CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP027519	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence	0 crisprs	NA	0	2
NZ_CP027517	Enterococcus faecium strain AUSMDU00004024 chromosome, complete genome	1 crisprs	cas3,DEDDh,cas2,RT,DinG,csa3,cas14j	0	11
NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	1 crisprs	RT,DEDDh,cas14j	2	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14419

Streptococcus_phage(83.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326827.1\|0_897_+	ParA family protein	A0A1X9I765	Streptococcus_phage	1.1e-152	97.9
WP_001835296.1\|988_1204_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_002326825.1\|1221_1494_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
WP_002332783.1\|1495_2359_+	toxin zeta	NA	NA	NA	NA
WP_011799058.1\|3130_3817_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-126	99.1
WP_000205227.1\|4205_4430_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000233000.1\|4444_5314_+	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
WP_000662263.1\|5294_6029_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_001255866.1\|6061_6970_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_002354485.1\|7535_8222_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002349227.1\|8424_8637_+	hypothetical protein	NA	NA	NA	NA
WP_000357244.1\|8798_9317_+	YfbU family protein	NA	NA	NA	NA
WP_000774078.1\|9323_9836_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|9939_11235_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_002288897.1\|11628_12252_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-13	30.1
WP_002354485.1\|12341_13028_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000599739.1\|13225_13831_+	cell filamentation protein	NA	NA	NA	NA
WP_000170424.1\|13846_14419_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0

DBSCAN-SWA_2

24472 : 32518

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|24472_25159_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002323245.1\|25779_26952_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_001280781.1\|27103_27799_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_002305818.1\|27776_28931_+	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_001059542.1\|29145_30114_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_001079845.1\|30106_31138_+	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
WP_000402347.1\|31143_31752_+	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
WP_002354485.1\|31831_32518_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP027517

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027517_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027517_1

2415712-2415821

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027517_1

>merge|NZ_CP027517|1|2415712-2415821|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP027517|1|1|2415712-2415821|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027517.1\|WP_002294585.1\|2417606_2418275_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP027517.1\|WP_002291634.1\|2415135_2415639_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP027517.1\|WP_002294587.1\|2416048_2416738_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP027517.1\|WP_002294577.1\|2422560_2423205_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP027517.1\|WP_002287787.1\|2409977_2410679_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP027517.1\|WP_002294579.1\|2422052_2422223_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP027517.1\|WP_002294584.1\|2418287_2419160_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP027517.1\|WP_002294589.1\|2413919_2414609_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP027517.1\|WP_002303471.1\|2412635_2413838_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP027517.1\|WP_002294588.1\|2414714_2415083_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP027517.1\|WP_002294578.1\|2422246_2422399_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP027517.1\|WP_002287788.1\|2409010_2409724_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP027517.1\|WP_002294581.1\|2420442_2421330_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP027517.1\|WP_002294580.1\|2421406_2421952_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP027517.1\|WP_002303469.1\|2404299_2406459_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP027517.1\|WP_002291638.1\|2416841_2417264_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP027517.1\|WP_002290558.1\|2410912_2412445_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP027517.1\|WP_002287792.1\|2406508_2407474_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP027517.1\|WP_002294583.1\|2419250_2420270_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP027517.1\|WP_002294593.1\|2407562_2408702_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701

Protein	Function_ID	Function_description	E-value
NZ_CP027517.1\|WP_002294585.1\|2417606_2418275_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP027517.1\|WP_002291634.1\|2415135_2415639_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP027517.1\|WP_002294587.1\|2416048_2416738_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP027517.1\|WP_002294577.1\|2422560_2423205_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP027517.1\|WP_002287787.1\|2409977_2410679_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP027517.1\|WP_002294579.1\|2422052_2422223_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP027517.1\|WP_002294584.1\|2418287_2419160_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP027517.1\|WP_002294589.1\|2413919_2414609_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
NZ_CP027517.1\|WP_002303471.1\|2412635_2413838_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
NZ_CP027517.1\|WP_002294588.1\|2414714_2415083_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP027517.1\|WP_002294578.1\|2422246_2422399_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP027517.1\|WP_002287788.1\|2409010_2409724_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP027517.1\|WP_002294581.1\|2420442_2421330_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP027517.1\|WP_002294580.1\|2421406_2421952_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP027517.1\|WP_002303469.1\|2404299_2406459_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP027517.1\|WP_002291638.1\|2416841_2417264_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP027517.1\|WP_002290558.1\|2410912_2412445_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP027517.1\|WP_002287792.1\|2406508_2407474_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP027517.1\|WP_002294583.1\|2419250_2420270_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP027517.1\|WP_002294593.1\|2407562_2408702_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61

>NZ_CP027517.1|WP_002291634.1|2415135_2415639_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP027517.1|WP_002294588.1|2414714_2415083_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP027517.1|WP_002294589.1|2413919_2414609_-|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP027517.1|WP_002303471.1|2412635_2413838_-|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>NZ_CP027517.1|WP_002290558.1|2410912_2412445_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP027517.1|WP_002287787.1|2409977_2410679_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP027517.1|WP_002287788.1|2409010_2409724_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP027517.1|WP_002294593.1|2407562_2408702_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP027517.1|WP_002287792.1|2406508_2407474_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP027517.1|WP_002303469.1|2404299_2406459_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFLSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYAMAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>NZ_CP027517.1|WP_002294587.1|2416048_2416738_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP027517.1|WP_002291638.1|2416841_2417264_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP027517.1|WP_002294585.1|2417606_2418275_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP027517.1|WP_002294584.1|2418287_2419160_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP027517.1|WP_002294583.1|2419250_2420270_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP027517.1|WP_002294581.1|2420442_2421330_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP027517.1|WP_002294580.1|2421406_2421952_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP027517.1|WP_002294579.1|2422052_2422223_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP027517.1|WP_002294578.1|2422246_2422399_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP027517.1|WP_002294577.1|2422560_2423205_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

534012 : 600975

Streptococcus_phage(15.38%)

integrase,tRNA,transposase,protease

attL 529565:529584|attR 607824:607843

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
529565:529584	attL	NA	NA	NA	NA
WP_002286726.1\|534012_535134_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_002286721.1\|535379_536801_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_002286711.1\|536814_537933_+	aminotransferase	NA	NA	NA	NA
WP_002286708.1\|537992_539285_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_002326790.1\|539434_539995_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286704.1\|540123_540501_+	DUF1033 family protein	NA	NA	NA	NA
WP_002304230.1\|540433_542506_+	DNA topoisomerase III	NA	NA	NA	NA
WP_002289773.1\|542716_543664_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	5.0e-84	51.0
WP_002289775.1\|543909_544374_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-18	38.7
WP_002289776.1\|544435_545479_-	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_002291188.1\|545855_546821_-	TDT family transporter	NA	NA	NA	NA
WP_002297022.1\|547054_547900_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002291183.1\|548090_549278_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_002295166.1\|549283_549640_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.7e-22	42.3
WP_002291179.1\|549641_549980_+	glycine cleavage system protein H	NA	NA	NA	NA
WP_002304234.1\|550374_551409_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.2e-28	35.1
WP_002287674.1\|551401_552088_+	ABC transporter permease	NA	NA	NA	NA
WP_002287678.1\|552111_552960_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002287679.1\|553156_553930_+	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	2.1e-08	28.8
WP_002287681.1\|553942_555229_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_002287683.1\|555225_556461_+	cysteine desulfurase	Q2XUY6	environmental_halophage	3.9e-113	47.7
WP_002287684.1\|556447_556918_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_002287686.1\|556922_558314_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_002297218.1\|558429_559725_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002287705.1\|559930_561073_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.3e-58	34.8
WP_002287709.1\|561111_561846_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287723.1\|562077_562353_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_048946547.1\|562450_564448_+	hypothetical protein	A0A1Z1LZK7	Bacillus_phage	5.5e-24	24.4
WP_002301912.1\|564523_564859_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_048946548.1\|565237_565600_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_048946549.1\|565645_565972_+	hypothetical protein	NA	NA	NA	NA
WP_002298390.1\|566814_568638_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002298389.1\|568651_570061_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	3.2e-42	27.6
WP_002298387.1\|570078_570915_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002317770.1\|570979_571762_+	hypothetical protein	NA	NA	NA	NA
WP_094850654.1\|572165_573291_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-75	54.1
WP_002297848.1\|574643_574844_+	sensor histidine kinase	NA	NA	NA	NA
WP_002297850.1\|574919_575117_+	hypothetical protein	NA	NA	NA	NA
WP_002297851.1\|575413_576961_-	2',3'-cyclic-nucleotide 2'-phosphodiesterase	S4VPC4	Pandoravirus	4.6e-10	25.7
WP_002297853.1\|577044_577848_-	metallophosphoesterase	NA	NA	NA	NA
WP_002297855.1\|577850_578633_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_002297856.1\|578629_579409_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_002297857.1\|579380_580172_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-21	39.4
WP_002297858.1\|580232_581162_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297859.1\|581356_582040_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_002340328.1\|582200_583244_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002340332.1\|585183_586362_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002295743.1\|586582_587491_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002321318.1\|587619_588219_+	DUF1819 family protein	NA	NA	NA	NA
WP_002321317.1\|588218_588794_+	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_002344971.1\|588818_592490_+	BREX system P-loop protein BrxC	NA	NA	NA	NA
WP_002340336.1\|592553_596186_+	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
WP_002321314.1\|596301_598824_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_002321313.1\|598941_600975_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
607824:607843	attR	NA	NA	NA	NA

DBSCAN-SWA_2

804919 : 906363

110

uncultured_Caudovirales_phage(14.29%)

tRNA,transposase,terminase,portal,capsid,head,plate,holin,protease,integrase,tail

attL 855874:855892|attR 891839:891857

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|804919_807718_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|807766_809293_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|809307_809955_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|810138_810468_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|810644_811373_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|811388_812402_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|812401_813679_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_074400891.1\|813741_816444_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|816595_816913_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|816942_817263_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002371581.1\|817370_818831_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|818898_819120_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|819150_819333_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|819332_819746_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|819868_821050_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286587.1\|821580_822720_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|823018_823654_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|823766_824402_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|824790_826110_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_106913968.1\|826260_826581_-	DUF4429 domain-containing protein	NA	NA	NA	NA
WP_002296613.1\|826710_827142_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|827159_827480_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|827778_828555_+	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|828569_828773_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|828788_829127_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296610.1\|829113_829293_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|829335_829806_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|829892_830591_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|830768_831110_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|831102_831774_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_058825536.1\|831779_832472_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286552.1\|832468_833218_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002304429.1\|833229_833499_+	hypothetical protein	NA	NA	NA	NA
WP_002303016.1\|833661_833961_+	hypothetical protein	NA	NA	NA	NA
WP_002303017.1\|833960_834263_+	hypothetical protein	D2IZY1	Enterococcus_phage	2.8e-33	70.7
WP_002303018.1\|834302_834668_+	hypothetical protein	NA	NA	NA	NA
WP_002369144.1\|835294_835477_+	hypothetical protein	NA	NA	NA	NA
WP_002347162.1\|835489_835684_+	hypothetical protein	NA	NA	NA	NA
WP_002303022.1\|835716_835929_-	hypothetical protein	NA	NA	NA	NA
WP_002304431.1\|836053_836257_+	hypothetical protein	NA	NA	NA	NA
WP_002303024.1\|836253_836526_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.5e-20	61.6
WP_002303025.1\|836526_836712_+	hypothetical protein	NA	NA	NA	NA
WP_123838300.1\|836698_837046_+	hypothetical protein	NA	NA	NA	NA
WP_002303026.1\|837005_837482_+	DUF1492 domain-containing protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.2e-27	50.8
WP_002349221.1\|837627_838356_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	1.2e-58	52.4
WP_002303029.1\|838403_838682_+	hypothetical protein	NA	NA	NA	NA
WP_002303030.1\|838683_839070_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	1.9e-10	36.7
WP_002304435.1\|839066_839447_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	4.7e-41	64.0
WP_002303032.1\|839558_840011_+	hypothetical protein	A0A2H4JFK0	uncultured_Caudovirales_phage	6.8e-47	66.2
WP_002303033.1\|840007_841735_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	6.9e-265	73.3
WP_002303034.1\|841756_842986_+\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	1.7e-145	65.0
WP_002349220.1\|842951_843527_+\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	3.6e-69	71.7
WP_002303037.1\|843539_844904_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	2.2e-125	69.1
WP_002303039.1\|844905_845187_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	4.7e-22	62.7
WP_002303041.1\|845164_845491_+\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	2.9e-23	53.4
WP_002303043.1\|845480_845819_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	9.6e-22	45.9
WP_002303045.1\|845808_846174_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002303047.1\|846180_846807_+\|tail	tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	5.7e-28	34.5
WP_002303049.1\|846806_847271_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.4e-15	38.9
WP_002303051.1\|847465_849775_+\|tail	phage tail tape measure protein	Q8W5Z7	Listeria_phage	5.5e-84	50.1
WP_002349218.1\|849786_850491_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002347164.1\|850487_853247_+	CHAP domain-containing protein	D7RWE0	Brochothrix_phage	1.6e-50	55.7
WP_002332773.1\|853259_854168_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
WP_002303523.1\|854167_854785_+	hypothetical protein	NA	NA	NA	NA
WP_002301867.1\|854788_855238_+	hypothetical protein	NA	NA	NA	NA
WP_002305897.1\|855237_855732_+	hypothetical protein	NA	NA	NA	NA
WP_002347165.1\|855745_856177_+	hypothetical protein	NA	NA	NA	NA
855874:855892	attL	NA	NA	NA	NA
WP_002303475.1\|856178_856316_+	XkdX family protein	NA	NA	NA	NA
WP_002303476.1\|856352_856646_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|856642_856867_+\|holin	holin	NA	NA	NA	NA
WP_002303477.1\|856863_857883_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
WP_002302747.1\|858659_858959_-	hypothetical protein	NA	NA	NA	NA
WP_002302745.1\|858964_859195_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|859444_859645_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002296840.1\|859961_861149_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002286469.1\|861423_862656_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|862910_863480_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286465.1\|863657_864098_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|864255_865020_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|865051_865975_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|866050_867190_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|867182_867983_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|867982_868810_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|868787_869522_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|869621_870488_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|870501_871074_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002294532.1\|871095_872124_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286428.1\|872221_873073_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002302719.1\|873106_875140_+	hypothetical protein	NA	NA	NA	NA
WP_042957143.1\|875183_876464_+	EpaQ family protein	NA	NA	NA	NA
WP_002289081.1\|876673_877480_+	ABC transporter permease	NA	NA	NA	NA
WP_002289079.1\|877491_878712_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
WP_002289078.1\|878701_880288_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002289076.1\|880326_882465_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002289074.1\|882832_883816_-	serine hydrolase	NA	NA	NA	NA
WP_002289073.1\|884193_885585_+	sugar transferase	NA	NA	NA	NA
WP_002289071.1\|885600_886641_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-07	35.3
WP_002289069.1\|886659_887745_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_002302730.1\|890158_891229_+	hypothetical protein	NA	NA	NA	NA
WP_002289359.1\|892648_893656_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.2e-40	35.9
891839:891857	attR	NA	NA	NA	NA
WP_002292874.1\|893667_894672_+	N-acetylneuraminate synthase	NA	NA	NA	NA
WP_002289362.1\|894668_895817_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
WP_002289363.1\|895789_896467_+	acetyltransferase	NA	NA	NA	NA
WP_002326811.1\|896456_897599_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L0G1	Tupanvirus	2.4e-24	27.9
WP_002289366.1\|897611_898589_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002289368.1\|898588_899497_+	dehydrogenase	NA	NA	NA	NA
WP_002289370.1\|899497_900250_+	acylneuraminate cytidylyltransferase family protein	NA	NA	NA	NA
WP_002289372.1\|900254_901202_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.8e-50	37.7
WP_000222572.1\|903158_904112_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_000997695.1\|905184_906363_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1176258 : 1185319

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288023.1\|1176258_1177554_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002297115.1\|1177733_1178111_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1178366_1179095_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1179094_1179349_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1179350_1180022_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1180022_1182245_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1182229_1183669_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002321731.1\|1183700_1184744_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1184740_1185319_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_4

1453331 : 1506231

Streptococcus_phage(28.57%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|1453331_1454627_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002303262.1\|1455077_1455320_-	DUF3781 domain-containing protein	NA	NA	NA	NA
WP_002303421.1\|1455865_1456396_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002303420.1\|1456577_1457234_-	hypothetical protein	NA	NA	NA	NA
WP_002303419.1\|1457360_1457834_-	trimethoprim-resistant dihydrofolate reductase DfrF	F8SJN4	Pseudomonas_phage	3.0e-21	45.1
WP_002296683.1\|1458501_1459716_-	ammonium transporter	NA	NA	NA	NA
WP_002290686.1\|1460056_1460299_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002295944.1\|1460330_1460888_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002295945.1\|1460900_1461089_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002295947.1\|1461101_1461668_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002295138.1\|1462897_1463371_+	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_002295139.1\|1463379_1463607_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002295142.1\|1465798_1466170_+	hypothetical protein	NA	NA	NA	NA
WP_002291278.1\|1466425_1466668_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002296679.1\|1466699_1467602_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002291274.1\|1467614_1467803_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002296677.1\|1467816_1468380_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002300977.1\|1468417_1469311_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.2e-59	46.0
WP_002296674.1\|1469388_1470327_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002296672.1\|1470360_1470711_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002296671.1\|1470743_1471646_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002296670.1\|1471638_1472496_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
WP_002296669.1\|1472829_1473639_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002296667.1\|1473678_1474176_+	cysteine hydrolase	NA	NA	NA	NA
WP_002321681.1\|1474820_1475144_+	hypothetical protein	NA	NA	NA	NA
WP_002296665.1\|1475307_1475562_+	hypothetical protein	NA	NA	NA	NA
WP_002296663.1\|1475631_1475877_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296662.1\|1475952_1476318_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1477592_1478888_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002302440.1\|1479126_1480428_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002293303.1\|1480531_1480732_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3
WP_002296656.1\|1481483_1482197_-	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
WP_002296654.1\|1482189_1483275_-	mannonate dehydratase	NA	NA	NA	NA
WP_002296653.1\|1483291_1483735_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002321678.1\|1483768_1484122_-	hypothetical protein	NA	NA	NA	NA
WP_002296650.1\|1484233_1484635_-	hypothetical protein	NA	NA	NA	NA
WP_002296648.1\|1484671_1485181_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002303107.1\|1485202_1486060_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002330536.1\|1486469_1487720_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.0e-113	63.3
WP_002296646.1\|1487860_1488694_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002303106.1\|1488707_1489505_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002321677.1\|1489537_1489822_-	alcohol dehydrogenase	NA	NA	NA	NA
WP_002296641.1\|1489818_1490820_-	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
WP_002296640.1\|1490821_1491724_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.3e-53	35.3
WP_002296639.1\|1491886_1492735_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002296638.1\|1493379_1493586_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296637.1\|1493787_1494789_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002311095.1\|1494793_1496707_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_002296634.1\|1496874_1497381_-	cysteine hydrolase	NA	NA	NA	NA
WP_002296633.1\|1497540_1497981_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002296632.1\|1498006_1499164_-	hypothetical protein	NA	NA	NA	NA
WP_002296631.1\|1499166_1499523_-	hypothetical protein	NA	NA	NA	NA
WP_002296629.1\|1499820_1500795_-	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_002296628.1\|1500990_1501830_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|1502014_1502902_+	rotamase	NA	NA	NA	NA
WP_002311093.1\|1503494_1504190_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|1504173_1504572_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002287107.1\|1504980_1506231_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_5

1514081 : 1537531

Streptococcus_phage(40.0%)

integrase,transposase

attL 1509271:1509286|attR 1518992:1519007

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1509271:1509286	attL	NA	NA	NA	NA
WP_000997695.1\|1514081_1515260_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_000222572.1\|1515415_1516369_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002288357.1\|1516425_1517553_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_010729348.1\|1517770_1518913_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.5e-39	32.4
WP_010729347.1\|1518917_1519103_-	DUF3173 domain-containing protein	NA	NA	NA	NA
1518992:1519007	attR	NA	NA	NA	NA
WP_002353648.1\|1519456_1519702_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010729346.1\|1519695_1520097_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_106913972.1\|1520242_1522090_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	2.4e-154	48.4
WP_010729344.1\|1522112_1523879_-	hypothetical protein	NA	NA	NA	NA
WP_010729343.1\|1523891_1524686_-	HAD family hydrolase	NA	NA	NA	NA
WP_010729341.1\|1526190_1526838_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_010729340.1\|1526921_1528349_-	glucuronate isomerase	NA	NA	NA	NA
WP_010729339.1\|1528422_1529502_-	mannonate dehydratase	NA	NA	NA	NA
WP_010729338.1\|1529504_1531136_-	mannitol dehydrogenase family protein	NA	NA	NA	NA
WP_010729337.1\|1531438_1532110_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010729336.1\|1532828_1532999_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|1533122_1534442_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_010729334.1\|1534950_1535403_-	hypothetical protein	NA	NA	NA	NA
WP_010729333.1\|1535409_1535958_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|1536211_1537531_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7

DBSCAN-SWA_6

1680517 : 1689677

Streptococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002341493.1\|1680517_1680724_-	excisionase	A0A1S5SF07	Streptococcus_phage	1.1e-25	87.3
WP_010729705.1\|1680716_1681859_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.5e-63	35.4
WP_153274509.1\|1682075_1682228_+	hypothetical protein	NA	NA	NA	NA
WP_008788621.1\|1682370_1683006_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_012386611.1\|1683511_1683598_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000691736.1\|1683613_1685533_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_011058338.1\|1685633_1685819_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_001227347.1\|1685878_1686232_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_013670292.1\|1686436_1686508_+	hypothetical protein	NA	NA	NA	NA
WP_022278534.1\|1686735_1687155_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_025481129.1\|1687180_1687387_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158003447.1\|1687763_1688429_+	sugar diacid utilization regulator	NA	NA	NA	NA
WP_002289374.1\|1688510_1689677_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.9e-24	25.7

DBSCAN-SWA_7

1720433 : 1773250

Streptococcus_phage(14.29%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294137.1\|1720433_1722143_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002294136.1\|1722210_1723479_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294135.1\|1723639_1724440_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|1724436_1725249_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002297404.1\|1725657_1726908_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002293875.1\|1727224_1727782_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|1727784_1728507_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|1728642_1729524_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|1729622_1730405_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|1730763_1731243_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326698.1\|1731459_1732551_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002326699.1\|1732543_1732672_+	hypothetical protein	NA	NA	NA	NA
WP_002288430.1\|1732675_1733221_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002288432.1\|1733674_1735366_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288434.1\|1735785_1736733_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|1736847_1737867_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|1737957_1739187_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|1739647_1740349_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002301319.1\|1740957_1741974_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288445.1\|1741970_1742435_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288446.1\|1742441_1742984_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|1742967_1743792_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|1743880_1744861_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|1744884_1746369_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|1746380_1747370_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1747617_1747785_+	DUF3042 family protein	NA	NA	NA	NA
WP_010729586.1\|1747846_1749658_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1749654_1750020_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1750182_1750578_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1750595_1751558_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1751557_1751770_-	YqgQ family protein	NA	NA	NA	NA
WP_106913973.1\|1751790_1752489_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1752508_1753051_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002301321.1\|1753182_1754187_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1754183_1755173_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|1755169_1755976_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1756141_1757098_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1757174_1757693_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1757780_1757930_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1758157_1758604_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002305724.1\|1758798_1760694_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002303934.1\|1761018_1761993_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002296332.1\|1762558_1763125_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002296334.1\|1763379_1764711_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1764676_1765027_+	hypothetical protein	NA	NA	NA	NA
WP_002296337.1\|1765538_1765883_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002301399.1\|1766148_1767108_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287776.1\|1767297_1767894_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|1768017_1769817_+	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1770094_1770307_-	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|1771169_1772129_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002295743.1\|1772341_1773250_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1778240 : 1974693

192

Streptococcus_phage(23.68%)

tRNA,transposase,terminase,portal,capsid,plate,head,holin,protease,integrase,tail

attL 1772231:1772290|attR 1908747:1908787

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1772231:1772290	attL	NA	NA	NA	NA
WP_002288577.1\|1778240_1778726_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
1772231:1772290	attL	NA	NA	NA	NA
WP_002305727.1\|1778748_1779507_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|1779522_1780701_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002303943.1\|1780930_1783051_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002297185.1\|1783167_1784463_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002296838.1\|1784795_1785521_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1785510_1786020_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1786089_1787538_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288590.1\|1787537_1788254_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|1788234_1788585_-	SdpI family protein	NA	NA	NA	NA
WP_002288592.1\|1788728_1789502_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002302293.1\|1791779_1792082_+	hypothetical protein	NA	NA	NA	NA
WP_002323892.1\|1793225_1793540_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1793656_1794835_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|1795171_1795411_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1795772_1796033_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1796216_1796714_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1796843_1797554_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1797566_1799231_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|1799435_1800098_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|1800107_1800923_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1801184_1801628_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|1801761_1802100_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288986.1\|1802087_1802465_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002288985.1\|1802688_1803882_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|1804047_1804470_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002321037.1\|1804864_1805059_+	hypothetical protein	NA	NA	NA	NA
WP_002288983.1\|1805055_1805550_+	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|1805711_1806884_-	class C sortase	NA	NA	NA	NA
WP_002288981.1\|1807089_1807905_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288979.1\|1808054_1808501_-	cell wall anchor	NA	NA	NA	NA
WP_158003446.1\|1808497_1809502_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002352916.1\|1809541_1809871_-	hypothetical protein	NA	NA	NA	NA
WP_002305732.1\|1809996_1812324_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288970.1\|1813165_1813459_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002288969.1\|1813861_1815040_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
WP_002300928.1\|1815143_1815458_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288966.1\|1815564_1815780_+	hypothetical protein	NA	NA	NA	NA
WP_002288964.1\|1816079_1816322_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288962.1\|1816308_1816737_-	hypothetical protein	NA	NA	NA	NA
WP_002299190.1\|1816888_1818436_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002287659.1\|1818537_1818891_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|1818880_1819075_-	hypothetical protein	NA	NA	NA	NA
WP_086956687.1\|1819205_1820368_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002289210.1\|1820932_1821307_-	VOC family protein	NA	NA	NA	NA
WP_002296814.1\|1821329_1822730_-	beta-fructofuranosidase	NA	NA	NA	NA
WP_002289214.1\|1822733_1823144_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002289215.1\|1823161_1823653_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002289216.1\|1823662_1824454_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002289217.1\|1824446_1825220_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002289218.1\|1825375_1827910_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002289219.1\|1827991_1828864_-	ROK family protein	NA	NA	NA	NA
WP_002289220.1\|1828899_1829367_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289221.1\|1829376_1830846_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002296810.1\|1830916_1832335_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_002296809.1\|1832456_1833437_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002295743.1\|1833569_1834478_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_086956705.1\|1834764_1835927_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5
1834530:1835569	attR	NA	NA	NA	NA
WP_002305710.1\|1836019_1836529_-	MarR family transcriptional regulator	NA	NA	NA	NA
1834530:1835569	attR	NA	NA	NA	NA
WP_002302055.1\|1836867_1837821_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_077828749.1\|1837773_1838010_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002305709.1\|1838429_1839551_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_002321361.1\|1839878_1841288_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002289053.1\|1841284_1842013_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
WP_002289055.1\|1842140_1843052_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
WP_002289057.1\|1843068_1844076_-	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
WP_002305708.1\|1844072_1846202_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.8e-182	60.3
WP_002296840.1\|1846502_1847690_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002298631.1\|1848734_1850561_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	3.7e-11	26.8
WP_002288938.1\|1852794_1853184_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
WP_002305705.1\|1853233_1854130_-	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
WP_002288935.1\|1854132_1855980_-	PHP domain-containing protein	NA	NA	NA	NA
WP_002288934.1\|1856076_1856577_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
WP_002298822.1\|1856589_1856811_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002305703.1\|1856815_1856953_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286934.1\|1856949_1858134_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
WP_002286933.1\|1858389_1858644_-	hypothetical protein	NA	NA	NA	NA
WP_002286932.1\|1858668_1859811_-	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
WP_002349191.1\|1859870_1861223_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.8e-162	64.4
WP_002305701.1\|1861293_1861647_-	DNA-damage-inducible protein J	NA	NA	NA	NA
WP_002286926.1\|1861647_1862022_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
WP_002286925.1\|1862034_1862349_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
WP_002305699.1\|1862462_1865690_-	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002286921.1\|1865768_1866431_-	hypothetical protein	NA	NA	NA	NA
WP_002353637.1\|1867047_1867278_+	hypothetical protein	NA	NA	NA	NA
WP_002318491.1\|1867283_1867583_+	hypothetical protein	NA	NA	NA	NA
WP_002302755.1\|1868576_1869785_-	hypothetical protein	NA	NA	NA	NA
WP_020944989.1\|1869899_1870916_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	9.8e-62	66.7
WP_002302122.1\|1870926_1871124_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
WP_002332427.1\|1871139_1871382_-\|holin	holin	D2J075	Enterococcus_phage	1.2e-21	63.3
WP_002332428.1\|1871416_1871554_-	XkdX family protein	NA	NA	NA	NA
WP_002332429.1\|1871555_1872002_-	hypothetical protein	NA	NA	NA	NA
WP_010729422.1\|1872164_1874225_-\|plate	BppU family phage baseplate upper protein	A0A249XZH9	Enterococcus_phage	1.7e-65	44.9
WP_002290629.1\|1874242_1875067_-	hypothetical protein	NA	NA	NA	NA
WP_002332431.1\|1875070_1876120_-	hypothetical protein	Q5K5I4	Oenococcus_phage	1.9e-31	27.9
WP_002350711.1\|1876116_1876989_-	hypothetical protein	NA	NA	NA	NA
WP_002350712.1\|1876989_1880838_-	tape measure protein	A0A0M5M3L4	Enterococcus_phage	0.0e+00	76.0
WP_002290636.1\|1880837_1881029_-	hypothetical protein	NA	NA	NA	NA
WP_002329391.1\|1881052_1881364_-	hypothetical protein	A0A0S2MY76	Enterococcus_phage	4.0e-14	44.8
WP_002332434.1\|1881488_1882049_-\|tail	phi13 family phage major tail protein	V5UQL2	Enterococcus_phage	3.4e-40	46.2
WP_002329393.1\|1882064_1882436_-	hypothetical protein	A0A060ANH4	Enterococcus_phage	2.5e-23	46.2
WP_002350714.1\|1882432_1882828_-	hypothetical protein	C0LZZ2	Enterococcus_phage	4.3e-21	44.5
WP_002342516.1\|1882824_1883160_-\|head	phage head closure protein	A0A249XUC8	Enterococcus_phage	2.2e-18	44.1
WP_002350715.1\|1883163_1883490_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002350716.1\|1883504_1884698_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.5e-114	55.4
WP_002350717.1\|1884694_1885372_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	4.9e-49	51.0
WP_002350718.1\|1885406_1886627_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	1.2e-61	38.5
WP_010729418.1\|1888181_1888943_-	GIY-YIG nuclease family protein	A0A220BXN1	Staphylococcus_phage	7.9e-40	45.9
WP_010729417.1\|1889035_1889194_+	ribbon-helix-helix domain-containing protein	A0A0A7RUX5	Clostridium_phage	5.3e-07	65.9
WP_002290653.1\|1889660_1890182_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.1e-16	34.2
WP_002350721.1\|1890283_1890448_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.6e-14	69.8
WP_016922443.1\|1890604_1890922_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	2.0e-13	39.8
WP_016922444.1\|1890922_1891468_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002304479.1\|1892663_1893077_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-56	81.0
WP_012197617.1\|1893563_1893851_-	hypothetical protein	NA	NA	NA	NA
WP_020944994.1\|1893980_1894250_-	hypothetical protein	NA	NA	NA	NA
WP_012197625.1\|1894246_1894777_-	DUF1642 domain-containing protein	A0A059T7S4	Listeria_phage	1.8e-11	37.2
WP_012197627.1\|1894769_1895084_-	hypothetical protein	D2IZY1	Enterococcus_phage	4.6e-34	72.7
WP_074394665.1\|1895083_1895389_-	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|1895385_1895547_-	antitoxin	NA	NA	NA	NA
WP_002350665.1\|1895543_1895861_-	VRR-NUC domain-containing protein	A0A1B0YA93	Lactobacillus_phage	3.6e-31	61.5
WP_012197635.1\|1896107_1898420_-	phage/plasmid primase P4 family domain-containing protein	R4IBW2	Listeria_phage	1.3e-250	55.9
WP_012197636.1\|1898434_1898935_-	DUF669 domain-containing protein	A8ATF2	Listeria_phage	1.1e-34	52.9
WP_002350668.1\|1898936_1899410_-	transcriptional regulator	A8ATW6	Listeria_phage	7.7e-09	43.9
WP_002350669.1\|1899400_1900750_-	DEAD/DEAH box helicase	A0A0P0ID30	Lactobacillus_phage	4.1e-132	53.4
WP_012197638.1\|1900724_1901411_-	AAA family ATPase	A0A1P8VVS4	Streptococcus_phage	1.1e-61	52.7
WP_002350671.1\|1901529_1901856_-	DUF5406 family protein	F0PIH7	Enterococcus_phage	1.6e-26	57.8
WP_044384563.1\|1901852_1902284_-	hypothetical protein	NA	NA	NA	NA
WP_002329420.1\|1902733_1903213_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	5.3e-34	49.0
WP_002350675.1\|1903145_1903463_-	hypothetical protein	NA	NA	NA	NA
WP_002332465.1\|1903630_1904089_+	hypothetical protein	NA	NA	NA	NA
WP_002325021.1\|1904391_1904640_-	hypothetical protein	NA	NA	NA	NA
WP_002315391.1\|1904652_1904838_-	helix-turn-helix transcriptional regulator	Q5YAA3	Bacillus_phage	8.4e-12	56.7
WP_002315392.1\|1905141_1905516_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7
WP_002350678.1\|1905520_1905949_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_012197642.1\|1905998_1906652_+	hypothetical protein	NA	NA	NA	NA
WP_002350679.1\|1906787_1907354_+	hypothetical protein	A0A0P0IXE0	Lactobacillus_phage	1.9e-06	92.3
WP_012197643.1\|1907469_1908606_+\|integrase	site-specific integrase	A0A1P8BMN3	Lactococcus_phage	8.4e-54	36.8
WP_002286913.1\|1908737_1909085_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293716.1\|1909970_1910492_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002297190.1\|1910661_1911453_-	hypothetical protein	NA	NA	NA	NA
WP_002290277.1\|1911577_1911829_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|1911840_1912116_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|1912368_1912923_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|1913001_1913523_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|1913526_1914105_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|1914216_1915635_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|1915655_1915994_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|1915953_1916457_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|1916587_1917292_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297195.1\|1917288_1919025_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002305697.1\|1919127_1921599_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.1e-45	29.2
WP_002289807.1\|1921923_1922814_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002305696.1\|1923010_1923493_-	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|1923700_1924066_+	hypothetical protein	NA	NA	NA	NA
WP_002322761.1\|1924266_1924584_-	hypothetical protein	NA	NA	NA	NA
WP_002287105.1\|1925311_1926286_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002297404.1\|1926695_1927946_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305694.1\|1928231_1928489_+	hypothetical protein	NA	NA	NA	NA
WP_042959742.1\|1930816_1931392_-	hypothetical protein	Q9MCC6	Lactobacillus_phage	4.8e-13	35.9
WP_094932120.1\|1931472_1932634_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.7e-79	51.3
WP_002294835.1\|1933008_1933578_-	prevent-host-death protein	NA	NA	NA	NA
WP_002323057.1\|1933651_1934941_-	hypothetical protein	NA	NA	NA	NA
WP_010721082.1\|1935294_1936143_+	MoxR family ATPase	NA	NA	NA	NA
WP_002323055.1\|1936156_1937230_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002305688.1\|1937219_1939391_+	transglutaminase	NA	NA	NA	NA
WP_059355943.1\|1939502_1941659_-	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	2.9e-71	32.3
WP_002349136.1\|1941801_1943988_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.4e-121	38.7
WP_002289040.1\|1943987_1944197_-	copper chaperone CopZ	NA	NA	NA	NA
WP_002294855.1\|1944209_1944650_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002349135.1\|1944723_1945197_-	hypothetical protein	A0A097BYE2	Leuconostoc_phage	1.1e-10	28.8
WP_002297185.1\|1945423_1946719_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288779.1\|1947028_1948495_-	amino acid permease	NA	NA	NA	NA
WP_002305684.1\|1948805_1950890_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.9e-117	35.7
WP_002288776.1\|1951413_1951773_-	YccF domain-containing protein	NA	NA	NA	NA
WP_002323072.1\|1951802_1952144_-	hypothetical protein	NA	NA	NA	NA
WP_002305683.1\|1952140_1952815_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002305681.1\|1953608_1954907_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002305679.1\|1954946_1956137_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002348809.1\|1956157_1956685_-	DUF5590 domain-containg protein	NA	NA	NA	NA
WP_002304681.1\|1956731_1959521_-	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
WP_002288762.1\|1959667_1959868_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002323868.1\|1960319_1960640_-	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|1960917_1962213_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288760.1\|1962664_1963783_-	hypothetical protein	NA	NA	NA	NA
WP_002304680.1\|1964253_1965561_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002340453.1\|1965679_1966879_+	YdcF family protein	NA	NA	NA	NA
WP_002291751.1\|1969389_1969893_-	HD domain-containing protein	NA	NA	NA	NA
WP_059355914.1\|1970015_1970780_-	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	1.7e-05	26.1
WP_002289551.1\|1970887_1971163_+	acylphosphatase	NA	NA	NA	NA
WP_002312284.1\|1972728_1972929_-	hypothetical protein	NA	NA	NA	NA
WP_010782560.1\|1973733_1974693_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2006636 : 2071825

Streptococcus_phage(31.25%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074398935.1\|2006636_2007977_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.9e-65	36.0
WP_002296623.1\|2008133_2009429_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002291695.1\|2009563_2010010_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.6e-19	38.8
WP_002287321.1\|2010036_2010213_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_002287322.1\|2010374_2010803_-	transcriptional repressor	NA	NA	NA	NA
WP_002348657.1\|2010894_2011755_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_002291691.1\|2011848_2012142_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002313517.1\|2012214_2013942_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.4e-209	62.9
WP_002291688.1\|2014154_2015081_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.3e-89	52.8
WP_010782557.1\|2015225_2016659_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_002305593.1\|2016658_2018062_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_002294948.1\|2018291_2019194_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_010782556.1\|2019234_2021121_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002348652.1\|2022404_2024189_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.1e-47	27.6
WP_002314690.1\|2024188_2025940_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.6e-56	30.4
WP_002291670.1\|2026081_2026306_-	YneF family protein	NA	NA	NA	NA
WP_002348650.1\|2026556_2028143_+	divalent metal cation transporter	NA	NA	NA	NA
WP_002348649.1\|2028208_2029984_-	hypothetical protein	NA	NA	NA	NA
WP_002308625.1\|2030194_2031097_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.5e-21	30.7
WP_025480886.1\|2031375_2033721_+	penicillin-binding protein	NA	NA	NA	NA
WP_000997695.1\|2033961_2035140_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002348961.1\|2035229_2035496_-	hypothetical protein	NA	NA	NA	NA
WP_002305582.1\|2035488_2035812_-	hypothetical protein	NA	NA	NA	NA
WP_059355912.1\|2035823_2037080_-	lipase	NA	NA	NA	NA
WP_010782554.1\|2037076_2037472_-	hypothetical protein	NA	NA	NA	NA
WP_002348958.1\|2037514_2037766_-	hypothetical protein	NA	NA	NA	NA
WP_002348957.1\|2037765_2038161_-	hypothetical protein	NA	NA	NA	NA
WP_002291653.1\|2038514_2039516_-	catabolite control protein A	NA	NA	NA	NA
WP_002313499.1\|2039725_2040829_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_002348956.1\|2040891_2041494_-	YtxH domain-containing protein	NA	NA	NA	NA
WP_002308608.1\|2041496_2041937_-	DUF948 domain-containing protein	NA	NA	NA	NA
WP_002308607.1\|2042061_2043000_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	5.5e-75	51.2
WP_002296128.1\|2043014_2044040_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_002289570.1\|2044083_2044914_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002289568.1\|2044928_2045867_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_002289566.1\|2046033_2046384_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_002322015.1\|2046383_2046701_-	PspC domain-containing protein	NA	NA	NA	NA
WP_002303617.1\|2047000_2048569_-	daptomycin-sensing surface protein LiaX	NA	NA	NA	NA
WP_002299434.1\|2048668_2049436_-	YibE/F family protein	NA	NA	NA	NA
WP_074398943.1\|2049432_2050473_-	YibE/F family protein	NA	NA	NA	NA
WP_002297218.1\|2050594_2051890_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002289490.1\|2052208_2052886_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_002289489.1\|2052898_2053657_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-19	31.3
WP_002303220.1\|2053672_2054479_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-13	28.4
WP_002294978.1\|2054493_2055378_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_002292761.1\|2055377_2056298_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_002292763.1\|2056412_2057270_-	phosphate ABC transporter substrate-binding protein PstS	NA	NA	NA	NA
WP_002300487.1\|2057606_2059055_-	cardiolipin synthase	NA	NA	NA	NA
WP_002305568.1\|2059206_2060100_-	ABC transporter permease	NA	NA	NA	NA
WP_002292768.1\|2060083_2060770_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.5e-29	34.7
WP_096157771.1\|2060874_2061976_-	peptide chain release factor 2	NA	NA	NA	NA
WP_002294984.1\|2062101_2064636_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_002294985.1\|2064857_2065409_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_002294986.1\|2065536_2066256_-	ComF family protein	NA	NA	NA	NA
WP_002303218.1\|2066252_2067566_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	1.8e-63	37.9
WP_002292778.1\|2067646_2067967_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002294988.1\|2068074_2068362_-	hypothetical protein	NA	NA	NA	NA
WP_002303217.1\|2068488_2069133_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.0e-49	50.2
WP_002292782.1\|2069191_2069899_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002297218.1\|2070529_2071825_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_10

2730075 : 2736589

Streptococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297356.1\|2730075_2730783_+	DNA methylase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
WP_002297354.1\|2730772_2731063_+	hypothetical protein	NA	NA	NA	NA
WP_002297353.1\|2731321_2732506_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002317225.1\|2732502_2732640_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|2733385_2735296_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033658092.1\|2735399_2735624_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002297350.1\|2735636_2736140_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_002297349.1\|2736199_2736589_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3

DBSCAN-SWA_11

2752053 : 2789146

Bacillus_phage(40.0%)

integrase,transposase

attL 2738829:2738844|attR 2793767:2793782

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2738829:2738844	attL	NA	NA	NA	NA
WP_002303350.1\|2752053_2753013_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_010729817.1\|2752999_2754331_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_059355941.1\|2754464_2760392_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_002332818.1\|2761009_2761444_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|2762584_2763763_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002303350.1\|2764072_2765032_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002297333.1\|2765771_2766158_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002311665.1\|2766955_2767288_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_077828743.1\|2767583_2767739_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002297326.1\|2769595_2771212_-	cobalamin biosynthesis protein	NA	NA	NA	NA
WP_002317220.1\|2771329_2771548_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297325.1\|2771742_2772204_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-12	35.0
WP_002304820.1\|2772396_2772636_-	hypothetical protein	NA	NA	NA	NA
WP_002297324.1\|2772659_2774183_-	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002322279.1\|2774200_2774323_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_002304819.1\|2774352_2775336_-	GTP-binding protein	NA	NA	NA	NA
WP_002297320.1\|2775359_2775509_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002297319.1\|2775529_2775907_-	hypothetical protein	NA	NA	NA	NA
WP_002297318.1\|2775938_2776118_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_002297316.1\|2776132_2776402_-	30S ribosomal protein S14	NA	NA	NA	NA
WP_010729277.1\|2776924_2778667_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.4e-30	29.1
WP_010729813.1\|2778650_2780405_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-24	24.8
WP_002302405.1\|2780514_2781084_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_002305512.1\|2781101_2782526_-	energy-coupling factor ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	5.9e-20	26.4
WP_074394433.1\|2783324_2783909_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002297302.1\|2784239_2784473_-	iron-dependent repressor	NA	NA	NA	NA
WP_010729812.1\|2784487_2785438_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010729271.1\|2785434_2786277_-	metal ABC transporter permease	NA	NA	NA	NA
WP_010729270.1\|2786278_2786998_-	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.6e-18	32.7
WP_074394656.1\|2787689_2787848_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010729268.1\|2787919_2789146_+\|integrase	site-specific integrase	NA	NA	NA	NA
2793767:2793782	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP027518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027518_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027518_1

430-557

Orphan

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP027518_1

>merge|NZ_CP027518|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP027518|1|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027518.1\|WP_002336710.1\|5628_6300_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP027518.1\|WP_025481135.1\|10206_12318_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|275067
NZ_CP027518.1\|WP_002297404.1\|3393_4644_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP027518.1\|WP_002295674.1\|2815_3157_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP027518.1\|WP_010729784.1\|6352_8329_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP027518.1\|WP_010729785.1\|8341_9097_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP027518.1\|WP_002323647.1\|1864_2197_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027518.1\|WP_002295673.1\|5053_5293_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027518.1\|WP_002295672.1\|5359_5569_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027518.1\|WP_002350398.1\|9093_9918_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP027518.1\|WP_025481135.1\|10206_12318_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|275067	TIGR04226, Fimbrial_subunit_type_2, fimbrial isopeptide formation D2 domain. The Streptococcus Pneumoniae pilus backbone protein, RrgB, has three tandem domains with Lys-to-Asn isopeptide bonds, but these three regions are extremely divergent in sequence. This model represents the homology domain family of the D2 domain. It occurs just once in many surface proteins but up to twenty times in some pilin subunit proteins. Three of every four members have the typical Gram-positive C-terminal motif, LPXTG, although in many cases this motif may be involved in pilin subunit cross-linking rather than cell wall attachment. Proteins with this domain include fimbrial proteins with lectin-like adhesion functions, and the majority of characterized members are involved in surface adhesion to host structures.	3.03843e-08
NZ_CP027518.1\|WP_002297404.1\|3393_4644_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.21771e-29
NZ_CP027518.1\|WP_002295674.1\|2815_3157_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.01693e-48
NZ_CP027518.1\|WP_010729784.1\|6352_8329_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	3.93449e-27
NZ_CP027518.1\|WP_010729785.1\|8341_9097_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	2.58528e-60
NZ_CP027518.1\|WP_002336710.1\|5628_6300_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	5.03937e-44

>NZ_CP027518.1|WP_002323647.1|1864_2197_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIG
>NZ_CP027518.1|WP_002295674.1|2815_3157_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSFEIIEFVADKEE
>NZ_CP027518.1|WP_002297404.1|3393_4644_-|IS110-family-transposase
MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNDSYHFDQIVIGMESTSMYSFHPSMFFHEDEKLKKLNTLVTIENPFRVKQFSRMFDENKTDRNDALRIADFLRIQRFTTSPIKEEKYMALQRLTRTRYQLIKQLIRTKQHFLENLTYKCNTLAREMRDESTSLFSATLISLMTEDFTLDELAELPLEAFCDLLQEKGKGRFKQPEKIAKAIQRAITMSYRLGALAQESINVVLSVLVREIRALEKNIKELDKAIEQVIVVIPEYQCLTSIPGVGKVYAAGLIAEIGQIERFEDQTKLAKYAGLSWKVNQSGNYQSQNTPLTKQGNRYFRYYLVEAANSVKNYLPEYKAFYQSKYKEVPKHQHKRALVLTARKFTRLVDTLLRKHQLYTPPRSVIEK
>NZ_CP027518.1|WP_002295673.1|5053_5293_+|hypothetical-protein
MARPVLEAMDMDTLTKGRYVQLLARGYSPKEVFKALSKGTDMEKERLRKEFDYWRTHNGIKDLKPARPVIKRKKKITQD
>NZ_CP027518.1|WP_002295672.1|5359_5569_+|hypothetical-protein
MNYEEIENRKKVSKEMEEKLLKTMKQKHLKRLSVAQYINDMQLTGKEKACLLGSMKNFEQLRRTYRIHF
>NZ_CP027518.1|WP_002336710.1|5628_6300_+|class-A-sortase
MKKWLFGFLGVTLIVFCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPGYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP027518.1|WP_010729784.1|6352_8329_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYQVHAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVQDVEDKGSNSEYVKNATNKITSAVDENGEITFTDQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDKTGSGFLKNIHLYPKNIVSKLSFELTKFGDDGADQSKQTLLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDQEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGKGLSYVAEKADIKVTNNDGSVVLKENTDYKIENSDSGFVIDFIVNNGQVSDTVANLHGQDLKMTYNMFVNDSAEIANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLEGAEFAAKNAEGKYYGGLTDTDKDGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGDYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQSYVLISCLLLGAGGLSAVVYFKKKA
>NZ_CP027518.1|WP_010729785.1|8341_9097_+|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPVVETNVAKFQQQQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFCVPIIFIYKKIRRRSE
>NZ_CP027518.1|WP_002350398.1|9093_9918_+|hypothetical-protein
MNKRKWLFVCVAALFSTVAYSQLSFADSSDSSTTQTIDNSITAPSETDSSENTTEETADSNISFTESTNPTSESSSETSEKPQDVEDTQVIKQAIHIQKIISSNQINNQGSQVAQQEGINGAKFIVYDITNILEEMSQDDNEKNQSVEIIESKLKDRAKKLSYDQLKKVAEGETKTIDDQEGVIEFSIEVPANKKQAYYIVNESSPENISNSEDIVLLTPVSNEKGEFLTDVWLYPKSEKSEPKEEIKKVVSTGVKKNFFENCWEFFAQLFFDN
>NZ_CP027518.1|WP_025481135.1|10206_12318_+|isopeptide-forming-domain-containing-fimbrial-protein
MEGIMENKIHCTTGRVITLVLFLFLLLFARGTAVQALEKVDPSQIKENNNLVLYHDSDSLRNIEVTGINGFKILDEYSTKKQKVLAWPKVKDLKSTSKIVAHYQKVGTYLGKEIDCDVTFSNFVAHAGVNQDGLAKTINGKKYYNYLLFDKNIYRGFFMQSINVMNAKLEFKYAGTKTKVALSEPQPEIQSKMRSMRAAGIDLNDTFLSIYSLNGQYQQRVSWYNDNNESVGERNIDMREFVGYEKMGSLPYFVTTDTACAEYKAPALSTNNLTSKVVGGRAEKAYSSNDHFTDVVGADTYHRSGVTYTLQGASPTFMIGANTNSMMFSFDTALLWTPQPSKPTKEVFNKANTEEAAHNIDKKVIPQGSDVYYHIHQKFDALTVNTMNKYKSFKITDTFDSKNFDMVSDGKNYDGALWYVEANGTWKKADTGGKLTVSGNTVTYTASDSFLANAANYGRDYILQLHMRAKNDAKGIAPNVATVTFNNDPNKGTQKTNTVENYFSLKPNKKVEQDGKDVDGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDIASDHYKQFSIQDPVEDRLTYKEGSARVIDMSTGKDITSEGTLTYDSNSRTLKWEASADFLSKNLLDGREIQLIFTAKTPLNEELDIDNQAKVSVESIEKATNVVTIGVKPNLPQIIVPKTGSNHLVLTVIGSILFLTLASLGYVVLKLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.2\|516\|19\|NZ_CP027518\|CRISPRCasFinder	516-534	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP027518_1	1.1\|453\|40\|NZ_CP027518\|CRISPRCasFinder	453-492	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|516|19|NZ_CP027518|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|453|40|NZ_CP027518|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

50773 : 80012

Streptococcus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086322086.1\|50773_51460_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	98.7
WP_010729797.1\|51507_52218_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010729798.1\|52201_52936_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002301686.1\|53152_54166_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002301685.1\|54176_54587_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002301684.1\|54586_55054_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002301683.1\|55071_55818_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002301682.1\|55817_56627_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_080114943.1\|58589_58991_-	hypothetical protein	A0A0N9S006	Staphylococcus_phage	2.5e-24	49.2
WP_010729801.1\|59217_60396_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.7e-23	27.1
WP_074394709.1\|60443_61181_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_002299198.1\|61338_62268_-	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	1.1e-06	23.3
WP_002299197.1\|62340_62952_-	VanZ family protein	NA	NA	NA	NA
WP_010729802.1\|63167_64076_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002298377.1\|66700_67117_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002298375.1\|67113_67584_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_010729805.1\|67597_68371_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298371.1\|68384_69197_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002322451.1\|69250_70216_+	SIS domain-containing protein	NA	NA	NA	NA
WP_010729806.1\|70351_73075_+	PRD domain-containing protein	NA	NA	NA	NA
WP_010729807.1\|73087_73720_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	3.0e-08	27.9
WP_077974475.1\|73924_74152_+	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_086322080.1\|74148_74487_+	antitoxin	NA	NA	NA	NA
WP_002389879.1\|74476_74746_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	8.7e-18	48.8
WP_002302440.1\|74924_76226_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002296127.1\|76454_78002_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002287659.1\|78103_78457_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002285758.1\|78446_78641_-	hypothetical protein	NA	NA	NA	NA
WP_010729749.1\|78719_80012_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5

DBSCAN-SWA_2

84681 : 126452

Streptococcus_phage(23.08%)

integrase,transposase

attL 80223:80240|attR 127796:127813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
80223:80240	attL	NA	NA	NA	NA
WP_002296840.1\|84681_85869_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002298077.1\|86403_87804_+	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
WP_002322961.1\|87836_88004_+	hypothetical protein	NA	NA	NA	NA
WP_002350223.1\|88869_89730_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002350224.1\|90149_91082_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_002339141.1\|91124_91736_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.7e-56	53.2
WP_002339142.1\|91755_92976_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.9e-57	58.5
WP_085910366.1\|93033_93720_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002331328.1\|94209_94431_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002342384.1\|94446_95289_+	hypothetical protein	NA	NA	NA	NA
WP_010729753.1\|95351_97154_+	exonuclease DNA polymerase III epsilon subunit	A0A0A7RWA3	Clostridium_phage	7.6e-33	30.4
WP_010729754.1\|97212_98121_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002336308.1\|98670_99630_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.5e-31	35.5
WP_002313084.1\|101018_101624_-	recombinase family protein	A0A219YA40	Aeromonas_phage	3.6e-19	32.6
WP_010729506.1\|102658_103630_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-05	22.4
WP_002322554.1\|103724_105083_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002322555.1\|105125_105992_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002313079.1\|105988_106837_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002322556.1\|106850_108323_+	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_010729757.1\|108339_109212_+	ROK family protein	NA	NA	NA	NA
WP_002292678.1\|112474_112804_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002300557.1\|112793_113081_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292680.1\|113364_114222_+	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002292681.1\|114222_114771_+	hypothetical protein	NA	NA	NA	NA
WP_044383156.1\|115400_116081_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.2e-109	83.6
WP_074394729.1\|116136_116322_+	type I restriction endonuclease subunit S	NA	NA	NA	NA
WP_094868189.1\|116533_117220_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002344897.1\|117348_117705_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002344896.1\|117694_117961_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002344895.1\|118119_119121_+	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_008271463.1\|120344_120590_+	hypothetical protein	NA	NA	NA	NA
WP_002311006.1\|120687_120909_+	hypothetical protein	NA	NA	NA	NA
WP_002319325.1\|121972_122590_+	hypothetical protein	NA	NA	NA	NA
WP_002300314.1\|123609_124779_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002290383.1\|125251_125806_+\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002290382.1\|125978_126452_-\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
127796:127813	attR	NA	NA	NA	NA

DBSCAN-SWA_3

164385 : 211246

Streptococcus_phage(31.58%)

integrase,transposase,holin

attL 162866:162883|attR 170952:170969

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
162866:162883	attL	NA	NA	NA	NA
WP_000997695.1\|164385_165564_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_106913980.1\|165863_166598_+	hypothetical protein	NA	NA	NA	NA
WP_002328877.1\|166594_167092_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002328876.1\|167147_168056_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_071870188.1\|168602_168770_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010729769.1\|168843_170070_+\|integrase	site-specific integrase	A0A097BYJ7	Leuconostoc_phage	3.2e-14	24.2
WP_002323453.1\|170227_170845_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.5e-15	36.7
WP_002305056.1\|171527_172523_-	LacI family transcriptional regulator	NA	NA	NA	NA
170952:170969	attR	NA	NA	NA	NA
WP_002322785.1\|172617_173490_-	ROK family protein	NA	NA	NA	NA
WP_002361237.1\|173502_174930_-	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	3.1e-29	26.8
WP_002323715.1\|174983_176258_-	MFS transporter	NA	NA	NA	NA
WP_002325884.1\|176560_177514_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.3e-34	36.1
WP_002305052.1\|177687_178119_-	antitoxin HicB	F0PIL2	Enterococcus_phage	4.3e-43	64.9
WP_002305050.1\|178958_179654_-	hypothetical protein	NA	NA	NA	NA
WP_002305049.1\|179646_180084_-	hypothetical protein	NA	NA	NA	NA
WP_002287517.1\|180099_180351_-	hypothetical protein	NA	NA	NA	NA
WP_002324499.1\|180350_180557_-	hypothetical protein	NA	NA	NA	NA
WP_074399798.1\|181004_181229_-	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	3.6e-09	56.9
WP_002295624.1\|181418_181541_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295625.1\|181699_181957_-	hypothetical protein	NA	NA	NA	NA
WP_002301800.1\|182466_183366_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002299811.1\|183378_183975_-	transcriptional regulator	NA	NA	NA	NA
WP_002303486.1\|184320_186330_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002313123.1\|186340_187810_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002313122.1\|187870_189682_-	hypothetical protein	NA	NA	NA	NA
WP_002330536.1\|190651_191902_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.0e-113	63.3
WP_002322479.1\|192037_192232_-	hypothetical protein	NA	NA	NA	NA
WP_086968564.1\|192479_193620_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
WP_002296379.1\|194122_195715_-	hypothetical protein	NA	NA	NA	NA
WP_010729773.1\|195733_196156_-	hypothetical protein	NA	NA	NA	NA
WP_002296377.1\|196157_196454_-	hypothetical protein	NA	NA	NA	NA
WP_002305788.1\|196688_196958_-	hypothetical protein	NA	NA	NA	NA
WP_086322097.1\|197001_197667_-	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|197723_198410_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_074394719.1\|199359_199563_+	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|200519_201206_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002285758.1\|202694_202889_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|202878_203232_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002296127.1\|203333_204881_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002354485.1\|205594_206281_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001028141.1\|206741_208181_-	bifunctional aminoglycoside N-acetyltransferase AAC(6')-Ie/aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A0N9SKF6	Staphylococcus_phage	8.5e-285	100.0
WP_025189010.1\|208181_208574_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	1.4e-69	96.9
WP_002319817.1\|210089_210770_+\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_010729776.1\|210775_211246_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.5e-09	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP027519

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP027517

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP027518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection