513	PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated.	0
NZ_CP027848.1\|WP_095116285.1\|185491_186796_+\|16S-rRNA-(cytosine(967)-C(5))-methyltransferase-RsmB	gnl\|CDD\|237857	PRK14902, PRK14902, 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB.	0
NZ_CP027848.1\|WP_095116273.1\|166982_167396_-\|VOC-family-protein	gnl\|CDD\|369157	pfam06983, 3-dmu-9_3-mt, 3-demethylubiquinone-9 3-methyltransferase. This family represents a conserved region approximately 100 residues long within a number of bacterial and archaeal 3-demethylubiquinone-9 3-methyltransferases (EC:2.1.1.64). Note that some family members contain more than one copy of this region, and that many members are hypothetical proteins.	1.44912e-42
NZ_CP027848.1\|WP_095116271.1\|165965_166790_+\|N-acyl-homoserine-lactonase-family-protein	gnl\|CDD\|293815	cd07729, AHL_lactonase_MBL-fold, quorum-quenching N-acyl-homoserine lactonase, MBL-fold metallo-hydrolase domain. Acyl Homoserine Lactones (also known as AHLs) are signal molecules which coordinate gene expression in quorum sensing, in many Gram-negative bacteria. Quorum-quenching N-acyl-homoserine lactonase (also known as AHL lactonase, N-acyl-L-homoserine lactone hydrolase, EC 3.1.1.81) catalyzes the hydrolysis and opening of the homoserine lactone rings of AHLs, a reaction that can block quorum sensing. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	8.33755e-61

>NZ_CP027848.1|WP_095116281.1|171733_174142_+|primosomal-protein-N'
MIAQVIVDVAAKSVDRTFDYLIPDDLKDVVQPGVRVLVPFGPRKIQGYVMQIVSDEQSDIEIHRLKPIFEVKDIQPELTEELVKLSEWYSHYFVSKRISILEVMLPSAIKAKYTKAFSAKHPEQLPEYLRLRFNQDGLYPYKAAQNQEDVATLLTLMKQGIVEEVTLLSQHTTKKKQRAVRVIHPDMGDSILMDLEKKQKQYELLAFLLDEQHRSVLLRELKDMNFSTSAINTLERNGIIEKYDVVVERDPYEGRVFEQEHKRQLTEEQQEAFDQINRAAASHQAETFLLHGVTGSGKTEVYLQIIDQVLERQQEAMMLVPEIALTPQMVQRFKSRFGDEVAVLHSGLSHGERYDEWQKIRDGRARVSVGARSSVFAPFKNLGVIIIDEEHEATYKQEDYPRYHAREIAEWRSRYHHCPLVLGSATPSLESYARATRKVYTLLSMPTRVNNQQLPEVKIRDMRDELANGNRSIFSEDLAVAIEDRLQKQEQVVLFLNRRGYASFMLCRDCGHVPQCPNCDISMTYHKTTHELKCHYCGYHEPAPFQCPSCGSEHIQQMGTGTQRVEELIQERFPSARIIRMDVDTTSKKGSHEKLLKAFGDGKGDILLGTQMIAKGLDFPNITLVGVLNADTMLNLPDFRSSERTYQLLTQVAGRAGRHEKTGEVIIQTYNPDHYAVQDVQANNYLAFYEKEMQFRQLAKYPPYFFLINFTVTHEKMKVALQAATHVHQTLLQHVTEKAFILGPAPAALSRINNEYRFQILLKYKHEPGLIDALRYLDDYYHERYEQEKLALRIDIGPYMMM
>NZ_CP027848.1|WP_095116279.1|170531_171737_+|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC
MKNILLAVTGGIAAYKAIDLTSKLTQAGYDVRVMLTTHAQQFVTPLSFQAISRNAVYTDTFIEQNPAEIQHITLGDWADAVIIAPATANTISKLSHGIADDMVTTTLLATTAPKLIAPAMNVHMYENPRIQENMAILKKDGYQFLEPGEGFLACGYVAKGRMAEPLDIIASLKQLQTENQATTVQTYFTGKKVLITAGTTIEEIDPVRYVSNRASGKMGYALATALVNQGANVTLVSGPTHLDVPEGVTFVSINSAEDMFEAVVSRYDEQDFVFKTAAVSDYTPVTKLEHKVKKKEGNLTVEFKRTKDILKYLGEHKTHQKLIGFAAETRDVEHYAQEKLARKNADVIIANNVGDRTIGFNSDQNEVTMYFKGGDVQPIEKGPKTELAYKILNALESRWHE
>NZ_CP027848.1|WP_095116277.1|170199_170409_+|DNA-directed-RNA-polymerase-subunit-omega
MLYPPLHHLQDKVNSKYLIATTAAKRAREIQENPEGLLLDDYTSKKTVGRALEEMASSKVKPNVDLKDY
>NZ_CP027848.1|WP_095116276.1|169576_170200_+|guanylate-kinase
MDTEKGLLIVLSGPSGVGKGTVRKRIFDDPHTSYKYSISMTTRDMREGEQDGVDYFFKSRNEFEQLIEQDAFIEYAEYVGNYYGTPVQYVKDTMNEGHDVFLEIEVEGAKQVRKKFPDALFIFLAPPSLDHLKERLIGRGTESSEKIQRRVDEARKEVEMMNLYDYVVVNDEVDLAKDRIQSIVEAEHLKRERIEAKYRKMLLEAKK
>NZ_CP027848.1|WP_095116275.1|167583_169290_-|fibronectin-binding-domain-containing-protein
MAFDGLFTRKMVADLQSLVSGRIHKINQPENDTILMIVRQNRKNHQLLLSIHPNFARIHLTTKKYDNPFEPPMFARVFRKHLEGGIIRAIRQIDNDRRVEIDVESKDEIGDTIHRTVILEIMGKHSNLILVNEAYKIIEGFKHLTPNTNQYRTVMPGFQYEAPPAQNKHNPFEYRGQDILQFIDFNAGRIDRQLLQSFEGFSPLITKEIVSRRHFMTAHTLPEAFDEVMAEIDMPDTPVFHKNHDTGKEDFYFMALSQFDDDVVHYESLHELLDRFYDARGERARVKQRANDLVKLVQQLLQKYQNKYSKLLEEQQGTQEKELQQLYGELITANIYQLKQGDKTLDALNYYTGEQVTIPLNPTKSPAENAQYYYKQYNRMKTRERELTHQLLLTEENIQYFENIEQQLAHITVDDIDDIREELAEQGFIRQRKQHKKKKTSAIKLQTYQSTDGDTILVGKNNKQNDYLTNKRAQKSHFWFHTKDFPGSHVVILNDAPSDQTIDEAAMIAAYFSKAGQSGQIPVDFTQIKHVHKPSGAKPGFVTYDHQQTRYATPDYDKIQALKHTESN
>NZ_CP027848.1|WP_095116273.1|166982_167396_-|VOC-family-protein
MQIPKITTFLMFNGNAEAAIKKYTSLFEDSEIVTMVKYDESVPEQAGKVQHAIFTLNNQVFMAIDNINGTPIEMTPATSLYVTVKDVFEMERLFNGLKDGGAILMPKTSMPPQYREFAWVQDKFGVNFQLALPEKQK
>NZ_CP027848.1|WP_095116271.1|165965_166790_+|N-acyl-homoserine-lactonase-family-protein
MTNDIKIHVLHTGEVIVDEALPFGYESNRPLAWTGLFRSKKHQISIPVSVYLIEHPKGLILIDTGWHTDNRTKQIRNLLFQYPVNKADLPEGQAVHEQLKRLGYEPKDIDYVLMSHMHCDHADGLRHVKDAKNILLSEPEFKAIKKDKMHYLSHEWKGVTLKSFPLSHTGLGPKGYSFDLFGDQTVQMIWCPGHSKGLCATMIKKEDEDKFVLLAADVGYANKSWEENILPGVLDNKEEARASLNWVKKKAADGNCIEALANHDANTKPHVITL
>NZ_CP027848.1|WP_095116269.1|165528_165969_+|MarR-family-transcriptional-regulator
MDQSTFEEFNNMHLTFIKVNQLINEVIEEQNIDISREQLGVFKLLLKHEQLPLKAIAEKQGVFKTAVSKRVKKLEEKGFVTRISSSDKREKVITLTDEGIRFYEERQRILYESFMKKLNLDKVQAAEFFSNMREVDQLLKQGEKNI
>NZ_CP027848.1|WP_095116268.1|164807_165416_+|orotate-phosphoribosyltransferase
MVKAIAQSLLDIEAVSLSPNDMFTWSSGIKSPIYCDNRVTLGFPEVREAIRDGLVELIEQYFPEVEIVSGTATAGIPHAAYVSEKMNLPMNYVRSKSKSHGKQNQIEGANSKGKKVVVIEDLISTGGSSITAVEALREAGAEVLGVVAIFTYGLQKADDMFGEAQVPFYTISNYDELIEVAEAQGKITSEDIDTLVSWRNQL
>NZ_CP027848.1|WP_095116267.1|164115_164814_+|orotidine-5'-phosphate-decarboxylase
MKQTPIIALDFATKEEVMTFLAKFDTPLFVKVGMELFYQTGPALLEEIKEQGHDIFLDLKLHDIPNTVGKTMEGLGRLNVDLVNVHAAGGSVMMQRAVEGLRRTNPDTKIIAVTQLTSTTEQQLHDEQQIDMSMEEAVCHYAKLAQDSGLDGVVCSPLEAAPITAHCGAEFLKVTPGVRPANAAVNDQKRVTTPEQAKALGSTHIVVGRPITQSDDPVASYQQITESWVGKW
>NZ_CP027848.1|WP_095116282.1|184078_184567_+|peptide-deformylase
MAIKKILNYRTSNLRQKTLPVTTFNEKLTTLIENLEDTMYEMDSQAIAAPQIGVNQQVALIDMGQDGLLQLINPEIISSSSETAIELEGCMSVPGRYGEVERSRMIVVKSYDLHGNEVELTAYDDIARMILHEIDTLNGILFIDKMKKEVTEAELEAYLEDE
>NZ_CP027848.1|WP_095116284.1|184559_185495_+|methionyl-tRNA-formyltransferase
MSKIIFMGTPDFSTKILEMLIETEEVIAVVTQPDRPVGRKRTLTPPPVKKVAVAHNIPVLQPEKLTGSEELETLLNMPCDLIVTAAFGQLLPESLLSHPTYGAVNVHASLLPKYRGGAPIHQSIIDGEAETGVTIMYMVKQLDAGDIISQRAIPIEETDNVGSMHDKLSDLGTVLLQETLPSILDGTNARTLQESDKATFASNIQREDERIDWTKDARAVFNHIRGLSPWPVAYTKLDDKVMKLYDAHIVTGKQGEPGQIIETTKKQIIVGTGSEDAIALTEIQLAGKKRMPVANFLSGYHETLVGKELHS
>NZ_CP027848.1|WP_095116285.1|185491_186796_+|16S-rRNA-(cytosine(967)-C(5))-methyltransferase-RsmB
MTTVRELSYQTLEAVLKDGAYSNLKMNEVLQEHPLSPADRGLYTALVYGTLKRKLTLDFYLKPYVKTKIKGWVRRLLWMSLYQFVYMDKIPTHAIINEAVEIAKQRGGKQTGNTVNAILRQATTQPLRSIDSIKNKEEQLSIRYSLPTWIIRHWKTHFGLEKTEEIAAQMLLPAVQTVRVNRTKLTPDEAVAQLIEEGYRVQQDNDIAHCLIVEGTGVMQSQLFREGKISIQDKSSMFVAEMIDLQHGQRVLDCCSAPGGKSCHMAEILDGTGEILATDIHDHKIGLIQHNIDKLGLSGIQARQHDATAPYEGTFDRILVDAPCSGLGVLRHKPEIRYTMNQETVDQLVKIQLQILNNVAQNLKIGGELIYSTCTIEQMENENVIYTFLKAHPEFEFVTLQDPRTKEQVKTLQLLPQDFDADGFFITKIRRKDQ
>NZ_CP027848.1|WP_095116287.1|186797_187892_+|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN
MITAEKKKKNKFLPDFEKQSIYSVRFDEMKDWLKTHGQQSFRAKQIFEWLYDKRVNQFDEMTNLSKDLRQLLEDNFTMTTLETVVRQESRDGTIKFLFELQDGYTIETVLMRHEYGNSVCVTTQVGCRIGCTFCASTLGGLKRNLEAGEIVSQVLTVQKALDETDERVSSIVIMGIGEPFENYDEMMDFLKIINDDNGLNIGARHITVSTSGIIPRIYDFADESLQINFAISLHAANNDIRSQLMPINRAYDVNKLIEAIEYYQEKTNRRITFEYGLFGGVNDQLTHARELAALIKHLNCHVNLIPVNHVPERNYVKTPKEDIFKFEKELKRLGINATIRREQGADIDAACGQLRAKEREAETR
>NZ_CP027848.1|WP_095116290.1|187898_188642_+|Stp1/IreP-family-PP2C-type-Ser/Thr-phosphatase
MLNAELYSITGDYRDQNEDAAGVFYNQTDQQLLVMCDGMGGHLAGEVASQFVVEALQTRFERENFIEQNQAEAWLKETLQAVNLELYALAQENDAYTGMGTTCVCALVYDHHIIVANIGDSRAYLVNSRTCDQVTMDHTFVNQLVMLGQITEEEAFNHPKRHLITKVMGTDKLVSPDVYTRRTQFYQYLLLNTDGLTDYVTKQEIQELLVEPKTLRELGDDLLARAEVRAAKDNVSFILAEIAGDPV
>NZ_CP027848.1|WP_095116291.1|188638_190711_+|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase
MIGRIIDERYEIQDVLGGGGMSKVYGAMDTILNRKVAVKMIQVPASERQATIDRFEREVQNTTQLSHPNIVSVLDVGEEDDCFYLVMEFIEGTTLSEYIKTHGPIAPEKAIGYIEQVMQGIQHAHEQGIVHRDIKPQNIMIDPNDTLKIVDFGIAKALSESTMTQTNHVIGTVQYLSPEQAKGEKTGERTDIYSIGIVLYEMLTGAAPFHGETAVSIAIKQIQEPVPNVTEHHPDIPQALSNVILRATEKEPVNRYVTVSEMAHDVATVLDDSRADEQMYQADESITKTVAVDKNALKQQQEPVTSNETASIPIVQTEQNTTRSTPPPRTHRAAMASAYTGKPKRSRKKKVIAGLILLLLFVSLFFFVTAAMMGNKYSQVPNVLGQTEERATEMLAEKNLKVGNVSQTYNDQYEEGQIASISPKEGEKVKQDSTVDLVISKGEHREKMPDLVGKSREEAEKVLGELGFEKVHYTTAYTQNDIPKGHIEAQNVSPGTEVSVKKEMIEITESLGKRQVYVNDYTYKDIALATSDLESEGLKVTVIERREDNKVKENHIIKQSPKNKEVDEGSEVKFIVSKGASEADKLKNKPKDDDKDKDDEEDSSDNKQAYDKTYTQSLTIPYTGKDKKPQKVEVYIKDKNNDGKKPRTFQIKNNTSQVLNFTIEDGGSASYRVVVDGKEVESNEIKYDDF
>NZ_CP027848.1|WP_157728679.1|190776_191694_-|trypsin-like-peptidase-domain-containing-protein
MKKQPFLIFIGLLFICFIVAFTIINRPQSSNVQVHPTNDPDDAYVTNNAIKKQSGSGKAFQLAQRIDDDDVSIKTVQSPIPKPYQSIGRLINHKRDIAGTAVAIDDHTLLTNNHVVEESKTRPGKRNYRPAKPQFLRFKPMQTPTQTPYTFTVRSVHMIKGVDLAVVHTHENLSDVMTPMPIASEHSIESMSFKDRIKIVGYPDPKYFESRYPSLAKIPSHQMFITQGYYLNKATTKEPQIYFNAVTRKGNSGSPMMNVNNELIGIFPNGFNNSGRSTFKYNEEEMGYGVVMTKHVRKEINNISY
>NZ_CP027848.1|WP_095116296.1|191997_192873_+|ribosome-small-subunit-dependent-GTPase-A
MKTGQIIKSISGVYRVDVDGEQFDAKPRGLFRKKQITPVVGDIVDIDFETHASGYIQHVHERKNELKRPPVSNIDILVVVMSAVEPDFSTQLLDRFLVIAHSYGLSPRIVITKKDLATDAQRAEIERLLAIYQHIGYDTQFIGKDDDVQAVFDAWESGIAVLSGQSGVGKSTLLNSYRPELALETNSISQSLNRGRHTTRHVELYPRANGYIADTPGFSALDFDHIEKYELDGYFIEISEASEYCKFRDCSHTNEPKCHVKALVESGEIADFRYQHYEQLLQEISNRKVRY
>NZ_CP027848.1|WP_095116298.1|192872_193529_+|ribulose-phosphate-3-epimerase
MTKVFPSLLSADFLKLQDELHALEKAGVDGVHFDVMDGQFVPNISIGFPILEAVRRGTSLPIDVHLMIDNPEAYIDDFCEKGADKVSIHVEATPHIHRAIQKIHAHGKEAGIVLNPGTSIEAIRPIIGDVDFVLIMSVNPGFGGQAFISSSLDKIRELKILREKLGLSFRIEVDGGVNAETAQQVVEAGADWLVAGSYFFNQEQYAQAVVTLKGEASS
>NZ_CP027848.1|WP_095116300.1|193528_194173_+|thiamine-diphosphokinase
MSKRIHLLCSDRYLPEGLFETLKDAEWGGVDRGTKILLEQGIQPTFTVGDFDSVTDAERAWISEHIAISPVPAEKADTDLGLAVAEAVAHGYKEIAIYGATGGRLDHFMGAMQLLKAPSYQACRIELIDIQNEITLLSKGCYDIQCKSQFPYISFVPANEQVTLSLKGFKYDLDEETLEIGTTLTISNEFHHEHAQINVHEGLVYQIRSRDMTE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP027848_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027848_2

688638-689068

Orphan

Consensus_repeat	Method
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	CRISPRCasFinder
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	CRT

6 spacers

The CRISPR arrays of NZ_CP027848_2

>merge|NZ_CP027848|2|688638-689068|CRISPRCasFinder,CRT
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAACAAAAAAATTAAAAGATTACTAGACAGTGATGTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAACCATTAACAGTTTGTCGTGAATTAACACTTAGTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAACTTTACGCCGCCACGCCCTTACGCTAAGTTGTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAACAAAAAGAAAAAAACCGCTTGGGAAAGACGAGTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAACTCACGCACTCTTGCCCCATATAGTTTTGCAGTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAACTTCCATTTTTGGGGCGAAGCCGGGGGTGCAGTTTTAGTACTCTGTAATTCCGGGTGTAAATTAGCC

>NZ_CP027848|2|1|688638-689068|CRISPRCasFinder
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	AAAAAAATTAAAAGATTACTAGACAGTGAT
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	CATTAACAGTTTGTCGTGAATTAACACTTA
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	TTTACGCCGCCACGCCCTTACGCTAAGTT
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	AAAAAGAAAAAAACCGCTTGGGAAAGACGA
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	TCACGCACTCTTGCCCCATATAGTTTTGCA
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	TTCCATTTTTGGGGCGAAGCCGGGGGTGCA
GTTTTAGTACTCTGTAATTCCGGGTGTAAATTAGCC

>NZ_CP027848|2|2|688638-689068|CRT
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	AAAAAAATTAAAAGATTACTAGACAGTGAT
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	CATTAACAGTTTGTCGTGAATTAACACTTA
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	TTTACGCCGCCACGCCCTTACGCTAAGTT
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	AAAAAGAAAAAAACCGCTTGGGAAAGACGA
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	TCACGCACTCTTGCCCCATATAGTTTTGCA
GTTTTAGTACTCTGTAATTTTAGGTATAAGTGAAAC	TTCCATTTTTGGGGCGAAGCCGGGGGTGCA
GTTTTAGTACTCTGTAATTCCGGGTGTAAATTAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027848.1\|WP_106904253.1\|699136_699535_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|168472
NZ_CP027848.1\|WP_095117185.1\|694480_695293_-\|HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|319792
NZ_CP027848.1\|WP_095117177.1\|687194_688406_+\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP027848.1\|WP_095117159.1\|678355_678817_+\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|224867
NZ_CP027848.1\|WP_095117165.1\|680899_681643_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176506
NZ_CP027848.1\|WP_095117163.1\|679804_680761_+\|ornithine-cyclodeaminase	unknown	unknown	gnl\|CDD\|236313
NZ_CP027848.1\|WP_095117173.1\|685159_686284_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223620
NZ_CP027848.1\|WP_095117161.1\|679034_679637_+\|30S-ribosomal-protein-S4	unknown	unknown	gnl\|CDD\|235411
NZ_CP027848.1\|WP_095117189.1\|698618_699068_+\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|226218
NZ_CP027848.1\|WP_095117167.1\|681715_682168_+\|SACOL1771-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|132602
NZ_CP027848.1\|WP_095117195.1\|701917_702907_-\|catabolite-control-protein-A	unknown	unknown	gnl\|CDD\|130546
NZ_CP027848.1\|WP_095117181.1\|690946_691840_+\|transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|376415
NZ_CP027848.1\|WP_095117169.1\|682349_683510_+\|alanine--glyoxylate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223153
NZ_CP027848.1\|WP_157728717.1\|698293_698380_-\|type-I-toxin-antitoxin-system-Fst-family-toxin	unknown	unknown	unknown
NZ_CP027848.1\|WP_095117193.1\|700002_701670_-\|formate--tetrahydrofolate-ligase	unknown	unknown	gnl\|CDD\|237403
NZ_CP027848.1\|WP_095117187.1\|695277_696528_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NZ_CP027848.1\|WP_095117175.1\|686422_687040_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP027848.1\|WP_095117171.1\|683499_685107_+\|phosphoglycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|237436
NZ_CP027848.1\|WP_095117179.1\|689330_690593_-\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NZ_CP027848.1\|WP_095118139.1\|697564_698119_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737

Protein	Function_ID	Function_description	E-value
NZ_CP027848.1\|WP_106904253.1\|699136_699535_-\|hypothetical-protein	gnl\|CDD\|168472	PRK06217, PRK06217, hypothetical protein; Validated.	1.19291e-12
NZ_CP027848.1\|WP_095117185.1\|694480_695293_-\|HAD-IIB-family-hydrolase	gnl\|CDD\|319792	cd02605, HAD_SPP, sucrose-phosphatase, similar to Synechocystis sp PCC 6803 SPP. Sucrose-phosphatase (SPP; EC 3.1.3.24) catalyzes the dephosphorylation of sucrose-6(F)-phosphate (Suc6P)-the final step in the pathway of sucrose biosynthesis in plants and cyanobacteria. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.03269e-83
NZ_CP027848.1\|WP_095117177.1\|687194_688406_+\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	3.43834e-87
NZ_CP027848.1\|WP_095117159.1\|678355_678817_+\|GAF-domain-containing-protein	gnl\|CDD\|224867	COG1956, COG1956, GAF domain-containing protein [Signal transduction mechanisms].	1.62324e-81
NZ_CP027848.1\|WP_095117165.1\|680899_681643_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176506	cd08563, GDPD_TtGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase (TtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Despite the fact that most of GDPD family members exist as the monomer, TtGDE can function as a dimeric unit. Its catalytic mechanism is based on the general base-acid catalysis, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). A divalent metal cation is required for the enzyme activity of TtGDE.	7.23999e-60
NZ_CP027848.1\|WP_095117163.1\|679804_680761_+\|ornithine-cyclodeaminase	gnl\|CDD\|236313	PRK08618, PRK08618, ornithine cyclodeaminase family protein.	2.48447e-81
NZ_CP027848.1\|WP_095117173.1\|685159_686284_-\|HAD-family-hydrolase	gnl\|CDD\|223620	COG0546, Gph, Predicted phosphatases [General function prediction only].	1.31917e-15
NZ_CP027848.1\|WP_095117161.1\|679034_679637_+\|30S-ribosomal-protein-S4	gnl\|CDD\|235411	PRK05327, rpsD, 30S ribosomal protein S4; Validated.	2.20402e-125
NZ_CP027848.1\|WP_095117189.1\|698618_699068_+\|ABC-2-family-transporter-protein	gnl\|CDD\|226218	COG3694, COG3694, ABC-type uncharacterized transport system, permease component [General function prediction only].	2.33245e-18
NZ_CP027848.1\|WP_095117167.1\|681715_682168_+\|SACOL1771-family-peroxiredoxin	gnl\|CDD\|132602	TIGR03563, perox_SACOL1771, peroxiredoxin, SACOL1771 subfamily. This protein family belongs to the OsmC/Ohr family (pfam02566, OsmC-like protein) of peroxiredoxins.	4.4212e-51
NZ_CP027848.1\|WP_095117195.1\|701917_702907_-\|catabolite-control-protein-A	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	5.51332e-176
NZ_CP027848.1\|WP_095117181.1\|690946_691840_+\|transglycosylase-domain-containing-protein	gnl\|CDD\|376415	pfam00912, Transgly, Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.	1.60894e-64
NZ_CP027848.1\|WP_095117169.1\|682349_683510_+\|alanine--glyoxylate-aminotransferase-family-protein	gnl\|CDD\|223153	COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism].	1.24743e-136
NZ_CP027848.1\|WP_095117193.1\|700002_701670_-\|formate--tetrahydrofolate-ligase	gnl\|CDD\|237403	PRK13505, PRK13505, formate--tetrahydrofolate ligase; Provisional.	0
NZ_CP027848.1\|WP_095117187.1\|695277_696528_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.87658e-128
NZ_CP027848.1\|WP_095117175.1\|686422_687040_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	1.74744e-36
NZ_CP027848.1\|WP_095117171.1\|683499_685107_+\|phosphoglycerate-dehydrogenase	gnl\|CDD\|237436	PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional.	0
NZ_CP027848.1\|WP_095117179.1\|689330_690593_-\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	0
NZ_CP027848.1\|WP_095118139.1\|697564_698119_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	4.50506e-58

>NZ_CP027848.1|WP_095117177.1|687194_688406_+|trypsin-like-peptidase-domain-containing-protein
MNSNDFNPTSQRQQNDTPPPSSKKSGWLRTIIIALIAGLIGGSIAFFAISGISNFTSSGNHSGANVNVAENEKGGNVLDQKSKSYPSINAMIKDKSPSIVGVVNEQKAENIEDLLRGKSTDAQPSGIGSGVIYQRNKKEAFIVTNNHVIDGASSIKVQLHNSKQVNAELVGTDPLTDIAVLKIKNRNDIKAIDFADSSKVKTGDSVFAMGNPLGLEFANTVTSGIISASERTIDAETPAGTNKVTVLQTDAAINPGNSGGALVDVNGNLVGINSMKISAPHVEGIGFAIPSNEVKLVIEQLVKHGEVKRPSIGIGMINVTDIPASYQKQLHTDSGVYVAEVQRSQSGLKRGDIITKIDDQKVENDSDLRSYLYKNKQPGDSVKFTVIRNGQSENVNVTLVESQ
>NZ_CP027848.1|WP_095117175.1|686422_687040_-|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MLYKLIGTVLEFIVAKRLKNLEVLGKDNEPDNNEYLVTCNHESYNEIVLLGVALLPNQIHFMAKQELFENKLFGKFLSALNAFPVNRENPGPSTLKIPVKLLNSNKTVGIFPSGHRTTEEVPLKRGAATIAMLAKKPILPAAYVGPTKLIGMLTGKAYIKFGAPIDTTTFPEGMKRQEKVEYLTNLIGERTKQLQQELNEYVKTK
>NZ_CP027848.1|WP_095117173.1|685159_686284_-|HAD-family-hydrolase
MTKAVLFDVDGVFLDESRCFDVSALTVYELLYDKAYLNLKDGIALDALTESEIMTIRNELFENDLILHRLKSLGINSNWDMLFIVFSVHLIDLLKSLPHTEKLSFLDEAAFSETSIKTLQSHIKSSHIDYALPLDFLNHLTEGKEQIYEGLKAYATNVLKTDKVALFDINSPLWQLAQELYQEWYLGTKLYEEVEKKKAKTNYKKGYIYDEVVLAPIDGIRSLLQDLKEAGYLIAIATGRTRVETLIPFEALGLLSYFDDSHIVTASEVIQAEKQYPELKPLGKPNPFSYVATYDGNDTSKYHDYATNQVNRLNHYEVTIVGDSLADLLSAQKVNARFIGTLTGLKGTEAAEELDAKGADELVNHVLEVRQYLL
>NZ_CP027848.1|WP_095117171.1|683499_685107_+|phosphoglycerate-dehydrogenase
MNYKVLVADPISDDGLHQLHADGAFEVVHKTGLTENELIAFIPDYDALIVRSQTQVTATVLKSADRLKVVARAGVGVDNIDIDTATKEGIIVINAPDGNTISATEHSVAMLLSMARNIPQAHASLKRGEWDRKTFRGTELYQKTLGVIGTGRIGIGVAKRMQSFGMNILAFDPYLTEAQANELGFTRATVEEIAQAADFITVHTPLTEKTRGLINADFFNLAKPNLRVINVARGGIIDEQALIEALDNNKIAGAALDVFENEPAVNTPVTQHPKIIVTPHLGASTIEAQEKVAVSVAGEIIDILKYQNVKHAVNAPKVIFDHSEEIQPFVDLAQLTGALAIQLLPKAPRKMHITYGGDLALDDTSLLTRTLAQGVLQEDMGDHVNLINTLMLLNEQNVSYTIEKTKGIQGFSNYIEVELINKDQRAKIGMTVLNGFGPRIVRINDYAVDFKPEHYQLIIQHTDQPGMIGQTGQILGEHDVNITSMYVGRKQVGGHAMMILSIDHPIDEAVHDALLNIPGLESVQLVTLKDESLIN
>NZ_CP027848.1|WP_095117169.1|682349_683510_+|alanine--glyoxylate-aminotransferase-family-protein
MYTHHSLLLTPGPTPVPNKIQHAMNLPMVGHRSSDFEAIAKLAFSGLKRVFGASHDVIILTSSGTSALEASMRNLINPDDHIVVIVSGAFGARFQQIAEAYSHHLHVFNVEWGESFNTEDVLTFIQSIDHPITAVFTQYCETSTSVLHPVAELGHSLKQFNPDIYYIVDGVSCIGAVDVDMERDQIDVLVAGSQKAMMLPPGLAFVAYNDRARTRFSQTNSPSFYLNLSKHLSSLEASTTPYTPNVPAFRGVVQYSQMIKEEGFQHVVKRHNVIRDALRKALKSLSLDLLVNDDAASPTVTAFVPKDHDELVYIKEQLAKTFNITIAGGQGKLKGHILRVGHMGFISPNDLLPFVSSLEMILSTYRNENYIGKGTKAFLEGIYHEL
>NZ_CP027848.1|WP_095117167.1|681715_682168_+|SACOL1771-family-peroxiredoxin
MIQHTFTTTVSWQGGRNEVGHLNGDILEHDVSIPSSLGGTGKGTNPDELLVAAASSCMTISLAAALERAHLTPTKIEMQSDGHAVFDQQQFQMKKITHYPKIFLSNEQDIKKLERRITHLINIADKNCMVSNSLKGNVQIDVIPQIVHCS
>NZ_CP027848.1|WP_095117165.1|680899_681643_-|glycerophosphodiester-phosphodiesterase
MKLLRPNKSFQVIAHRGLSQRYPENTKLAYQAALSQHIDMLEIDLHMTKDGMLVGIHDESIDRTSNGKGAIKDFTLEDLRVFNFNAQMKGDIDAPIMTFDEILTLCKNYSKTLLIEVKKPSKYPNIGALMIQKIIHHDFPINRIIIQSFDQSFIKEIQHQVPYIHYGVLISKRKYWLKQPDFCDIAEYADYVNPNYQLVNKKFVKRAHDANLKVLPYTVNDAQTAKKLIQLGIDGVISDIPDEIFKL
>NZ_CP027848.1|WP_095117163.1|679804_680761_+|ornithine-cyclodeaminase
MKVFTEKEVMMTYHMSDAIQDIENLFQNMDDVSQTSRVVIPTGEGAKSMLYMPCIHFGKQQGIIKITSITPENPQHNRPTTQANIVITDLKTGEHVASMDGSYLTRLRTGALSGIATKYMSRPDSKTLGMIGTGGMAYEQLLGNLEVRPIEKVLLYNRTSEKAHAFKARIADKHPSIEFEVVSTVTELVRQSDIINCQTQSTSPVFNANDIQSGTHINGIGSYRPEMKEMDNRLFPTASQIVFDDLEGVKEEAGEFIEADKQGLFSFDHHDDDLKGVSLNGKIQRNNEDITIFKCVGAAHFDLAVALGTWEKFNKNHN
>NZ_CP027848.1|WP_095117161.1|679034_679637_+|30S-ribosomal-protein-S4
MARFRGSSWKKSRRLGISLSGTGKELDKRPYAPGQHGPTQRKKLSEYGLQLREKQKLRYLYGMTERQFRNTFNIAGKQGGVHGENFMVLLASRLDAVVYSLGLARTRRQARQLVNHGHILVDGKRVDIPSYSLKPGQEIAVREKSQKLAIIAESVEISNFVPDYLEFDADNLKGTFVRLPERSELPAEINEQLIVEYYSR
>NZ_CP027848.1|WP_095117159.1|678355_678817_+|GAF-domain-containing-protein
MSVKQTDYTLLARQLDALLDGETDLIANLSNASALLNENLDQINWVGFYLMKNDALILGPFQGKPACVHIEVGRGVCGTAVAENKIQRVADVNAFPGHIACDAASQSEIVVPIHKGDTVIGVLDIDAPITNRFSEADEEGLAKFVEVLEQHLA
>NZ_CP027848.1|WP_095117179.1|689330_690593_-|tyrosine--tRNA-ligase
MTNALIEDLKWRGLIYQQTDEAAIEELLNKEEVKIYCGADPTADSLHIGHLLPFLTLRRFQNAGHRPVVLVGGGTGMIGDPSGKSEERVLQTEEQVEQNVLGIQRQMEMLFDFDKENGPILVNNKDWLSQISLIEFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGYLNREYNCKMQIGGSDQWGNITTGIELMRRMYGTNDAYGFTIPLVTKADGKKFGKSESGAVWLDSEKTSPYEFYQFWINTSDDDVIKFLKYFTFLSKEEIAELETSVETEPHLRKAQQALAENVTALIHGQEALEEAQRISEALFKGDLKALSTKEIKAGFKDVPQVILSNKTTNIVEALVETKISSSKRQAREDVQNGAIYINGERETDLAYELSEADKYDNAFTIVRRGKKKYFMVNYQ
>NZ_CP027848.1|WP_095117181.1|690946_691840_+|transglycosylase-domain-containing-protein
MKEIYQTDNKLSHILKKFDLFCRFVKRLFFSFVALFLLVLFLLLGIAIGYFTSLVSESRALNDTSLIQQVTDLPEMEPITSPKTDMIALYDAPEPVLIAGPHEVSPFVTSALVAAEDDQFYIHNGILPKAVIRAIYQDIFQHQFATGGSTITQQLIKNQVLSNERTYDRKAKEIMYALRIEKLMTKDEILFTYLNRVPFGLDTNGQHITGITSASYGIFGKPPRSLNLAESAYLTGLLQSPYYYTPFDLKGNIRPDKELMPSINRQRYVLKRMRIEQMITDDEYQQALNYDIRSHLS
>NZ_CP027848.1|WP_095117185.1|694480_695293_-|HAD-IIB-family-hydrolase
MSGNLILFDFDETYYKHNTNQTDVYSLKEMEGLLQKISVNNNAITAILTGSTLDSVLEKMLKANMSYKPKHIFSDLSSKMYTWNNYEYVESDEYKNEVLTEPFLLEDILEILNHISSKHNVEFIPQREFYENETLYNFYLYSTGDTNLDKKILKDLTQYSKTRNYTMRFNRCNPLAGDPENAYDIDFTPKNAGKLYATKFLMRKYSIPRNSIIGFGDSGNDEEFLRYLDHAFIMSNSKDEEMKRKFKNTKYPYYKGIFKHVSEFVGGKND
>NZ_CP027848.1|WP_095117187.1|695277_696528_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MTLKSSSIFNFRNNIQELKKHTEIHANKYLSNEIDITRQNLSENRDIQKIEFMPVNSLIREDETEKIIKALKQLLPTGKYTSGKYIDEFEQYLSEYLSINHVIALSSGTAALTIGLLSLGVTAGDEVILPSNSFAATENAVVSIGATPVYADVKDDFTICPKSIENLITSKTKAILSVHLYGRFCDMLKIKKIALEHDIRVIEDACQGIGLEEVGMHSDLAALSFNPYKNLGVCGKAGAIITNNAELDYKCRLISYHGFNLKEKNKKIIDFGFNSKIDNTQALIGIVRMEYLTFNQYRRLKIAEKYNQKLSDMENIILPTFDDKSVGHLYPIRVKNNKRDFVKSELEKVGIQSEIYYPYLSHEQISYKKIISLPNTERMHKELLCLPLYPGLTKEEQEYVISKLRVVLEGLRCQEI
>NZ_CP027848.1|WP_095118139.1|697564_698119_+|recombinase-family-protein
MAIVGYARVSTQDQKLDSQIDALKEYGCTKIFSEKVSGKKFKRTELDKCLEYLREGDTLVIYKLDRLGRTTTQLIELSQWLEDNHIELQIINMNINTKDAMGKMFFTMMSAFAELEANLLSERTKKGLAAARARGRKGGRPSLPDYKKREINFLYDEQKLTGEEIAQQTGVSRSTVYRVINERK
>NZ_CP027848.1|WP_157728717.1|698293_698380_-|type-I-toxin-antitoxin-system-Fst-family-toxin
MLVQLTVTIVSGCVITLFSHWLSKRNKK
>NZ_CP027848.1|WP_095117189.1|698618_699068_+|ABC-2-family-transporter-protein
MAADNAWGPAALPAVFIYLISVSTINFTLFDYLLLIIMILSSTIIFFCLYIIYGGLCFFTLNKIEVFTILTQGSREFGKYPIDAYGELVLKFSTYIVPYALVQYYPFIHLMGRSDNFNYIFYPVFSFLFIIPTVIIWKIGVVNYNSSGS
>NZ_CP027848.1|WP_106904253.1|699136_699535_-|hypothetical-protein
MKLHIYGGPGSGKTTLGLEYSRRYKLKYLDLDSIFWDQRNGKYTKINSVEVRQYALKKFIENNENWVIEGVYIDWVYDSLSQADKILILNTNSLVRGIALLNVIFLERRIKAKSRDTKVPSAIAYMEFQISE
>NZ_CP027848.1|WP_095117193.1|700002_701670_-|formate--tetrahydrofolate-ligase
MSHLSDLEIANQATLKPIKEIADKAGIAEEALEQYGHYKAKIDISKIQTKGKKGKVVLVTAMSPTPAGEGKSTVTVGLADAFQHIDQNVMVALREPALGPTFGIKGGATGGGYAQVLPMEDINLHFNGDFHAITTANNALSAFIDNHIHQGNALGIDQRRIEWKRVLDMNDRALRQVVVGLGGPTQGVPREDGFNITVASEIMAILCLSTDIMDLKASIAKITIGYTRDRQPVTVKDLGVEGALAMILKDAIKPNLVQTMEGTPALIHGGPFANIAHGCNSIIATETARDLADIVVTEAGFGSDLGAEKFIDIKARKADFEPDAVVLVATIRALKMHGGIAKDNLKEENVEAVKAGIANLDRHVNNIRKFGVEPVIALNAFIHDTDAEFEAVQQWAKENNVHLSLTEVWEKGGAGGVDLAKKVLEVVEQPQTFKHLYELEQPLEEKIETIVKEIYGGSKVTFTSKAQKQLKQFKDNGWDHFPICMAKTQYSFSDDQTKLGAPSDFEITIRELEAKTGAGFIVALTGAIMTMPGLPKQPAALKMDVTEDGHAIGLF
>NZ_CP027848.1|WP_095117195.1|701917_702907_-|catabolite-control-protein-A
MTVTIYDVAREANVSMATVSRVVNGNQNVKPATRNKVNEVIQRLNYRPNAVARGLASKRTTTVGVIIPDISNIYYSELARGIEDIATMYKYHTIISNSDDDPKKEGEIFNNLLSKQVDGIIFLGGTITEEIQEQIKKASIPVVVSGTNGKEADVASVNIDFVKASEEVTERLLDSGAKKFAYIGGGYSKVAQEEVAKGLKNTLQKHGLSVDEHLVYVGNETYQDGLRAFEVIKDHQPDAVLSISDEQAIGVVHGALDNGLSVPEDIQVVSFNNTRLVEMVRPQLSSVIQPLYDIGAVGMRLLTKYMNKEEITEQNVTLPHTIRYRGTTK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP027848_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027848_3

756942-757109

Orphan

Consensus_repeat	Method
GTTTCACTTATACCTAAAATTACAGAGTACTAAAAC	CRISPRCasFinder
GTTTCACTTATACCTAAAATTACAGAGTACTAAAACA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP027848_3

>merge|NZ_CP027848|3|756942-757109|CRISPRCasFinder,PILER-CR
TAACGTATGGTAACAAAAATTACAGAGTACTAAAACAGAGAATACTCAAATAAATCAACCTTTTGTGTTTCACTTATACCTAAAATTACAGAGTACTAAAACAAAGGCTATGTAGGACTACTGACATCAAGAGTTTCACTTATACCTAAAATTACAGAGTACTAAAAC

>NZ_CP027848|3|2|756942-757109|CRISPRCasFinder
TAACGTATGGTAACAAAAATTACAGAGTACTAAAAC	AGAGAATACTCAAATAAATCAACCTTTTGT
GTTTCACTTATACCTAAAATTACAGAGTACTAAAAC	AAAGGCTATGTAGGACTACTGACATCAAGA
GTTTCACTTATACCTAAAATTACAGAGTACTAAAAC

>NZ_CP027848|3|1|756957-757109|PILER-CR
AAAATTACAGAGTACTAAAACAGAGAATACTCAAATAAAT	CAACCTTTTGTGTTTCACTTATACCTAAA
ATTACAGAGTACTAAAACAAAGGCTATGTAGGACTACTGA	CATCAAGAGTTTCACTTATACCTAAA
ATTACAGAGTACTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027848.1\|WP_095117316.1\|766333_767068_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP027848.1\|WP_095117294.1\|752871_753864_-\|o-succinylbenzoate-synthase	unknown	unknown	gnl\|CDD\|213667
NZ_CP027848.1\|WP_095117308.1\|762160_763090_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP027848.1\|WP_095117306.1\|760741_762145_-\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP027848.1\|WP_103289554.1\|757336_757516_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027848.1\|WP_095117296.1\|753866_755270_-\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|341238
NZ_CP027848.1\|WP_095117312.1\|764545_765070_+\|signal-transduction-protein-TRAP	unknown	unknown	unknown
NZ_CP027848.1\|WP_095117310.1\|763124_764165_-\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP027848.1\|WP_169712273.1\|765122_766334_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|377581
NZ_CP027848.1\|WP_095117298.1\|755662_756241_+\|Ltp-family-lipoprotein	unknown	unknown	gnl\|CDD\|377866
NZ_CP027848.1\|WP_095117302.1\|757765_758119_+\|DUF3969-family-protein	unknown	unknown	gnl\|CDD\|372479
NZ_CP027848.1\|WP_095117304.1\|759985_760558_-\|serine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|226075
NZ_CP027848.1\|WP_095117293.1\|752644_752881_+\|membrane-protein-insertion-efficiency-factor-YidD	unknown	unknown	gnl\|CDD\|376620
NZ_CP027848.1\|WP_095117281.1\|747054_747966_-\|NERD-domain-containing-protein	unknown	unknown	unknown
NZ_CP027848.1\|WP_095118142.1\|758593_758794_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP027848.1\|WP_095117289.1\|751361_752132_-\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NZ_CP027848.1\|WP_095117286.1\|749698_751279_+\|phosphoenolpyruvate-carboxykinase-(ATP)	unknown	unknown	gnl\|CDD\|236471
NZ_CP027848.1\|WP_095117300.1\|756511_756697_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225635
NZ_CP027848.1\|WP_095117283.1\|748019_749222_-\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP027848.1\|WP_095117291.1\|752112_752583_-\|nucleoside-triphosphatase-YtkD	unknown	unknown	gnl\|CDD\|131752

Protein	Function_ID	Function_description	E-value
NZ_CP027848.1\|WP_095117302.1\|757765_758119_+\|DUF3969-family-protein	gnl\|CDD\|372479	pfam13108, DUF3969, Protein of unknown function (DUF3969). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 110 amino acids in length.	2.50722e-14
NZ_CP027848.1\|WP_095117316.1\|766333_767068_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.67699e-85
NZ_CP027848.1\|WP_095117306.1\|760741_762145_-\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP027848.1\|WP_095117296.1\|753866_755270_-\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|341238	cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE). O-succinylbenzoic acid-CoA synthase catalyzes the coenzyme A (CoA)- and ATP-dependent conversion of o-succinylbenzoic acid to o-succinylbenzoyl-CoA. The reaction is the fourth step of the biosynthesis pathway of menaquinone (vitamin K2). In certain bacteria, menaquinone is used during fumarate reduction in anaerobic respiration. In cyanobacteria, the product of the menaquinone pathway is phylloquinone (2-methyl-3-phytyl-1,4-naphthoquinone), a molecule used exclusively as an electron transfer cofactor in Photosystem 1. In green sulfur bacteria and heliobacteria, menaquinones are used as loosely bound secondary electron acceptors in the photosynthetic reaction center.	2.4177e-156
NZ_CP027848.1\|WP_095117310.1\|763124_764165_-\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP027848.1\|WP_169712273.1\|765122_766334_-\|ABC-transporter-permease	gnl\|CDD\|377581	pfam05975, EcsB, Bacterial ABC transporter protein EcsB. This family consists of several bacterial ABC transporter proteins which are homologous to the EcsB protein of Bacillus subtilis. EcsB is thought to encode a hydrophobic protein with six membrane-spanning helices in a pattern found in other hydrophobic components of ABC transporters.	3.88086e-80
NZ_CP027848.1\|WP_095117298.1\|755662_756241_+\|Ltp-family-lipoprotein	gnl\|CDD\|377866	pfam07553, Lipoprotein_Ltp, Host cell surface-exposed lipoprotein. This is a family of lipoproteins that is involved in superinfection exclusion. Proteins in this family have been shown to act at the stage of DNA release from the phage head into the cell.	1.77555e-22
NZ_CP027848.1\|WP_095117294.1\|752871_753864_-\|o-succinylbenzoate-synthase	gnl\|CDD\|213667	TIGR01928, o-succinylbenzoate_synthase, o-succinylbenzoate synthase. This model describes the enzyme o-succinylbenzoic acid synthetase (menC) that is involved in one of the steps of the menaquinone biosynthesis pathway. It takes SHCHC and makes it into 2-succinylbenzoate. Included in this model are low GC gram positive bacteria and archaea. Also included in the seed and in the model are enzymes with the com-name of N-acylamino acid racemase (or the more general term, racemase / racemase family), which refers to the enzyme's industrial application as racemases, and not to its biological function as o-succinylbenzoic acid synthetase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	7.34415e-82
NZ_CP027848.1\|WP_095117304.1\|759985_760558_-\|serine-hydrolase-family-protein	gnl\|CDD\|226075	COG3545, COG3545, Predicted esterase of the alpha/beta hydrolase fold [General function prediction only].	4.21252e-28
NZ_CP027848.1\|WP_095117293.1\|752644_752881_+\|membrane-protein-insertion-efficiency-factor-YidD	gnl\|CDD\|376620	pfam01809, Haemolytic, Haemolytic domain. This domain has haemolytic activity. It is found in short (73-103 amino acid) proteins and contains three conserved cysteine residues.	9.75761e-44
NZ_CP027848.1\|WP_095117308.1\|762160_763090_-\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP027848.1\|WP_095117289.1\|751361_752132_-\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	2.26589e-43
NZ_CP027848.1\|WP_095118142.1\|758593_758794_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.38163e-13
NZ_CP027848.1\|WP_095117286.1\|749698_751279_+\|phosphoenolpyruvate-carboxykinase-(ATP)	gnl\|CDD\|236471	PRK09344, PRK09344, phosphoenolpyruvate carboxykinase.	0
NZ_CP027848.1\|WP_095117300.1\|756511_756697_-\|hypothetical-protein	gnl\|CDD\|225635	COG3093, VapI, Plasmid maintenance system antidote protein [General function prediction only].	0.00293526
NZ_CP027848.1\|WP_095117283.1\|748019_749222_-\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP027848.1\|WP_095117291.1\|752112_752583_-\|nucleoside-triphosphatase-YtkD	gnl\|CDD\|131752	TIGR02705, conserved_hypothetical_protein, nucleoside triphosphatase YtkD. The functional assignment to the proteins of this family is contentious, with papers disagreeing in both interpretation and enzyme assay results. This protein belongs to the nudix family and shares some sequence identity with E. coli MutT but appears not to be functionally interchangeable with it. [DNA metabolism, DNA replication, recombination, and repair].	1.85112e-58

>NZ_CP027848.1|WP_095117300.1|756511_756697_-|hypothetical-protein
MMRKEIEKLLESDISHYKISKVTGVNSKTISELRAGKRKIGNITLDTAEKLYNYQIQLEDK
>NZ_CP027848.1|WP_095117298.1|755662_756241_+|Ltp-family-lipoprotein
MSNDATNQNFNPTKKIEQQVQPSKETSSNSKKWWLWGCGGCGGCLVIIIILSVAFTFLAGAIIDNVDEELQKDPLLQNPPSKTDDSSGHTGVKSEKERALEQAKIYSNDLYMSKEMIYQTLTSNDGDKFPAEAAQYAIDNLHADYKQNAVKKAESYANDMNMSKNEIYDQLTSPYGELYTKEEAQYAIDHMK
>NZ_CP027848.1|WP_095117296.1|753866_755270_-|o-succinylbenzoate--CoA-ligase
MESWLIQRVKKTPNAVAVETEHQQLSFQQLFEIASQYGSGLTSLNDKRFGLLVDNSLEALALIHGAWLFNIEIALINNRLTDEEIIKQMKSIDVKTIVVSDKYQSRCMKTQLAQQFQCLTASEVLKYETSMKIQEFDETAIASIMFTSGTTGTQKAVPQTFLNHKASAKRCQSDLGFDKQTRWLTVLPIYHISGLSIVIRSVLYGFTVYLMEKFDEQKIMEAIKHKNITHMSLVPLTLKRLMRAGLTKPYELEKILLGGAKLERDFVMQALSYELPIYNSFGMTETCSQFLTASPEILAKNPEAVGKFDSQLKISRPNQNGHGELCVRGDNVMQGYLYPTGLTDTFDDEGFFMTGDIASVDANGFVIIHDRRKDLIISGGENIYPNEIERVAKKHTDVLDAMCVGVKDDYWGQRPILYIVGTPPEAEMLDYLSSHLAKYKLPKEIRYVQSLPYTSTGKLKRQLLNGE
>NZ_CP027848.1|WP_095117294.1|752871_753864_-|o-succinylbenzoate-synthase
MKLSELHFYEYTPTFKHKIQTPKITMNVRKTLFIGLIDESGTEWFGECNAFETDWYHYETIETVKRTLESWFKCVEGHEIHDFSEAQRMADKLNDTPAARATVMMALYQMFHDLPSFEVPMTVTVNGDMQKRFLRIDHAERIKIKWNCDIVEQVKLLTAMYPDIPITTDANQTLSDRDIPLLNQLANYNLAYIEEPFPELLKEKELGNMPPIAIDEHATDEQAIVQAVQCNHVRVIVIKPFRVGGIDRALSLIDTLHNQGITVVIGGMYECGLSRYFTALASRYGDYAGDVTPCGYYFTDDIVEQSGQIIKGRLRFKPPVIDMSKLQRYL
>NZ_CP027848.1|WP_095117293.1|752644_752881_+|membrane-protein-insertion-efficiency-factor-YidD
MKKIFIKCIRFYQRFISPLTPPSCRFYPTCSNYAIEAIQVHGAIKGSWLAINRILRCHPFHKGGFDPVPFKKKKHHHK
>NZ_CP027848.1|WP_095117291.1|752112_752583_-|nucleoside-triphosphatase-YtkD
MEFIDAAQQRVTLSFRAHHDVADGDHVLALPIYQNRLLMTDHRQRGIEFPGGKCEAGETTIDALKRELYEETGATIETTYYIAQYTVHTETMPFKKDVYVVIVDNIEGKSDYLETNGPMIVSKIEDIPEDKRSILLSDKAILACVERMVSLGFYQL
>NZ_CP027848.1|WP_095117289.1|751361_752132_-|S9-family-peptidase
MDFISYKRMPADLGTHQVDEVRYDAAGITVRGLLVTPKHSVERIVVYLRGGKGQVGRVRLGRMLQFTNTSTLVFGPYYRGNNGSQGRDAFAGDDLQDVIAGVEILKKMYPNVPVHLIGFSRGGIQGLLTFQAVQAASYIIWGGVSDMHLMYEERVDLRGMLRRMVGHPKKLPEAYQQRDALSMIDHTAPPILIVHGGLDEQVGIHQAYHLAKHLEAKQVRYDTFYQMGEGHIPRPKALSEVLQRIHSWMDEVERNK
>NZ_CP027848.1|WP_095117286.1|749698_751279_+|phosphoenolpyruvate-carboxykinase-(ATP)
MSFDTSALNALIDKPTSHLQLTKTELYNKILSRGEAELTELGAINAKTGEYTGRSPKDKYIVNNPQVIDDIDWGTVNQPISEDKFLNLYHQVLEYLDAKDEVFVFNGYAGSDKDSQLKLTVVNEFAWHNLFAQNMFIRPHSKSEAEKIKADFTIISAPTFKADPEKDGTRSETFVIVSFKHKTVLIGGTEYAGEMKKSIFSVMNYLLPKRDIMSMHCSANVGRKGDVALFFGLSGTGKTTLSADPDRKLIGDDEHGWNENGVFNIEGGCYAKAINLSAEKEPQIFDAIRYGTVLENLVVDEHGYIDFDDNKYTENTRAAYPIEHIDNIVVPSKASHPNTIIFLTADAFGVLPPISKLSKDQAMYHFLSGFTSKLAGTERGITEPQPSFSTCFGAPFLPLNAKVYADLLGDLIDKHEVDVYLVNTGWTGGVYGKGNRIELKYTRKMVNSAINGSLKNSTFEEDEIFGLSIPTEIEGVPTTILQPKNAWHDKDAYDKQATDLIERFRENFKKFGEETQQLQQTGGFKG
>NZ_CP027848.1|WP_095117283.1|748019_749222_-|methionine-adenosyltransferase
MTNNKRLFTSESVTEGHPDKIADQISDAILDEILKGDSHARVACETTVTTGMALIAGEISTSTYVDIPKVVRETVKQIGYTRAKYGYDYKTMSVLTAIDEQSPDIAQGVDRALEYRDASNDEVLNIGAGDQGLMFGYATNETASFMPLPIDLSHKLAKRLTDVRKDGTLDYLRPDGKVQVTVEYDENDQPKRIDTIVISSQHHEEVALDQIQRDIKEYVIYPVVPQALLDAETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGFADKCEVQLAYAIGVAQPVSIAIDTFGTGTVSEESLIQAVRSHFDLRPAGIIQMLDLQRPIYKQTAAYGHFGRTDVELPWEKTDKVDVLKDAVQAYTA
>NZ_CP027848.1|WP_095117281.1|747054_747966_-|NERD-domain-containing-protein
MTQFGPMEIGLYVAVGIAVICFILFLVALNRKKKAQQRIETQYKEKEEKLTQSHHEALEKVRIEKKKVETKHKEDYETMVASKDREIDALKVFSKNNSEYVTDMRLIGIRERLVREKRIRPEDMHIMANIFMPTNDLDNITRISHLVLTRTGLYIIDSQLLKGHVYQGISRNQFVDNPMMEQVFKTLQLDETTPQTIVLDESEDNDRKLSIVDYSEQIEHLEAVAEKLQRQLNNKYTPTPILYFNPKQDGDVTLSSYAPQSTTKVLVGPEQLDEFFNKYVFHGRIQYDVNELQAIMEEIESYN
>NZ_CP027848.1|WP_103289554.1|757336_757516_-|hypothetical-protein
MTKPKIKRKHDAPTYNDILKLIKIKDGNIQVMKVEEDVEVRGRFSTVVYGTLSYTSKVE
>NZ_CP027848.1|WP_095117302.1|757765_758119_+|DUF3969-family-protein
MILFENTREVEKFALIIIHGLFSQMNKGLISIENAEHIFFTPHTITELEKLNVDQSIIELIHLGTELEDLEDFAISVKEETDKFLAQTEQLLTNYQDVEFTEKILTDLKIIKKNTDV
>NZ_CP027848.1|WP_095118142.1|758593_758794_+|tyrosine-type-recombinase/integrase
MIALGRYTLHSIRHTHASALLTNGLSIQYISKRLGHSIIEITWRVYIHLLEEHKKEQGQRVRELFS
>NZ_CP027848.1|WP_095117304.1|759985_760558_-|serine-hydrolase-family-protein
MTNVYIVHGYQANSRDHWFPWLKRTLEIEGHQVTVLDLPNTNRPNGSEWVSYMKEHITEVNNDTIFIAHSLGVITTLKFIQDLDVAQVGSLAMVSGFKGDLPKNDLLPDQEVLDSFFNWELDYELLHNKVLHMFGVAAKDDYVVPIEATQKLCEVLDCKLYELDTGGHFCKEDGYDAFLFLKNKILQKFD
>NZ_CP027848.1|WP_095117306.1|760741_762145_-|protoporphyrinogen-oxidase
MTKVAIVGAGITGLTSAYFIKKHYPEIDVTIYEATDRPGGKVKTAYRDGYVIELGPESYLGRKTIMTDVAKDIGIADEDIVTNETGQSYIFANNELYPIPGGAILGVPTDIKPFMTTQLISMKGKLRALKDLTIKPVDMPEGDMSVGAFFRERLGDELLENLIEPLLSGIYGTDIDELSLMSTFPHFKSLEEQHGSIIKGMQQVRKARLEKEDQRRSGAQGQFKQFRRGLYDFIEHLETWLIAQDVSIQYNTQVKDLISTQKGYHIVLDDDTQPFYDGVIVATPHQTFRQWFDKDPMFDYFDELDASSVATIVFAFDEDDIENIHNGTGFVIARTSQTDITACTWTSKKWPHTTPEGKVLIRAYVGKQGDNIVNEKTDEELVQIARRDLEQMMTFKGEPEFTIVNKMPYASPQYHVGHIDKIKQIQQHILDNYQHLQITGAPFEAVGLPDCISQAYQAVENLLPRIR
>NZ_CP027848.1|WP_095117308.1|762160_763090_-|ferrochelatase
MTKTVGLLVMAYGTPYKKSDIEPYYTDIRRGRKPSQAELDDLTQRYEAIGGLSPLAGTTERQGEALVNALNESGLYKDTEFKLYIGLKHIHPFIEDTVIQMHKDGITEAITVVLAPHYSKFSIGSYNKRAKEKADEFGITLHHVNSYFEQPKFIDYWSMRINEVLENIPVDEHDDTMLVVSAHSLPERMILESNDPYPEQISKTARLIAEHIPLKHISVGWQSAGNTGTPWLAPDVQDLTRELHGILGSKHFIYTPLGFVAEHLEVLYDNDYECKVVCDEVGAMYHRPPMPDTHPLFIGAIVDEISNIY
>NZ_CP027848.1|WP_095117310.1|763124_764165_-|uroporphyrinogen-decarboxylase
MNNTFNDTMLRAIKGEQATHTPVWFMRQAGRSQPEYRKLKEKYSLFDITHQPEICAYVTKLPVDQYNTDAAVLYKDIMTPLKAIGVDVEIKSGIGPVISNPIRQYSDVTALGQIDPKRDVPYVLDTIKLLTQEQLNVPLIGFTGAPFTLASYMIEGGPSKNYNKTKAMMYSDEATWFKLMDTLADMSITYVKGQVEAGAQIIQIFDSWVGALNESDYKYYIQPCMNKLVAGIKALNTPVILFGVGASHLIDAWHDLPIDVLGLDWRTSISEAGQQGVTKTVQGNLDPSILLAPWDVIEARLKPILDQGLAHAGGHIFNLGHGVFPEVSPDTLRRVAQFVHDYTAKK
>NZ_CP027848.1|WP_095117312.1|764545_765070_+|signal-transduction-protein-TRAP
MNFFITYGTLSFLQQIQSKHKNRDLLIFAGEGHAIIFEETDLDTIFQQPNEYRVLSHVGELSESDFQVLITIPTSEDHKYQLEKQLETYQPALEENADYHSFRLLKSTHQNVYKALLGFTSRNAYDDYKKSSAFRNNLSLEATKPLAGASAVHTPYIEQYFYPSQDISEEENNV
>NZ_CP027848.1|WP_169712273.1|765122_766334_-|ABC-transporter-permease
MTAKQLFNQRYRAMRKEAQYYNKFIFNGHFTVFLVILIGAFILGYGEWLKDIPTGINYFLFISIVLAISSIFPLKTYLVEADSLFLLPFESQMKDYIQKSIWTSYYKRLPLQVILLVISYPLIHALAPNQTTQFIVICLFTLLLPLIGLFVKWYWFLYGLEAWSINVILGILNLSAIYVMLASGSLHSLGAPIALIVLAVFLQKLTKQHRLPWTFLIKQAHQHQANYYKFVSMFTDVKGLQERAVRRRYLDFLLATPTSFHEGAMYPFLFKRNFLRGKDAFNLTLRLVVITVLLMSWLNHPYVSIVIGCMAMYILIMQMSQFYTQEAYGLWPQVWPPSEALVILGYQKFLTGTTSVMAAILSVVYLVFNIQHGYLIVLLFIVSYLTIHRTIKKLKYKESLLRD
>NZ_CP027848.1|WP_095117316.1|766333_767068_-|ABC-transporter-ATP-binding-protein
MTVKVEHLTGGYGKKPVIKDISFALKSGEIVGLIGLNGVGKSTTIKHILGLLTPSEGKMSISGIDINEDIHTYRKKLSYIPESPVIYETLTLKEHIYMTAMAYGINQETAMTRAQPLLKTFRLEEQLEVFPSHFSKGMKQKVMIICAFIVDPDLYIIDEPFLGLDPLGIQSMLDLMEAKKQEGRTVLMSTHILATAERYCDRFIILDKGEIIGVGDLETLRQQFKMPNATLDDIYIRSTQGVGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP027848_3	3.2\|757044\|30\|NZ_CP027848\|CRISPRCasFinder	757044-757073	30	NZ_CP027848.1	1955035-1955064	1	0.967
NZ_CP027848_3	3.4\|757066\|26\|NZ_CP027848\|PILER-CR	757066-757091	26	NZ_CP027848.1	1955039-1955064	1	0.962

1. spacer 3.2|757044|30|NZ_CP027848|CRISPRCasFinder matches to position: 1955035-1955064, mismatch: 1, identity: 0.967

aaaggctatgtaggactactgacatcaaga	CRISPR spacer
aaaggctatgtaggactactaacatcaaga	Protospacer
********************.*********

2. spacer 3.4|757066|26|NZ_CP027848|PILER-CR matches to position: 1955039-1955064, mismatch: 1, identity: 0.962

gctatgtaggactactgacatcaaga	CRISPR spacer
gctatgtaggactactaacatcaaga	Protospacer
****************.*********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157417-157444	1	0.964
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153997-154024	1	0.964
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156727-156754	1	0.964
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156877-156904	1	0.964
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157111-157138	1	0.964
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1522-1549	1	0.964
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153055-153082	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154459-154486	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156649-156676	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157291-157318	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151486-151513	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153163-153190	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153799-153826	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153901-153928	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155569-155596	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156073-156100	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156349-156376	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156547-156574	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157381-157408	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1534-1561	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1048-1075	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2266-2293	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3034-3061	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151522-151549	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151558-151585	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151594-151621	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153091-153118	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153163-153190	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154069-154096	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154477-154504	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155737-155764	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156949-156976	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154585-154612	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155767-155794	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157075-157102	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	994-1021	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2230-2257	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2794-2821	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3250-3277	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1426-1453	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2998-3025	2	0.929
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3460-3487	2	0.929
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1468-1495	2	0.929
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2017	2	0.929
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1414-1441	2	0.929
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2572-2599	2	0.929
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3760-3787	2	0.929
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3778-3805	2	0.929
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151834-151861	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151888-151915	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153091-153118	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153607-153634	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154585-154612	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155497-155524	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155737-155764	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156277-156304	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156313-156340	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157075-157102	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157111-157138	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1246-1273	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1390-1417	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1480-1507	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1948-1975	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2020-2047	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3352-3379	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3520-3547	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	976-1003	3	0.893
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1138-1165	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151378-151405	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151414-151441	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153535-153562	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154105-154132	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154141-154168	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154213-154240	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155053-155080	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155287-155314	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155515-155542	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156001-156028	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156037-156064	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156295-156322	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156385-156412	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156421-156448	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156439-156466	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156649-156676	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156781-156808	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156817-156844	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156985-157012	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157615-157642	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1120-1147	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1228-1255	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1336-1363	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1390-1417	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1498-1525	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1570-1597	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1858-1885	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1966-1993	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2020-2047	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2074-2101	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2110-2137	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2398-2425	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2644-2671	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3070-3097	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3196-3223	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3286-3313	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3370-3397	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3682-3709	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	958-985	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	994-1021	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1066-1093	3	0.893
NZ_CP027848_1	1.18\|175746\|28\|NZ_CP027848\|CRT	175746-175773	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1726-1753	3	0.893
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151504-151549	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151540-151585	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151576-151621	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155035-155080	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155269-155314	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156931-156976	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157129-157174	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1102-1147	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1912-1957	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2380-2425	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2980-3025	3	0.935
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3268-3313	3	0.935
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1333	3	0.893
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1360-1387	3	0.893
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1699	3	0.893
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2935	3	0.893
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151311-151338	3	0.893
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1117	3	0.893
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1156-1183	4	0.857
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3613	4	0.857
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3439	4	0.857
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154213-154240	5	0.821
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156703-156730	5	0.821
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1708-1735	5	0.821
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2338-2365	5	0.821
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156703-156730	5	0.821
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2140-2167	5	0.821
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3496-3523	5	0.821
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1138-1183	5	0.891
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1654-1681	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2326-2353	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2467	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2482-2509	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16145-16172	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16277-16304	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16409-16436	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16475-16502	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16721-16748	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17087-17114	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17153-17180	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17555-17582	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17717-17744	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18017-18044	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18215-18242	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18479-18506	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18527-18554	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18959-18986	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19199-19226	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19499-19526	5	0.821
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19697-19724	5	0.821
NZ_CP027848_3	3.2\|757044\|30\|NZ_CP027848\|CRISPRCasFinder	757044-757073	30	MF417980	Uncultured Caudovirales phage clone 10F_4, partial genome	4793-4822	5	0.833
NZ_CP027848_3	3.2\|757044\|30\|NZ_CP027848\|CRISPRCasFinder	757044-757073	30	MF417953	Uncultured Caudovirales phage clone 7S_15, partial genome	13954-13983	5	0.833
NZ_CP027848_1	1.8\|175014\|46\|NZ_CP027848\|CRT	175014-175059	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1624-1669	6	0.87
NZ_CP027848_1	1.8\|175014\|46\|NZ_CP027848\|CRT	175014-175059	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3556-3601	6	0.87
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157702-157729	6	0.786
NZ_CP027848_1	1.13\|175350\|28\|NZ_CP027848\|CRT	175350-175377	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3627978-3628005	6	0.786
NZ_CP027848_1	1.18\|175746\|28\|NZ_CP027848\|CRT	175746-175773	28	LT598654	Phage NCTB genome assembly, complete genome: monopartite	9424-9451	6	0.786
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151360-151405	6	0.87
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3508-3535	6	0.786
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1168-1195	6	0.786
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	42845-42874	6	0.8
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	489081-489110	6	0.8
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	350106-350135	6	0.8
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	468804-468833	6	0.8
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	196780-196809	6	0.8
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	97413-97442	6	0.8
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	MG893203	Vibrio phage VP06, complete genome	60072-60099	7	0.75
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	MF754113	Vibrio phage vB_VpaS_KF3, complete genome	38693-38720	7	0.75
NZ_CP027848_1	1.10\|175152\|28\|NZ_CP027848\|CRT	175152-175179	28	MF754114	Vibrio phage vB_VpaS_KF4, complete genome	60052-60079	7	0.75
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3340-3367	7	0.75
NZ_CP027848_1	1.31\|176898\|28\|NZ_CP027848\|CRT	176898-176925	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151302	7	0.75
NZ_CP027848_2	2.1\|688674\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688674-688703	30	MN689521	Lactococcus phage CHPC836, complete genome	33963-33992	7	0.767
NZ_CP027848_2	2.1\|688674\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688674-688703	30	MN693120	Marine virus AFVG_25M98, complete genome	16184-16213	7	0.767
NZ_CP027848_2	2.6\|689003\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	689003-689032	30	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	129555-129584	7	0.767
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	NC_017414	Borreliella burgdorferi N40 plasmid N40_lp36, complete sequence	2033-2062	8	0.733
NZ_CP027848_3	3.3\|756997\|29\|NZ_CP027848\|PILER-CR	756997-757025	29	NC_017414	Borreliella burgdorferi N40 plasmid N40_lp36, complete sequence	2033-2061	8	0.724
NZ_CP027848_3	3.3\|756997\|29\|NZ_CP027848\|PILER-CR	756997-757025	29	MF001361	Enterococcus phage EF5, partial genome	58107-58135	8	0.724
NZ_CP027848_3	3.3\|756997\|29\|NZ_CP027848\|PILER-CR	756997-757025	29	MF001358	Enterococcus phage EF1, partial genome	59211-59239	8	0.724
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2572-2611	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3781	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16793-16832	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17627-17666	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17789-17828	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18875-18914	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19271-19310	9	0.775
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1018-1057	9	0.775
NZ_CP027848_1	1.9\|175086\|40\|NZ_CP027848\|CRT	175086-175125	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153862	9	0.775
NZ_CP027848_1	1.9\|175086\|40\|NZ_CP027848\|CRT	175086-175125	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156136	9	0.775
NZ_CP027848_1	1.9\|175086\|40\|NZ_CP027848\|CRT	175086-175125	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156610	9	0.775
NZ_CP027848_1	1.24\|176238\|46\|NZ_CP027848\|CRT	176238-176283	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154267-154312	9	0.804
NZ_CP027848_1	1.30\|176820\|52\|NZ_CP027848\|CRT	176820-176871	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2044-2095	9	0.827
NZ_CP027848_2	2.4\|688871\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688871-688900	30	NZ_CP017904	Vibrio alginolyticus strain K05K4 plasmid pL289, complete sequence	126070-126099	9	0.7
NZ_CP027848_2	2.4\|688871\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688871-688900	30	NZ_CP017901	Vibrio alginolyticus strain K04M5 plasmid pL294, complete sequence	131726-131755	9	0.7
NZ_CP027848_2	2.4\|688871\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688871-688900	30	NZ_CP017909	Vibrio alginolyticus strain K06K5 plasmid pL291, complete sequence	109664-109693	9	0.7
NZ_CP027848_2	2.4\|688871\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688871-688900	30	NZ_CP017893	Vibrio alginolyticus strain K04M1 plasmid pL280, complete sequence	109664-109693	9	0.7
NZ_CP027848_2	2.4\|688871\|30\|NZ_CP027848\|CRISPRCasFinder,CRT	688871-688900	30	NZ_CP017898	Vibrio alginolyticus isolate K04M3 plasmid pL294, complete sequence	131091-131120	9	0.7
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	MF001358	Enterococcus phage EF1, partial genome	59211-59240	9	0.7
NZ_CP027848_3	3.1\|756978\|30\|NZ_CP027848\|CRISPRCasFinder	756978-757007	30	MF001361	Enterococcus phage EF5, partial genome	58106-58135	9	0.7
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155935-155974	10	0.75
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1072-1111	10	0.75
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1900-1939	10	0.75
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18587-18626	10	0.75
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21265-21304	11	0.725
NZ_CP027848_1	1.1\|174450\|40\|NZ_CP027848\|CRT	174450-174489	40	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15886-15925	11	0.725
NZ_CP027848_1	1.30\|176820\|52\|NZ_CP027848\|CRT	176820-176871	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153559-153610	11	0.788
NZ_CP027848_1	1.30\|176820\|52\|NZ_CP027848\|CRT	176820-176871	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154303-154354	11	0.788

1. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcgctgtccgagtccgaatcactg	Protospacer
******.*********************

2. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
.***************************

3. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
.***************************

4. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
.***************************

5. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcactgtcggagtccgaatcgctg	Protospacer
****************** *********

6. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.964

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtccgag	Protospacer
***.************************

7. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtccgaatccgaatcactg	Protospacer
 **************.************

8. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtcagagtccgaatcactg	Protospacer
 *********** ***************

9. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcggagtccgaatcactg	Protospacer
 *********** ***************

10. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcgctgtccgagtccgaatcactg	Protospacer
 *****.*********************

11. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcgctgtccgagtccgaatcgctg	Protospacer
******.*****************.***

12. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcactgtcggagtccgaatcgctg	Protospacer
************ ***********.***

13. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcactgtcggagtccgagtcactg	Protospacer
************ ********.******

14. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcgctgtcggagtccgaatcactg	Protospacer
******.***** ***************

15. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcgctgtccgagtccgaatcgctg	Protospacer
******.*****************.***

16. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcactgtcggagtccgagtcactg	Protospacer
************ ********.******

17. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcactgtccgaatccgagtcactg	Protospacer
***************.*****.******

18. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcactgtcagaatccgaatcactg	Protospacer
************ **.************

19. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcactgtcagagtccgagtcactg	Protospacer
************ ********.******

20. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcgctgtccgagtccgaatcactg	Protospacer
 *****.*********************

21. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcgctgtcagagtccgaatcactg	Protospacer
******.***** ***************

22. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgaatcgctgtccgagtccgaatcactg	Protospacer
***.**.*********************

23. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgaatcgctgtccgagtccgaatcactg	Protospacer
***.**.*********************

24. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

25. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

26. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

27. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtccgaatcgctg	Protospacer
.***************** *********

28. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcggagtccgaatcgctg	Protospacer
 ***************** *********

29. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

30. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtcggaatcgctg	Protospacer
 **.************************

31. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtccgaatcgctg	Protospacer
.***************** *********

32. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

33. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcactgtcagagtccgaatcgctg	Protospacer
************.***** *********

34. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcactgtcggcgtcagaatcgctg	Protospacer
************** ***.*********

35. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcactgtcagagtccgaatcgctg	Protospacer
************.***** *********

36. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

37. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
tgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.*********************

38. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcagagtcggaatcgctg	Protospacer
.***********.***************

39. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggagtcgctg	Protospacer
.********************.******

40. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcgctgtcggagtcggagtcgctg	Protospacer
******.**************.******

41. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcgctgtcggagtccgaatcgctg	Protospacer
******.*********** *********

42. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
agagtcactgtcggaatccgaatcgctg	Protospacer
***************.** *********

43. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtccgaa	Protospacer
***.***********************.

44. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtccgaa	Protospacer
***.***********************.

45. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtcggag	Protospacer
***.******************** ***

46. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtcggag	Protospacer
***.******************** ***

47. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcggagtcgctgtccgag	Protospacer
***.********.***************

48. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtcggag	Protospacer
***.******************** ***

49. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtccgaatccgaatcgctg	Protospacer
 **************.********.***

50. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggaatcactgtcggagtccgaatcactg	Protospacer
 **.******** ***************

51. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcggagtccgaatcgctg	Protospacer
 *********** ***********.***

52. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtccgaatccgaatcgctg	Protospacer
 **************.********.***

53. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtcagagtccgaatcgctg	Protospacer
 *********** ***********.***

54. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggaatcactgtcggagtccgaatcactg	Protospacer
 **.******** ***************

55. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcggagtccgaatcgctg	Protospacer
 *********** ***********.***

56. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggaatcactgtcggagtccgaatcactg	Protospacer
 **.******** ***************

57. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggaatcgctgtccgagtccgaatcactg	Protospacer
 **.**.*********************

58. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtcagagtccgaatcgctg	Protospacer
 *********** ***********.***

59. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtcggagtccgaatcgctg	Protospacer
 *********** ***********.***

60. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcgctgtccgaatccgaatcactg	Protospacer
 *****.********.************

61. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcagagtccgaatcgctg	Protospacer
 *********** ***********.***

62. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcgctgtccgaatccgaatcactg	Protospacer
 *****.********.************

63. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcgctgtcagagtccgaatcactg	Protospacer
 *****.***** ***************

64. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcagagtccgaatcgctg	Protospacer
 *********** ***********.***

65. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcgctgtccgaatccgaatcactg	Protospacer
 *****.********.************

66. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcgctgtccgagtccgaatcgctg	Protospacer
 *****.*****************.***

67. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcgctgtcagagtccgaatcactg	Protospacer
 *****.***** ***************

68. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggaatcactgtcagagtccgaatcactg	Protospacer
 **.******** ***************

69. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

70. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

71. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggagtcgctg	Protospacer
 *****.**************.******

72. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
 **.**.*********************

73. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
 **.**.*********************

74. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
actgtcactgtcggagtccgaatcgctg	Protospacer
*  *************** *********

75. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

76. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

77. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcagagtcggaatcgctg	Protospacer
 **.********.***************

78. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtctgagtcggaatcgctg	Protospacer
 *****.***** ***************

79. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtccgagtcgctg	Protospacer
.***************** **.******

80. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcagagtcggaatcgctg	Protospacer
 **.********.***************

81. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtccgagtcgctg	Protospacer
.***************** **.******

82. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggaatcactgtcggagtcggaatcactg	Protospacer
.**.********************.***

83. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggaatcactgtcggagtcggaatcactg	Protospacer
.**.********************.***

84. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtccgaatcactg	Protospacer
.***************** *****.***

85. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcagagtcggaatcgctg	Protospacer
 *****.*****.***************

86. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

87. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

88. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcgctgtcagagtcggaatcgctg	Protospacer
.*****.*****.***************

89. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

90. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggagtcgctg	Protospacer
 *****.**************.******

91. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcggaatcggagtcgctg	Protospacer
 **************.*****.******

92. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcagagtccgaatcgctg	Protospacer
.***********.***** *********

93. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtccgaatcgctg	Protospacer
 **.************** *********

94. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtcggagtcgctg	Protospacer
 **.*****************.******

95. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
 **.**.*********************

96. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
 **.***********.************

97. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcagagtccgaatcgctg	Protospacer
.***********.***** *********

98. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcagagtcagaatcgctg	Protospacer
 ***********.*****.*********

99. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcagagtcggagtcgctg	Protospacer
 ***********.********.******

100. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

101. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggaatccgaatcgctg	Protospacer
.**************.** *********

102. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcgctgtcggaatcgctg	Protospacer
 ************  *************

103. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggaatccgaatcgctg	Protospacer
.**************.** *********

104. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggaatcactg	Protospacer
 *****.*****************.***

105. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtccgaatcgctg	Protospacer
 **.************** *********

106. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtccgaatcgctg	Protospacer
 **.************** *********

107. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtcggagtcgctg	Protospacer
 *****.**************.******

108. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
 **.***********.************

109. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.*********** *********

110. spacer 1.18|175746|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

agaatcactgtctgcatcagaatcgctg	CRISPR spacer
cgaatcactgtcagcatccgaatcgctg	Protospacer
 *********** ***** *********

111. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtccgaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
 *********** **.******************************

112. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
.***********.**.******************************

113. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatcgctgtcggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
.***********.**.******************************

114. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
 **************.******************** *********

115. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
 **************.******************** *********

116. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcagaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
 **.***********.******************************

117. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtccgaatcgctgtcagagtcggaatcgctg	Protospacer
 ********************.********.***************

118. spacer 1.24|176238|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgagtcgctgtcagagtccgagtcgctgtcggagtccgaatcgctg	Protospacer
 **.******************************** *********

119. spacer 1.24|176238|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtccgagtcgctgtccgagtcggagtcgctg	Protospacer
 ***************************** ********.******

120. spacer 1.24|176238|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
 **************.******************** *********

121. spacer 1.24|176238|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtcagagtcgctgtcggagtccgaatcgctg	Protospacer
 ***************** ***************** *********

122. spacer 1.24|176238|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.935

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtcgctgtcagagtccgagtcgctgtcggagtcggaatcactg	Protospacer
.**.**************************************.***

123. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtcggaa	Protospacer
***.******************** **.

124. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtcagagtcagagtcgctgtccgaa	Protospacer
***.** ********************.

125. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtcagaa	Protospacer
***.******************** **.

126. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtcggagtcagagtcgctgtccgaa	Protospacer
***.** ********************.

127. spacer 1.31|176898|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatccgagtcagagtcactgtcagaa	Protospacer
******************.***** **.

128. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtccgagtcagagtcgctgtcagaa	Protospacer
***.******************** **.

129. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcggagtcggagtcggag	Protospacer
 ********************.***  *

130. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
cgaatcggagtcagagtcgctgtccgag	Protospacer
   *** *********************

131. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
actgtccgagtcagagtcgctgtcagaa	Protospacer
.**.******************** **.

132. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
actgtcactgtcggagtccgaatcgctg	Protospacer
   ********* ***********.***

133. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcagagtccgaatcggag	Protospacer
 *********** ***********.  *

134. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
gctgtcagagtccgagtccgaatcactg	Protospacer
   ****  *******************

135. spacer 1.10|175152|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
cgagtcgctgtccgagtccgagtccgag	Protospacer
******.**************.**   *

136. spacer 1.13|175350|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
ggagtcactgtcagagtccgaatcggag	Protospacer
.***********.***** ******  *

137. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcggagtcggagtcagag	Protospacer
 ********************.**.  *

138. spacer 1.13|175350|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcagagtcggagtcggag	Protospacer
 ***********.********.***  *

139. spacer 1.24|176238|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.891

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtccgagtcactgtcggagtcggagtcggag	Protospacer
 ***********************.**************.***  *

140. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
cgaatcggagtccgagtcgctgtccgag	Protospacer
   *** ***** ***************

141. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
ggagtcagagtccgagtcgctgtccgag	Protospacer
*  .** ***** ***************

142. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtcggagtcagagtcgctgtcagca	Protospacer
***.** ***************** * .

143. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctgtcagagtcagagtcgctgtcagca	Protospacer
***.** ***************** * .

144. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

145. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

146. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

147. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgagtcagagtcgctatcgctg	Protospacer
******.**************.**   *

148. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

149. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

150. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgagtcagagtcgctatcgctg	Protospacer
******.**************.**   *

151. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

152. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

153. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

154. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

155. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

156. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

157. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

158. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

159. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

160. spacer 1.31|176898|28|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
gctatctgaatcagagtcgctgtcgctg	Protospacer
******.**.**************   *

161. spacer 3.2|757044|30|NZ_CP027848|CRISPRCasFinder matches to MF417980 (Uncultured Caudovirales phage clone 10F_4, partial genome) position: , mismatch: 5, identity: 0.833

aaaggctatgtaggactactgacatcaaga	CRISPR spacer
aaaggctatgtgggattactgacaagcaga	Protospacer
***********.***.********   ***

162. spacer 3.2|757044|30|NZ_CP027848|CRISPRCasFinder matches to MF417953 (Uncultured Caudovirales phage clone 7S_15, partial genome) position: , mismatch: 5, identity: 0.833

aaaggctatgtaggactactgacatcaaga	CRISPR spacer
aaaggctatgtgggattactgacaagtaga	Protospacer
***********.***.********   ***

163. spacer 1.8|175014|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.87

cgaatcgctgtcggaatccgaatcgctgtccgaatctgagtcgcta	CRISPR spacer
cgaatcactgtcggaatccgaatcgctgtccgaatcggagtccgag	Protospacer
******.***************************** *****   .

164. spacer 1.8|175014|46|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.87

cgaatcgctgtcggaatccgaatcgctgtccgaatctgagtcgcta	CRISPR spacer
cgaatcactgtcggaatccgaatcgctgtccgaatcggagtcagag	Protospacer
******.***************************** *****.  .

165. spacer 1.10|175152|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
ggagtcactgtcagagtccgagtccgag	Protospacer
 *********** ********.**   *

166. spacer 1.13|175350|28|NZ_CP027848|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.786

agagtcactgtcggagtcggaatcgctg	CRISPR spacer
cgagtcactgtcgcagtcggaacggcca	Protospacer
 ************ ********. **..

167. spacer 1.18|175746|28|NZ_CP027848|CRT matches to LT598654 (Phage NCTB genome assembly, complete genome: monopartite) position: , mismatch: 6, identity: 0.786

agaatcactgtctgcatcagaatcgctg	CRISPR spacer
tgcatcactgtcttcatcagaatcttcg	Protospacer
 * ********** ********** ..*

168. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.87

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
gaatccactgtcagagtccgagtcgctgtcggagtccgaatcgctg	Protospacer
..* .*.***************************** *********

169. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
agagtcggagtcggagtcgctgtccgag	Protospacer
.  .** *****.***************

170. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
ggagtcggagtcggagtcgctgtccgaa	Protospacer
*  .** *****.**************.

171. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 6, identity: 0.8

agagaatactcaaataaatcaaccttttgt----	CRISPR spacer
agagaatactaagataaatcaac----tgtgaca	Protospacer
********** *.**********    ***

172. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

agagaatactcaaataaatcaaccttttgt----	CRISPR spacer
agagaatactaagataaatcaac----tgtgaca	Protospacer
********** *.**********    ***

173. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 6, identity: 0.8

agagaatactcaaataaatcaaccttttgt----	CRISPR spacer
agagaatactaagataaatcaac----tgtgaca	Protospacer
********** *.**********    ***

174. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 6, identity: 0.8

agagaatactcaaataaatcaaccttttgt----	CRISPR spacer
agagaatactaagataaatcaac----tgtgaca	Protospacer
********** *.**********    ***

175. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 6, identity: 0.8

agagaatactcaaataaatcaaccttttgt----	CRISPR spacer
agagaatactaagataaatcaac----tgtgaca	Protospacer
********** *.**********    ***

176. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 6, identity: 0.8

agagaatactcaaataaatcaaccttttgt----	CRISPR spacer
agagaatactaagataaatcaac----tgtgaca	Protospacer
********** *.**********    ***

177. spacer 1.10|175152|28|NZ_CP027848|CRT matches to MG893203 (Vibrio phage VP06, complete genome) position: , mismatch: 7, identity: 0.75

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtccgagtctgaagacgtc	Protospacer
 *****************.***    *

178. spacer 1.10|175152|28|NZ_CP027848|CRT matches to MF754113 (Vibrio phage vB_VpaS_KF3, complete genome) position: , mismatch: 7, identity: 0.75

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtccgagtctgaagacgtc	Protospacer
 *****************.***    *

179. spacer 1.10|175152|28|NZ_CP027848|CRT matches to MF754114 (Vibrio phage vB_VpaS_KF4, complete genome) position: , mismatch: 7, identity: 0.75

cgagtcactgtccgagtccgaatcactg	CRISPR spacer
agagtcactgtccgagtctgaagacgtc	Protospacer
 *****************.***    *

180. spacer 1.31|176898|28|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
cgagtcggagtcggagtcgctgtccgaa	Protospacer
   .** *****.**************.

181. spacer 1.31|176898|28|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

gctatccgagtcagagtcgctgtccgag	CRISPR spacer
agagtcagagtcagagtcgctgtcagaa	Protospacer
.  .** ***************** **.

182. spacer 2.1|688674|30|NZ_CP027848|CRISPRCasFinder,CRT matches to MN689521 (Lactococcus phage CHPC836, complete genome) position: , mismatch: 7, identity: 0.767

aaaaaaattaaaagattactagacagtgat	CRISPR spacer
taaaaaaataaaagattacttgacaaaatt	Protospacer
 ****** ************ ****. . *

183. spacer 2.1|688674|30|NZ_CP027848|CRISPRCasFinder,CRT matches to MN693120 (Marine virus AFVG_25M98, complete genome) position: , mismatch: 7, identity: 0.767

aaaaaaattaaaagattactagacagtgat	CRISPR spacer
aaaaaaattaaaagatttcaagatgtggaa	Protospacer
***************** * ***..  **

184. spacer 2.6|689003|30|NZ_CP027848|CRISPRCasFinder,CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 7, identity: 0.767

ttccatttttggggcgaagccgggggtgca	CRISPR spacer
ggccacacctgcggcgaagccgggggtgca	Protospacer
  ***. ..** ******************

185. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to NC_017414 (Borreliella burgdorferi N40 plasmid N40_lp36, complete sequence) position: , mismatch: 8, identity: 0.733

agagaatactcaaataaatcaaccttttgt	CRISPR spacer
acgaaatactcaaaaaaatcaatctttaaa	Protospacer
* ..********** *******.**** .

186. spacer 3.3|756997|29|NZ_CP027848|PILER-CR matches to NC_017414 (Borreliella burgdorferi N40 plasmid N40_lp36, complete sequence) position: , mismatch: 8, identity: 0.724

gagaatactcaaataaatcaaccttttgt	CRISPR spacer
cgaaatactcaaaaaaatcaatctttaaa	Protospacer
 ..********** *******.**** .

187. spacer 3.3|756997|29|NZ_CP027848|PILER-CR matches to MF001361 (Enterococcus phage EF5, partial genome) position: , mismatch: 8, identity: 0.724

gagaatactcaaataaatcaaccttttgt	CRISPR spacer
ctgtttactcaaataaatcatcctttcta	Protospacer
  *  *************** *****.

188. spacer 3.3|756997|29|NZ_CP027848|PILER-CR matches to MF001358 (Enterococcus phage EF1, partial genome) position: , mismatch: 8, identity: 0.724

gagaatactcaaataaatcaaccttttgt	CRISPR spacer
ctgtttactcaaataaatcatcctttcta	Protospacer
  *  *************** *****.

189. spacer 1.1|174450|40|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtccgagtcagagtcgctgtcggagtctgagtcgctg	Protospacer
   ***   ******.********.**************.

190. spacer 1.1|174450|40|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtcagagtcagaatcgctgtccgagtcggagtcgctg	Protospacer
   ***.  *************** ***** ********.

191. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtctgaatcgcta	Protospacer
   ***   .*****.*****************.******

192. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtctgaatcgcta	Protospacer
   ***   .*****.*****************.******

193. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtctgaatcgcta	Protospacer
   ***   .*****.*****************.******

194. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtctgaatcgcta	Protospacer
   ***   .*****.*****************.******

195. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtctgaatcgcta	Protospacer
   ***   .*****.*****************.******

196. spacer 1.1|174450|40|NZ_CP027848|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.775

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtcagagtccgaatcgctgtcagagtcagagtcgctg	Protospacer
   ***.  *** ***************** ********.

197. spacer 1.9|175086|40|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.775

gctgtcagaatccgagtcgctatcgga------gtctgaatcactg	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcgctgtctgaa------	Protospacer
.**************.*****.*****      *******

198. spacer 1.9|175086|40|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.775

gctgtcagaatccgagtcgctatcgga------gtctgaatcactg	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcgctgtctgaa------	Protospacer
.**************.*****.*****      *******

199. spacer 1.9|175086|40|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.775

gctgtcagaatccgagtcgctatcgga------gtctgaatcactg	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcgctgtctgaa------	Protospacer
.**************.*****.*****      *******

200. spacer 1.24|176238|46|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.804

agaatcgctgtcagagtccgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtcggagtcactgtcggagtcgctgtcagag	Protospacer
 ***************** *****.************  .**.  *

201. spacer 1.30|176820|52|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.827

gctgtcagaatccgagtcgctgtcagaatccgagtcagaatcgctgtcggca	CRISPR spacer
gctgtcagcatccgagtcgctgtcagaatccgagtcactgtcagagtcagaa	Protospacer
******** ****************************  .**.  ***.* *

202. spacer 2.4|688871|30|NZ_CP027848|CRISPRCasFinder,CRT matches to NZ_CP017904 (Vibrio alginolyticus strain K05K4 plasmid pL289, complete sequence) position: , mismatch: 9, identity: 0.7

aaaaagaaaaaaaccgcttgggaaagacga	CRISPR spacer
taaacgaaaaaaaccgcttggtaagcggct	Protospacer
 *** **************** **. .

203. spacer 2.4|688871|30|NZ_CP027848|CRISPRCasFinder,CRT matches to NZ_CP017901 (Vibrio alginolyticus strain K04M5 plasmid pL294, complete sequence) position: , mismatch: 9, identity: 0.7

aaaaagaaaaaaaccgcttgggaaagacga	CRISPR spacer
taaacgaaaaaaaccgcttggtaagcggct	Protospacer
 *** **************** **. .

204. spacer 2.4|688871|30|NZ_CP027848|CRISPRCasFinder,CRT matches to NZ_CP017909 (Vibrio alginolyticus strain K06K5 plasmid pL291, complete sequence) position: , mismatch: 9, identity: 0.7

aaaaagaaaaaaaccgcttgggaaagacga	CRISPR spacer
taaacgaaaaaaaccgcttggtaagcggct	Protospacer
 *** **************** **. .

205. spacer 2.4|688871|30|NZ_CP027848|CRISPRCasFinder,CRT matches to NZ_CP017893 (Vibrio alginolyticus strain K04M1 plasmid pL280, complete sequence) position: , mismatch: 9, identity: 0.7

aaaaagaaaaaaaccgcttgggaaagacga	CRISPR spacer
taaacgaaaaaaaccgcttggtaagcggct	Protospacer
 *** **************** **. .

206. spacer 2.4|688871|30|NZ_CP027848|CRISPRCasFinder,CRT matches to NZ_CP017898 (Vibrio alginolyticus isolate K04M3 plasmid pL294, complete sequence) position: , mismatch: 9, identity: 0.7

aaaaagaaaaaaaccgcttgggaaagacga	CRISPR spacer
taaacgaaaaaaaccgcttggtaagcggct	Protospacer
 *** **************** **. .

207. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to MF001358 (Enterococcus phage EF1, partial genome) position: , mismatch: 9, identity: 0.7

agagaatactcaaataaatcaaccttttgt	CRISPR spacer
gctgtttactcaaataaatcatcctttcta	Protospacer
.  *  *************** *****.

208. spacer 3.1|756978|30|NZ_CP027848|CRISPRCasFinder matches to MF001361 (Enterococcus phage EF5, partial genome) position: , mismatch: 9, identity: 0.7

agagaatactcaaataaatcaaccttttgt	CRISPR spacer
gctgtttactcaaataaatcatcctttcta	Protospacer
.  *  *************** *****.

209. spacer 1.1|174450|40|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.75

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtccgaatccgaatcgctgtcagagtccgagtcgctg	Protospacer
   ***   .** *****************.********.

210. spacer 1.1|174450|40|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 10, identity: 0.75

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
actgtcagaatccgaatcgctgtcagagtccgagtcgctg	Protospacer
   ***.  .** *****************.********.

211. spacer 1.1|174450|40|NZ_CP027848|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 10, identity: 0.75

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
actgtcagaatccgaatcgctgtcagagtccgagtcgctg	Protospacer
   ***.  .** *****************.********.

212. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.75

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgagtcgctg	Protospacer
   ***   .*****.******** **************.

213. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 11, identity: 0.725

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctatctgaatctgaatcgctgtctgagtctgagtcgctg	Protospacer
   .**   .** *********** **************.

214. spacer 1.1|174450|40|NZ_CP027848|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.725

cgagtcgctgtcagaatcgctgtcagagtctgagtcgcta	CRISPR spacer
gctatctgaatctgaatcgctgtctgagtctgagtcgctg	Protospacer
   .**   .** *********** **************.

215. spacer 1.30|176820|52|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.788

gctgtcagaatccgagtcgctgtcagaatccgagtcagaatcgctgtcggca	CRISPR spacer
gctgtcagaatccgagtcgctgtccgaatcggagtcactgtccgaatcggag	Protospacer
************************ ***** ******  .**   .**** .

216. spacer 1.30|176820|52|NZ_CP027848|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.788

gctgtcagaatccgagtcgctgtcagaatccgagtcagaatcgctgtcggca	CRISPR spacer
gctgtcagagtccgagtcgctgtcggaatccgagtcactgtcagagtccgag	Protospacer
*********.**************.************  .**.  *** * .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

41184 : 49604

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095116068.1\|41184_41667_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-20	43.7
WP_095116069.1\|41653_42781_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_095116070.1\|42782_43484_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.7e-47	42.1
WP_095116072.1\|43487_43748_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_095116073.1\|43749_44421_+	phosphoribosylformylglycinamidine synthase I	NA	NA	NA	NA
WP_095116075.1\|44413_46603_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.2e-134	39.3
WP_095116076.1\|46581_48003_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.6e-49	32.8
WP_095116077.1\|48006_49035_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	6.9e-63	43.0
WP_095116079.1\|49037_49604_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.3e-26	36.8

DBSCAN-SWA_2

373224 : 384568

uncultured_Mediterranean_phage(57.14%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095116600.1\|373224_374223_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	9.8e-06	29.1
WP_095116602.1\|374235_375261_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_095116604.1\|375278_376418_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.3e-86	45.3
WP_095116606.1\|376433_376697_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	3.0e-07	45.7
WP_095116608.1\|376921_379201_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.4e-28	32.7
WP_095116610.1\|379300_381586_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.5e-73	31.2
WP_095116613.1\|381596_382115_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.6e-26	47.2
WP_095116615.1\|382378_384568_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	5.0e-10	35.8

DBSCAN-SWA_3

521520 : 531446

Bacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095116898.1\|521520_522408_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	5.2e-35	30.2
WP_095116900.1\|522468_522993_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_095116902.1\|523087_523822_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.8e-09	28.8
WP_095116904.1\|523805_524354_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.0e-09	46.4
WP_095116906.1\|524350_525091_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_095116908.1\|525315_526041_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-45	40.9
WP_095116910.1\|526024_527770_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.3e-34	33.9
WP_095116912.1\|528128_528680_+	ECF transporter S component	NA	NA	NA	NA
WP_044358884.1\|528778_529027_-	ferredoxin	A0A127AYY7	Bacillus_phage	2.3e-17	53.3
WP_159031404.1\|529258_530080_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_095116916.1\|530072_531446_+	ATP-dependent DNA helicase RecQ	A0A0G2Y8K9	Acanthamoeba_polyphaga_mimivirus	1.4e-55	33.8

DBSCAN-SWA_4

722631 : 729814

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095117228.1\|722631_723897_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	6.3e-34	69.2
WP_095117230.1\|723962_724274_-	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	1.4e-27	61.2
WP_095117232.1\|724287_726699_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	80.8
WP_095117234.1\|727009_728197_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	5.6e-149	68.3
WP_095117237.1\|728303_729257_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	8.9e-65	81.8
WP_095117239.1\|729253_729814_+	class I SAM-dependent methyltransferase	A0A2H4PQV0	Staphylococcus_phage	4.4e-56	57.3

DBSCAN-SWA_5

735277 : 758794

Staphylococcus_phage(85.71%)

integrase

attL 735492:735508|attR 760136:760152

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095117249.1\|735277_736261_+	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.1e-121	67.7
735492:735508	attL	NA	NA	NA	NA
WP_095117251.1\|736316_736778_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.5e-54	67.8
WP_095117253.1\|736793_737975_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	9.4e-149	64.9
WP_095117255.1\|738004_738634_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.2e-63	58.1
WP_095117257.1\|738638_739685_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	9.0e-111	53.6
WP_095117259.1\|740231_741719_-	FAD/NAD(P)-binding protein	A0A2H4PQX2	Staphylococcus_phage	4.3e-13	65.0
WP_095117261.1\|742136_743000_-	glucosaminidase domain-containing protein	A0A1W6JNR1	Staphylococcus_phage	2.4e-37	43.6
WP_095117264.1\|743201_743423_-	hypothetical protein	NA	NA	NA	NA
WP_157728695.1\|743619_744087_+	sigma-70 family RNA polymerase sigma factor	A0A2H4PQT5	Staphylococcus_phage	6.6e-21	37.4
WP_095117268.1\|744098_744539_+	hypothetical protein	NA	NA	NA	NA
WP_095117271.1\|744535_744985_-	hypothetical protein	NA	NA	NA	NA
WP_095117273.1\|745092_745803_-	transaldolase	M1PR54	Cyanophage	5.0e-20	36.0
WP_095117275.1\|745972_746275_+	hypothetical protein	NA	NA	NA	NA
WP_095117277.1\|746296_746662_+	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	1.1e-28	55.6
WP_095117279.1\|746658_747009_+	CrcB family protein	NA	NA	NA	NA
WP_095117281.1\|747054_747966_-	NERD domain-containing protein	A0A2H4PQQ8	Staphylococcus_phage	5.5e-80	71.6
WP_095117283.1\|748019_749222_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.0e-182	81.1
WP_095117286.1\|749698_751279_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	8.2e-241	75.6
WP_095117289.1\|751361_752132_-	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	1.5e-83	60.0
WP_095117291.1\|752112_752583_-	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	2.4e-39	51.9
WP_095117293.1\|752644_752881_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	3.7e-28	72.0
WP_095117294.1\|752871_753864_-	o-succinylbenzoate synthase	A0A2H4PQM0	Staphylococcus_phage	9.2e-89	48.6
WP_095117296.1\|753866_755270_-	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.9e-127	49.8
WP_095117298.1\|755662_756241_+	Ltp family lipoprotein	A0A097BY93	Leuconostoc_phage	8.8e-07	54.7
WP_095117300.1\|756511_756697_-	hypothetical protein	A0A1W6JPV9	Staphylococcus_phage	2.1e-10	60.0
WP_103289554.1\|757336_757516_-	hypothetical protein	NA	NA	NA	NA
WP_095117302.1\|757765_758119_+	DUF3969 family protein	NA	NA	NA	NA
WP_095118142.1\|758593_758794_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAG7	uncultured_Caudovirales_phage	2.1e-16	72.9
760136:760152	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1855671 : 1863735

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095115550.1\|1855671_1856721_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	8.1e-19	25.6
WP_095115552.1\|1856798_1857326_+	5'(3')-deoxyribonucleotidase	A0A285PXQ3	Cedratvirus	1.8e-06	30.6
WP_095115554.1\|1857442_1858954_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.1e-69	34.8
WP_095115556.1\|1859186_1859687_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	6.5e-51	69.3
WP_095115558.1\|1859707_1860592_-	DMT family transporter	NA	NA	NA	NA
WP_095115560.1\|1861268_1861667_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	1.9e-45	67.4
WP_095115562.1\|1861629_1863735_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A2H4J2N6	uncultured_Caudovirales_phage	0.0e+00	85.6

DBSCAN-SWA_7

1925667 : 1978718

Staphylococcus_phage(63.64%)

integrase,head,portal,capsid,protease,terminase,holin,tail,transposase

attL 1928905:1928932|attR 1979267:1979294

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095115669.1\|1925667_1928007_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.6e-86	36.8
WP_095115671.1\|1928023_1928488_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.6e-73	90.3
1928905:1928932	attL	NA	NA	NA	NA
WP_095115674.1\|1928985_1930035_-\|integrase	site-specific integrase	W5R968	Staphylococcus_phage	1.5e-158	79.1
WP_095115676.1\|1930155_1931298_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	1.4e-101	52.2
WP_095115679.1\|1931386_1931809_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.4e-49	66.4
WP_095115681.1\|1931895_1932330_-	hypothetical protein	NA	NA	NA	NA
WP_095115676.1\|1932674_1933817_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	1.4e-101	52.2
WP_095115679.1\|1933905_1934328_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.4e-49	66.4
WP_095115683.1\|1934345_1934867_-	Abi family protein	NA	NA	NA	NA
WP_095115679.1\|1935157_1935580_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.4e-49	66.4
WP_095115676.1\|1935668_1936811_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0P0ICY9	Lactobacillus_phage	1.4e-101	52.2
WP_095115685.1\|1936858_1937149_-	hypothetical protein	NA	NA	NA	NA
WP_095115687.1\|1937154_1937613_-	ImmA/IrrE family metallo-endopeptidase	A0A223LGM3	Staphylococcus_phage	1.3e-50	62.3
WP_095115689.1\|1937925_1938555_-	LexA family transcriptional regulator	A0A0N9SKN0	Staphylococcus_phage	9.3e-103	90.9
WP_095115691.1\|1938708_1938936_+	helix-turn-helix transcriptional regulator	Q4ZCB2	Staphylococcus_virus	5.1e-35	96.0
WP_095115693.1\|1938961_1939891_+	DUF3102 domain-containing protein	A0A2H4JAH5	uncultured_Caudovirales_phage	2.5e-80	69.4
WP_095115695.1\|1939883_1940456_+	hypothetical protein	A0A2H4J1Z3	uncultured_Caudovirales_phage	1.4e-25	47.4
WP_020219729.1\|1940467_1940701_+	hypothetical protein	A0A2H4JBS5	uncultured_Caudovirales_phage	1.1e-11	47.4
WP_095115697.1\|1940686_1941022_-	hypothetical protein	NA	NA	NA	NA
WP_095115699.1\|1941581_1942286_+	phage repressor protein	A0A223LHJ8	Staphylococcus_phage	2.8e-108	81.1
WP_095115701.1\|1942412_1942622_+	hypothetical protein	A0A2H4PQR1	Staphylococcus_phage	1.0e-18	62.3
WP_095115703.1\|1942637_1942817_+	hypothetical protein	NA	NA	NA	NA
WP_157728665.1\|1942892_1943045_+	hypothetical protein	NA	NA	NA	NA
WP_095115705.1\|1943037_1943523_+	siphovirus Gp157 family protein	A0A1W6JPS5	Staphylococcus_phage	3.7e-43	58.1
WP_095115707.1\|1943519_1944164_+	ERF family protein	D2JGK1	Staphylococcus_phage	2.3e-104	90.5
WP_095115709.1\|1944156_1944573_+	single-stranded DNA-binding protein	A0A1J0MFD7	Staphylococcus_phage	5.4e-51	72.4
WP_095115711.1\|1944584_1945253_+	hypothetical protein	A0A1J0MFX6	Staphylococcus_phage	5.0e-115	88.3
WP_095115713.1\|1945338_1945965_-	hypothetical protein	A0A2H4J7C1	uncultured_Caudovirales_phage	6.1e-30	36.7
WP_095115715.1\|1946027_1946741_+	helix-turn-helix domain-containing protein	Q4ZC19	Staphylococcus_virus	4.6e-74	63.0
WP_095115717.1\|1946745_1947093_+	hypothetical protein	Q4ZC18	Staphylococcus_virus	1.6e-48	83.5
WP_095115718.1\|1947085_1948324_+	AAA family ATPase	Q4ZC17	Staphylococcus_virus	2.8e-188	81.3
WP_095115719.1\|1948320_1948539_+	hypothetical protein	A0A1J0MFB5	Staphylococcus_phage	2.2e-19	65.3
WP_095115721.1\|1948525_1948951_+	RusA family crossover junction endodeoxyribonuclease	A0A1J0MFP7	Staphylococcus_phage	9.8e-56	74.8
WP_095115723.1\|1948952_1949633_+	hypothetical protein	NA	NA	NA	NA
WP_095115725.1\|1949640_1950054_+	DUF3310 domain-containing protein	A0A1J0MFM3	Staphylococcus_phage	2.9e-28	56.6
WP_095115727.1\|1950043_1950262_+	hypothetical protein	NA	NA	NA	NA
WP_095115729.1\|1950258_1951656_+	DNA (cytosine-5-)-methyltransferase	A0A0D4DCJ3	Staphylococcus_phage	1.4e-188	70.6
WP_095115732.1\|1951648_1951855_+	hypothetical protein	A0A223LFJ6	Staphylococcus_phage	3.4e-14	67.3
WP_095115734.1\|1951851_1952466_+	nucleoside 2-deoxyribosyltransferase	A0A2R4P8N5	Staphylococcus_phage	3.2e-76	72.5
WP_095115736.1\|1953010_1953394_+	hypothetical protein	A0A2R3ZY10	Staphylococcus_phage	1.1e-53	81.1
WP_095115738.1\|1953397_1953883_+	hypothetical protein	NA	NA	NA	NA
WP_095115740.1\|1953869_1954235_+	hypothetical protein	NA	NA	NA	NA
WP_095115742.1\|1954263_1954674_+	hypothetical protein	A0A0U1ZWJ6	Staphylococcus_phage	2.4e-14	45.7
WP_095115744.1\|1954657_1954876_+	hypothetical protein	Q4ZC08	Staphylococcus_virus	6.4e-11	50.0
WP_095115746.1\|1954872_1955397_+	dUTP pyrophosphatase	A0A1J0MG68	Staphylococcus_phage	1.1e-67	78.2
WP_095115748.1\|1955386_1955752_+	hypothetical protein	NA	NA	NA	NA
WP_095115752.1\|1956080_1956260_+	hypothetical protein	NA	NA	NA	NA
WP_095115754.1\|1956275_1956701_+	transcriptional regulator	A0A1J0MFW0	Staphylococcus_phage	4.1e-62	85.8
WP_095115756.1\|1956884_1957205_+	HNH endonuclease	A0A2I6PDC4	Staphylococcus_phage	2.0e-37	68.9
WP_095115758.1\|1957322_1957628_+\|terminase	P27 family phage terminase small subunit	A0A2I6PEQ6	Staphylococcus_phage	1.2e-42	84.2
WP_095115760.1\|1957617_1959309_+\|terminase	terminase large subunit	A0A2K9VBQ1	Staphylococcus_phage	1.1e-280	82.4
WP_095115762.1\|1959316_1960576_+\|portal	phage portal protein	A0A2I6PER5	Staphylococcus_phage	1.2e-189	78.1
WP_095115764.1\|1960532_1961306_+\|protease	Clp protease ClpP	M1TAZ4	Staphylococcus_phage	8.5e-98	70.8
WP_095115766.1\|1961318_1962470_+\|capsid	phage major capsid protein	A0A2I6PDD7	Staphylococcus_phage	1.2e-185	85.5
WP_095115768.1\|1962566_1962845_+\|head,tail	phage gp6-like head-tail connector protein	R4WAL3	Staphylococcus_phage	1.1e-23	56.5
WP_095115770.1\|1962857_1963196_+	hypothetical protein	NA	NA	NA	NA
WP_095118110.1\|1963192_1963615_+	hypothetical protein	A0A2H4JBU3	uncultured_Caudovirales_phage	3.7e-39	60.5
WP_095115772.1\|1963611_1964019_+	hypothetical protein	Q4ZD70	Staphylococcus_phage	1.4e-38	61.5
WP_095115773.1\|1964030_1964657_+\|tail	phage tail protein	Q4ZD69	Staphylococcus_phage	2.4e-95	84.5
WP_169712248.1\|1964736_1964910_+	hypothetical protein	Q4ZD68	Staphylococcus_phage	7.3e-10	62.3
WP_095115774.1\|1964915_1965278_+	hypothetical protein	A0A2H4J5B3	uncultured_Caudovirales_phage	1.2e-49	81.7
WP_169712249.1\|1965313_1965481_+	hypothetical protein	A0A2H4J5B6	uncultured_Caudovirales_phage	3.4e-12	61.8
WP_095115775.1\|1965528_1971435_+\|tail	phage tail tape measure protein	Q4ZD65	Staphylococcus_phage	8.3e-294	54.2
WP_095115776.1\|1971434_1972949_+\|tail	phage tail family protein	A0A1Q1PW27	Staphylococcus_phage	2.9e-158	54.8
WP_095115778.1\|1972964_1976711_+\|tail	phage tail protein	A0A1Q1PW30	Staphylococcus_phage	2.5e-235	39.1
WP_157728667.1\|1976700_1976856_+	hypothetical protein	NA	NA	NA	NA
WP_095115780.1\|1976893_1977199_+	hypothetical protein	A0A1J0MFP4	Staphylococcus_phage	6.0e-23	60.9
WP_095115782.1\|1977198_1977690_+\|holin	phage holin family protein	H9A0W5	Staphylococcus_phage	1.8e-48	61.9
WP_169712250.1\|1977732_1977885_+	hypothetical protein	NA	NA	NA	NA
WP_095115784.1\|1977869_1978718_+	SH3 domain-containing protein	M1PRV7	Streptococcus_phage	1.7e-51	43.2
1979267:1979294	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP027848.1|WP_095115713.1|1945338_1945965_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP027848.1|WP_095115713.1|1945338_1945965_-|hypothetical-protein

1945338_1945965_-

208 aa aa

1925667-1978718

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP027848_3	Orphan	3.2\|757044\|30\|NZ_CP027848\|CRISPRCasFinder	757044-757073	30	1955035-1955064	1
NZ_CP027848_3	Orphan	3.4\|757066\|26\|NZ_CP027848\|PILER-CR	757066-757091	26	1955039-1955064	1

1. spacer 3.2|757044|30|NZ_CP027848|CRISPRCasFinder matches to NZ_CP027848 position: 1955035-1955064, mismatch: 1

aaaggctatgtaggactactgacatcaaga	CRISPR spacer
aaaggctatgtaggactactaacatcaaga	Protospacer
********************.*********

2. spacer 3.4|757066|26|NZ_CP027848|PILER-CR matches to NZ_CP027848 position: 1955039-1955064, mismatch: 1

gctatgtaggactactgacatcaaga	CRISPR spacer
gctatgtaggactactaacatcaaga	Protospacer
****************.*********

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP027848

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information