CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP027505	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed4, complete sequence	0 crisprs	csa3	0	1
NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	1 crisprs	DEDDh	2	1
NZ_CP027501	Enterococcus faecium strain AUSMDU00004142 chromosome, complete genome	1 crisprs	cas14j,DEDDh,cas2,RT,DinG,cas3,csa3	0	16
NZ_CP027504	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed3	0 crisprs	NA	0	2
NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10888 : 25631

Streptococcus_phage(66.67%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001224538.1\|10888_11506_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_000366408.1\|11546_11846_+	hypothetical protein	NA	NA	NA	NA
WP_000824191.1\|11879_12047_+	hypothetical protein	NA	NA	NA	NA
WP_002321606.1\|12091_12697_-	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-19	33.2
WP_000343406.1\|12821_15809_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.3e-206	38.3
WP_029756604.1\|16459_16816_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	3.4e-25	60.9
WP_005228365.1\|17329_17497_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	8.1e-14	64.0
WP_002405437.1\|17584_19525_-	tetracycline resistance ribosomal protection protein Tet(S)	A0A2K5B2A5	Erysipelothrix_phage	6.0e-294	78.7
WP_002354485.1\|20197_20884_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002354485.1\|21756_22443_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001096887.1\|22529_23324_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_000627290.1\|23416_23959_-	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001255866.1\|23955_24864_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|24896_25631_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0

DBSCAN-SWA_2

28981 : 35413

Bacillus_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001015311.1\|28981_29662_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000170424.1\|30479_31052_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_073120187.1\|31524_32097_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_086953888.1\|32197_33360_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002322130.1\|33400_33655_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.1e-09	50.0
WP_000199136.1\|33765_34020_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_001196543.1\|34212_34488_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|34459_35413_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP027502

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027502_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027502_1

430-557

Orphan

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP027502_1

>merge|NZ_CP027502|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP027502|1|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027502.1\|WP_002322486.1\|1881_2214_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027502.1\|WP_002316053.1\|7031_7784_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP027502.1\|WP_002302867.1\|8573_8834_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027502.1\|WP_002311524.1\|3674_3908_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027502.1\|WP_002313095.1\|4313_4985_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP027502.1\|WP_002311521.1\|2832_3174_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP027502.1\|WP_060805016.1\|8830_10921_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|375475
NZ_CP027502.1\|WP_060805017.1\|7799_8561_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027502.1\|WP_060805018.1\|5037_7017_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP027502.1\|WP_002311523.1\|3192_3483_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP027502.1\|WP_002311521.1\|2832_3174_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	8.60138e-49
NZ_CP027502.1\|WP_002316053.1\|7031_7784_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.23538e-60
NZ_CP027502.1\|WP_060805016.1\|8830_10921_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|375475	pfam17998, AgI_II_C2, Cell surface antigen I/II C2 terminal domain. This is the second domain (C2) located in the C-terminal region found in antigen I/II type adhesin protein AspA from S. pyogenes. Together with C3, these two domains form an elongated structure, each domain adopts the DEv-IgG fold. Similar to the classical IgG folds, it is comprised of two major antiparallel beta-sheets, designated ABED and CFG. For the C2-domain, there are two additional strands on the CFG sheet. Furthermore, sheets ABED and CFG are interconnected by several cross-connecting loops and one alpha-helix (DH1). The side chains of D982 and N996 in the C2-domain are involved in hydrogen bonding with the side chains of R1264 and N1295 in the C3 domain. Main chain hydrogen bonding can also be observed between S992 in C2 and N1189/G1191 in C3, furthermore stabilizing the interaction between the domains. The C2 domain contains one bound metal ion, modeled as Ca2+, and both the C2- and C3-domains are stabilized by conserved isopeptide bonds, which connect the beta-sheets of the central DEv-IgG motifs.Other members of this family include Major cell-surface adhesin PAc from Streptococcus mutans and SspB from Streptococcus gordonii.	1.29104e-15
NZ_CP027502.1\|WP_060805018.1\|5037_7017_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.35074e-30
NZ_CP027502.1\|WP_002313095.1\|4313_4985_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	4.30589e-43

>NZ_CP027502.1|WP_002322486.1|1881_2214_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP027502.1|WP_002311521.1|2832_3174_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALNEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP027502.1|WP_002311523.1|3192_3483_+|hypothetical-protein
MKFFEVKSPYYYALIAAKNEEECAELYEQVVTDIENREEFIRCLHELNRNEAIQEDAKKISEETLQPIGMEEATKDIFTIIDEQKSCVLSIDSTLV
>NZ_CP027502.1|WP_002311524.1|3674_3908_+|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWREHNGIKDLKPARPVIRRKKLKK
>NZ_CP027502.1|WP_002313095.1|4313_4985_+|class-A-sortase
MKKWLFGFLGVALIVFCSVFGYVSYQKHEGEVFKQNIEKKMPIDQINEHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQAFAQIQIPALGLTLPIFKGANQYTLSLGAATYFYEDAEMRKGNYVLAGHNMEIPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP027502.1|WP_060805018.1|5037_7017_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDVDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQALPREDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLESAEFAAKNAEGKYYGGLVDTDKNGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP027502.1|WP_002316053.1|7031_7784_+|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLEPNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKKQKLSWTWLLGSTVFLSVMIIGSLFVYKKKK
>NZ_CP027502.1|WP_060805017.1|7799_8561_+|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGQKLEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKDRVKKLFSDQLKLVSNGKTKTIDQQTGVFEFSIEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNGEFLKDVWIYPKSEASQPKEEVKKIVSTGVKKNFFENCWDFVTHLFSRD
>NZ_CP027502.1|WP_002302867.1|8573_8834_+|hypothetical-protein
MKLIKLLLFNFSCLTAVFLYCGLLFSKLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG
>NZ_CP027502.1|WP_060805016.1|8830_10921_+|isopeptide-forming-domain-containing-fimbrial-protein
MNFKHSWTRRLKYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKNIRYPSFQKEYGETNLVLEGVTTNTKVNIDYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIVYHSTQMNVQLVATYEDGSPVQFSGDTFISFNSLNPAGGKTTDLKGEYAHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKLTQADNDFNNLHDKLGDPKFGQGTVSFKISEANPTFVIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKVNRLGVDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSGEVTYDKTKHQVKYAAKADTLKNRMKYNGETYELVINVKVNELANQNSVAKNQGTSIINKVEKDTNIITVYFPKIPVKEVQQNGKDVNGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDAASDHYKQFSIQDPIEARLTYKEGSAQVIDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPLQSEKNIDNQAVVAVDNVSNKTNVVTIGVDPNLPQVIVPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.2\|516\|19\|NZ_CP027502\|CRISPRCasFinder	516-534	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP027502_1	1.1\|453\|40\|NZ_CP027502\|CRISPRCasFinder	453-492	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|516|19|NZ_CP027502|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|453|40|NZ_CP027502|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25323 : 127866

Paenibacillus_phage(17.24%)

integrase,transposase,holin

attL 58611:58670|attR 130562:130807

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002340487.1\|25323_26283_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.1e-35	36.7
WP_002311551.1\|26776_27064_+	hypothetical protein	NA	NA	NA	NA
WP_002311552.1\|27081_27504_+	hypothetical protein	NA	NA	NA	NA
WP_033583488.1\|27523_29116_+	hypothetical protein	NA	NA	NA	NA
WP_002316755.1\|29371_29566_+	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|29701_30952_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002311557.1\|31361_33734_+	hypothetical protein	B5SP25	Lactococcus_phage	1.1e-10	28.9
WP_002353044.1\|33794_35255_+	hypothetical protein	NA	NA	NA	NA
WP_002353045.1\|35265_35709_+	topoisomerase	NA	NA	NA	NA
WP_002340482.1\|35793_37470_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.1e-117	51.1
WP_002295629.1\|37715_38312_+	transcriptional regulator	NA	NA	NA	NA
WP_002340481.1\|38324_39224_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002295625.1\|39732_39990_+	hypothetical protein	NA	NA	NA	NA
WP_002311565.1\|40148_40283_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295623.1\|40425_40686_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002295619.1\|41134_41341_+	hypothetical protein	NA	NA	NA	NA
WP_002293542.1\|41340_41592_+	hypothetical protein	NA	NA	NA	NA
WP_002311567.1\|41607_42045_+	hypothetical protein	NA	NA	NA	NA
WP_002293546.1\|42725_43121_+	hypothetical protein	NA	NA	NA	NA
WP_002314432.1\|43102_43369_+	hypothetical protein	NA	NA	NA	NA
WP_002340480.1\|43378_43612_+	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_002335346.1\|43954_44137_+	hypothetical protein	NA	NA	NA	NA
WP_002340479.1\|44126_44348_+	hypothetical protein	NA	NA	NA	NA
WP_086956687.1\|44388_45550_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002290556.1\|46341_47109_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002290555.1\|47597_48023_+	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_002290554.1\|48039_48555_+	galactose-6-phosphate isomerase subunit LacB	A0A222YX14	Synechococcus_phage	3.3e-05	36.0
WP_002340477.1\|48565_49498_+	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_002290551.1\|49500_50481_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002290550.1\|50508_50826_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002340476.1\|50825_52532_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002290548.1\|52673_54080_+	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	3.6e-46	29.0
WP_002305107.1\|54102_54375_+	DUF3884 family protein	NA	NA	NA	NA
WP_002303235.1\|54395_55295_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_106914390.1\|55766_56929_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.9e-79	50.9
WP_106914391.1\|57625_58804_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
58611:58670	attL	NA	NA	NA	NA
WP_002326839.1\|58928_59837_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002300833.1\|60239_62186_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_002300835.1\|62188_62644_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002300836.1\|62657_63986_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002300838.1\|64019_64304_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002300840.1\|64305_64821_+	YjbQ family protein	NA	NA	NA	NA
WP_002300841.1\|64836_65499_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002300842.1\|65505_66078_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002300843.1\|66264_67785_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.1e-48	31.6
WP_002305884.1\|68027_68213_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_002300846.1\|68196_68379_-	hypothetical protein	NA	NA	NA	NA
WP_002301839.1\|69332_69932_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.3e-29	36.1
WP_002322465.1\|69995_70595_+	hypothetical protein	NA	NA	NA	NA
WP_002305879.1\|71610_72483_-	ROK family protein	NA	NA	NA	NA
WP_002352509.1\|72746_74693_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002302078.1\|74877_76317_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002302077.1\|76318_77281_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_002297218.1\|77486_78782_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_086953894.1\|78972_80399_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|80641_81097_+\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_106914392.1\|81682_81913_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|82142_82961_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|83121_83811_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|83824_85327_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002300328.1\|85339_85816_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_086956687.1\|86313_87476_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002287870.1\|88593_89112_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002301591.1\|91187_92273_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_000222572.1\|92380_93334_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_106914393.1\|93464_94715_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298736.1\|94733_95660_-	PEP phosphonomutase	NA	NA	NA	NA
WP_002301128.1\|95738_96734_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002301130.1\|96749_97919_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002301131.1\|97934_98669_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_087043335.1\|99439_100602_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.2e-79	51.3
WP_002301811.1\|101170_102463_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.1e-32	41.0
WP_002313174.1\|102736_102997_-	hypothetical protein	NA	NA	NA	NA
WP_002317769.1\|103169_104342_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_000997695.1\|104579_105758_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002300493.1\|105920_107090_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002300494.1\|107414_108734_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|108730_109384_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002348630.1\|110512_111229_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.5e-45	50.0
WP_016922460.1\|111352_111538_-	hypothetical protein	NA	NA	NA	NA
WP_002302261.1\|113144_114176_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6
WP_002313180.1\|114182_115013_-	ABC transporter permease	NA	NA	NA	NA
WP_002302265.1\|115009_115816_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002302267.1\|115821_116646_-	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
WP_002302268.1\|116635_117736_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002302270.1\|117913_118699_+	histidinol phosphate phosphatase	NA	NA	NA	NA
WP_002330694.1\|118731_119115_+	hypothetical protein	NA	NA	NA	NA
WP_077828694.1\|119190_119322_+	hypothetical protein	NA	NA	NA	NA
WP_002322470.1\|119290_119527_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_002302275.1\|119604_120576_-	radical SAM protein	NA	NA	NA	NA
WP_002340465.1\|121227_122850_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	2.7e-122	47.5
WP_002301195.1\|123135_124512_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|124511_125168_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|125177_126455_-	ABC transporter permease	NA	NA	NA	NA
WP_102829665.1\|126704_127866_+\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
130562:130807	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP027501

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027501_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027501_1

2448782-2448891

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027501_1

>merge|NZ_CP027501|1|2448782-2448891|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP027501|1|1|2448782-2448891|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027501.1\|WP_002290558.1\|2442934_2444467_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP027501.1\|WP_002296327.1\|2446989_2447679_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP027501.1\|WP_002295743.1\|2444856_2445765_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP027501.1\|WP_002291634.1\|2448205_2448709_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP027501.1\|WP_002294587.1\|2449118_2449808_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP027501.1\|WP_002287791.1\|2439584_2440724_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP027501.1\|WP_002287788.1\|2441032_2441746_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP027501.1\|WP_002294579.1\|2455122_2455293_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP027501.1\|WP_002291638.1\|2449911_2450334_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP027501.1\|WP_002294584.1\|2451357_2452230_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP027501.1\|WP_002294580.1\|2454476_2455022_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP027501.1\|WP_002294588.1\|2447784_2448153_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP027501.1\|WP_076713757.1\|2445858_2446908_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP027501.1\|WP_002294577.1\|2455630_2456275_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP027501.1\|WP_002294585.1\|2450676_2451345_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP027501.1\|WP_002294583.1\|2452320_2453340_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP027501.1\|WP_002294581.1\|2453512_2454400_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP027501.1\|WP_002287787.1\|2441999_2442701_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP027501.1\|WP_002287792.1\|2438530_2439496_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP027501.1\|WP_002294578.1\|2455316_2455469_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783

Protein	Function_ID	Function_description	E-value
NZ_CP027501.1\|WP_002290558.1\|2442934_2444467_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP027501.1\|WP_002296327.1\|2446989_2447679_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP027501.1\|WP_002295743.1\|2444856_2445765_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP027501.1\|WP_002291634.1\|2448205_2448709_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP027501.1\|WP_002294587.1\|2449118_2449808_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP027501.1\|WP_002287791.1\|2439584_2440724_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP027501.1\|WP_002287788.1\|2441032_2441746_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP027501.1\|WP_002294579.1\|2455122_2455293_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP027501.1\|WP_002291638.1\|2449911_2450334_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP027501.1\|WP_002294584.1\|2451357_2452230_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP027501.1\|WP_002294580.1\|2454476_2455022_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP027501.1\|WP_002294588.1\|2447784_2448153_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP027501.1\|WP_076713757.1\|2445858_2446908_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.24119e-56
NZ_CP027501.1\|WP_002294577.1\|2455630_2456275_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP027501.1\|WP_002294585.1\|2450676_2451345_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP027501.1\|WP_002294583.1\|2452320_2453340_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP027501.1\|WP_002294581.1\|2453512_2454400_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP027501.1\|WP_002287787.1\|2441999_2442701_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP027501.1\|WP_002287792.1\|2438530_2439496_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP027501.1\|WP_002294578.1\|2455316_2455469_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17

>NZ_CP027501.1|WP_002291634.1|2448205_2448709_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP027501.1|WP_002294588.1|2447784_2448153_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP027501.1|WP_002296327.1|2446989_2447679_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP027501.1|WP_076713757.1|2445858_2446908_-|MFS-transporter
MKSNEKTPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLRDVVDRPKLIIRMVALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFTRGAS
>NZ_CP027501.1|WP_002295743.1|2444856_2445765_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP027501.1|WP_002290558.1|2442934_2444467_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP027501.1|WP_002287787.1|2441999_2442701_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP027501.1|WP_002287788.1|2441032_2441746_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP027501.1|WP_002287791.1|2439584_2440724_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP027501.1|WP_002287792.1|2438530_2439496_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP027501.1|WP_002294587.1|2449118_2449808_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP027501.1|WP_002291638.1|2449911_2450334_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP027501.1|WP_002294585.1|2450676_2451345_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP027501.1|WP_002294584.1|2451357_2452230_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP027501.1|WP_002294583.1|2452320_2453340_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP027501.1|WP_002294581.1|2453512_2454400_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP027501.1|WP_002294580.1|2454476_2455022_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP027501.1|WP_002294579.1|2455122_2455293_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP027501.1|WP_002294578.1|2455316_2455469_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP027501.1|WP_002294577.1|2455630_2456275_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

225472 : 276784

Streptococcus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303667.1\|225472_226813_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.1e-66	36.0
WP_002288234.1\|226998_228063_-	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_002288233.1\|228059_229145_-	phosphomevalonate kinase	NA	NA	NA	NA
WP_002288232.1\|229157_230135_-	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_002288231.1\|230127_231072_-	mevalonate kinase	NA	NA	NA	NA
WP_002322895.1\|231393_232047_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.1e-58	52.3
WP_002294163.1\|232131_233037_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002294161.1\|233038_233671_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_002293357.1\|233990_234515_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.4e-14	33.3
WP_002289309.1\|234586_234787_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002289310.1\|234839_235199_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002289312.1\|235450_236788_+	hypothetical protein	NA	NA	NA	NA
WP_002289314.1\|236835_238965_+	hydantoinase	NA	NA	NA	NA
WP_002289315.1\|238939_239629_+	hypothetical protein	NA	NA	NA	NA
WP_002289316.1\|240036_240723_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002315615.1\|240858_241053_-	hypothetical protein	NA	NA	NA	NA
WP_002289317.1\|241102_241543_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_002289318.1\|241546_242392_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_002294157.1\|242540_243959_+	dipeptidase PepV	NA	NA	NA	NA
WP_002289860.1\|244015_244963_-	glycosyltransferase	NA	NA	NA	NA
WP_002289862.1\|245185_245536_-	peptidase	NA	NA	NA	NA
WP_002294156.1\|245735_246815_+	glutamyl aminopeptidase	NA	NA	NA	NA
WP_002287837.1\|246958_247279_+	thioredoxin family protein	NA	NA	NA	NA
WP_002287838.1\|247300_247765_+	universal stress protein	NA	NA	NA	NA
WP_002294153.1\|247969_248575_+	DUF4479 domain-containing protein	NA	NA	NA	NA
WP_002294152.1\|248613_249903_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-22	30.2
WP_002287841.1\|250330_250810_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_002296569.1\|250894_251404_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	2.8e-17	34.8
WP_002296570.1\|251503_252154_+	hypothetical protein	NA	NA	NA	NA
WP_002291914.1\|252604_253543_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002291912.1\|253555_254608_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002296392.1\|254873_255509_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002296391.1\|255699_256491_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_106914351.1\|256970_257879_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002295755.1\|257934_258432_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002340421.1\|258468_259152_-	hypothetical protein	NA	NA	NA	NA
WP_002296262.1\|259498_259765_+	DUF960 domain-containing protein	NA	NA	NA	NA
WP_002296261.1\|259791_260091_+	hypothetical protein	NA	NA	NA	NA
WP_002296259.1\|260264_260816_+	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_002296258.1\|260961_261255_+	hypothetical protein	NA	NA	NA	NA
WP_002304106.1\|261247_261544_+	peptidase	NA	NA	NA	NA
WP_002296256.1\|261618_262617_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_000222572.1\|262708_263662_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002294735.1\|263760_264477_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002296623.1\|264675_265971_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_025478783.1\|266017_268066_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_002294732.1\|269275_270517_+	serine/threonine transporter SstT	NA	NA	NA	NA
WP_002294730.1\|270663_271299_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002294728.1\|271489_272230_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002296909.1\|272374_274012_-	membrane protein	NA	NA	NA	NA
WP_002346735.1\|274144_275104_-\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_000997695.1\|275605_276784_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

732045 : 828966

108

Enterococcus_phage(23.91%)

portal,integrase,transposase,head,terminase,holin,tail,capsid,protease

attL 733928:733987|attR 832491:832526

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000195429.1\|732045_733218_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
733928:733987	attL	NA	NA	NA	NA
WP_002297185.1\|734009_735305_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
733928:733987	attL	NA	NA	NA	NA
WP_002287017.1\|735613_736426_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002305412.1\|736588_736696_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002320736.1\|736753_737821_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	3.6e-38	28.9
WP_002296936.1\|737962_738166_+	DUF3173 family protein	NA	NA	NA	NA
WP_002287015.1\|738225_739428_+\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	1.1e-32	28.5
WP_002287014.1\|740076_741207_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	6.0e-84	45.3
WP_000222572.1\|741320_742274_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002287002.1\|742582_742975_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002287001.1\|743002_744343_+	type I glutamate--ammonia ligase	A0A1V0SJ53	Klosneuvirus	9.1e-07	25.6
WP_002286999.1\|745534_747145_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.3e-145	48.4
WP_002294057.1\|747436_748306_+	fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_002294056.1\|748470_749742_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_002290332.1\|749738_751034_+	transcription termination factor Rho	NA	NA	NA	NA
WP_002290330.1\|751132_751396_+	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_002296225.1\|751840_752290_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002289225.1\|752346_753765_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002289226.1\|753764_754625_+	ketose-bisphosphate aldolase	NA	NA	NA	NA
WP_002289227.1\|754798_755572_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002289228.1\|755718_756084_+	DUF2512 family protein	NA	NA	NA	NA
WP_002294047.1\|756231_757440_-	MFS transporter	NA	NA	NA	NA
WP_002289230.1\|757458_757737_-	hypothetical protein	NA	NA	NA	NA
WP_002289231.1\|757929_758586_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002289232.1\|759027_759825_-	TPM domain-containing protein	NA	NA	NA	NA
WP_002289233.1\|759821_761006_-	hypothetical protein	NA	NA	NA	NA
WP_002289234.1\|761030_762278_-	virion core protein	NA	NA	NA	NA
WP_002294042.1\|762492_764238_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.9e-49	36.3
WP_002292337.1\|764257_764572_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_002296223.1\|764596_765193_+	recombination protein RecR	NA	NA	NA	NA
WP_002294039.1\|765256_765901_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|765915_766245_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|766258_767197_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|767232_768057_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|768049_768397_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|768465_769338_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|769446_770568_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|770621_771224_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|771538_773728_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6
WP_002304285.1\|774053_774821_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	35.2
WP_002288087.1\|774810_776853_+	ABC transporter permease	NA	NA	NA	NA
WP_002288113.1\|777133_777283_+	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_002288089.1\|777293_778808_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	3.4e-42	28.5
WP_002288090.1\|778804_780010_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.4e-19	30.7
WP_002288092.1\|780054_780288_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_002288094.1\|780290_781559_+	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_002288096.1\|781699_782782_+	M42 family metallopeptidase	NA	NA	NA	NA
WP_002288098.1\|782781_783585_+	DUF975 family protein	NA	NA	NA	NA
WP_002288100.1\|783654_784395_+	MBL fold metallo-hydrolase	S4VYV9	Pandoravirus	3.9e-07	26.3
WP_002288102.1\|784405_785410_+	lipoate--protein ligase	NA	NA	NA	NA
WP_002297185.1\|785503_786799_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288103.1\|786976_788821_-	membrane protein	NA	NA	NA	NA
785422:786935	attR	NA	NA	NA	NA
WP_002299609.1\|789032_789551_+	signal peptidase I	NA	NA	NA	NA
785422:786935	attR	NA	NA	NA	NA
WP_002288107.1\|789678_790362_+	O-methyltransferase	NA	NA	NA	NA
WP_002288109.1\|790902_791262_+	DUF1304 family protein	NA	NA	NA	NA
WP_002340354.1\|791384_793016_+	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_002289449.1\|793077_793719_-	uracil-DNA glycosylase	NA	NA	NA	NA
WP_002289450.1\|794000_794309_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_002289451.1\|794335_794680_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_002289452.1\|794692_794986_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_002301539.1\|795078_796227_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.0e-67	40.1
WP_002305409.1\|796238_796550_-	hypothetical protein	NA	NA	NA	NA
WP_002321996.1\|796602_796998_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002305405.1\|797033_797378_-	helix-turn-helix transcriptional regulator	A0A126GGL0	Streptococcus_phage	1.2e-24	52.6
WP_002349274.1\|797678_797900_+	hypothetical protein	NA	NA	NA	NA
WP_002305403.1\|798026_798803_+	hypothetical protein	B2ZYU5	Staphylococcus_phage	2.8e-72	54.8
WP_002305401.1\|798799_798994_+	helix-turn-helix transcriptional regulator	D2IZW2	Enterococcus_phage	1.2e-08	50.9
WP_002349273.1\|798995_799280_+	hypothetical protein	NA	NA	NA	NA
WP_002305400.1\|799300_799489_+	hypothetical protein	D2IZW5	Enterococcus_phage	7.4e-08	60.3
WP_002305399.1\|799814_800054_+	hypothetical protein	NA	NA	NA	NA
WP_002305398.1\|800059_800746_+	hypothetical protein	C9E2N1	Enterococcus_phage	2.6e-90	71.4
WP_002305397.1\|800748_801579_+	replication protein	C9E2N2	Enterococcus_phage	1.5e-52	43.9
WP_002305396.1\|801595_802447_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.2e-25	28.7
WP_002305394.1\|802443_802803_+	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	3.1e-18	48.3
WP_002290675.1\|802817_802979_+	hypothetical protein	NA	NA	NA	NA
WP_002305393.1\|802975_803281_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|803280_803637_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|803596_803842_+	hypothetical protein	NA	NA	NA	NA
WP_002305391.1\|804026_804494_+	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
WP_002349267.1\|804768_805005_+	hypothetical protein	NA	NA	NA	NA
WP_002305389.1\|805028_805370_+	hypothetical protein	NA	NA	NA	NA
WP_020944850.1\|805362_805542_-	YegP family protein	NA	NA	NA	NA
WP_002305387.1\|805763_806411_+	hypothetical protein	NA	NA	NA	NA
WP_002305386.1\|806670_807015_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.0e-26	58.1
WP_002296599.1\|807019_807301_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|807403_807718_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|807695_809390_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|809409_810588_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|810550_811237_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|811236_812397_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|812406_813282_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|813278_813590_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|813579_813933_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|813922_814324_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|814316_814721_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002305379.1\|814732_815338_+	hypothetical protein	Q8W5Z9	Listeria_phage	1.1e-33	41.6
WP_002286510.1\|815357_815720_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|815722_815905_+	hypothetical protein	NA	NA	NA	NA
WP_002305374.1\|815921_819341_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	8.7e-78	41.5
WP_106914364.1\|819391_820129_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002305372.1\|820138_822430_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	1.7e-90	30.2
WP_002305370.1\|822453_824544_+	hypothetical protein	A0A249XZH9	Enterococcus_phage	9.6e-88	49.6
WP_002286491.1\|824706_825153_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|825154_825292_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|825329_825623_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|825619_825844_+\|holin	holin	NA	NA	NA	NA
WP_002286484.1\|825840_826866_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|827804_828966_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
832491:832526	attR	NA	NA	NA	NA

DBSCAN-SWA_3

867310 : 942894

Enterococcus_phage(26.32%)

portal,integrase,transposase,head,terminase,holin,tRNA,tail,capsid,protease

attL 924572:924587|attR 927923:927938

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|867310_870109_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|870157_871684_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|871698_872346_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|872529_872859_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|873035_873764_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|873779_874793_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|874792_876070_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|876132_878835_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|878986_879304_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|879333_879654_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|879761_881222_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|881289_881511_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|881541_881724_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|881723_882137_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|882259_883441_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286587.1\|883971_885111_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|885409_886045_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|886157_886793_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|886826_887288_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296613.1\|887417_887849_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|887866_888187_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|888485_889262_+	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|889276_889480_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002317757.1\|889495_889816_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002351655.1\|889997_890780_-	hypothetical protein	NA	NA	NA	NA
WP_105459839.1\|890845_891538_+	phage regulatory protein	D2IZW4	Enterococcus_phage	2.3e-38	41.3
WP_060809376.1\|891715_892057_+	hypothetical protein	NA	NA	NA	NA
WP_074394502.1\|892049_892721_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	5.5e-29	47.8
WP_002335419.1\|892726_893413_+	hypothetical protein	C9E2N1	Enterococcus_phage	1.1e-88	69.5
WP_106914365.1\|893485_894664_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_105459878.1\|894743_895604_+	replication protein	A0A1S5SFJ6	Streptococcus_phage	2.4e-48	66.7
WP_002343405.1\|895615_895885_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|896046_896349_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|896345_896507_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|896503_896809_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|896808_897165_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|897124_897370_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|897366_897786_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|897782_898340_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|898336_898633_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|898709_899123_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002300143.1\|899580_899856_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|900309_900516_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|900711_900879_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|900904_901249_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|901253_901535_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|901636_901951_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|901928_903623_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|903642_904821_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|904783_905470_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|905469_906630_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|906639_907515_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|907511_907823_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|907812_908166_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|908155_908557_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|908549_908954_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|908965_909574_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|909593_909956_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|909958_910141_+	hypothetical protein	NA	NA	NA	NA
WP_002286502.1\|910157_913589_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002286500.1\|913639_914377_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002296595.1\|914386_916678_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	1.6e-88	30.0
WP_002286495.1\|916701_918828_+	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002286491.1\|918990_919437_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|919438_919576_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|919613_919907_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|919903_920128_+\|holin	holin	NA	NA	NA	NA
WP_002286484.1\|920124_921150_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|922089_923251_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|924174_924582_+	hypothetical protein	NA	NA	NA	NA
924572:924587	attL	NA	NA	NA	NA
WP_002296902.1\|924595_924997_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|924998_925370_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|925405_925708_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|925956_926157_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002286469.1\|926461_927694_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|927947_928517_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
927923:927938	attR	NA	NA	NA	NA
WP_002286465.1\|928694_929135_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|929292_930057_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|930088_931012_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|931087_932227_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|932219_933020_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|933019_933847_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|933824_934559_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|934658_935525_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|935538_936111_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002296544.1\|936132_937161_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.2e-69	43.2
WP_002294531.1\|937258_938110_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.0
WP_002296543.1\|938144_940178_+	hypothetical protein	NA	NA	NA	NA
WP_060805065.1\|940221_941502_+	EpaQ family protein	NA	NA	NA	NA
WP_002297218.1\|941598_942894_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_4

967939 : 1093279

115

Streptococcus_phage(35.42%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|967939_969235_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_106914367.1\|969723_970677_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-35	35.8
WP_000997695.1\|971749_972928_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002296840.1\|973160_974348_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002296840.1\|974783_975971_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002289162.1\|976117_977740_+	hypothetical protein	NA	NA	NA	NA
WP_002289161.1\|978006_979176_-	serine hydrolase	A0A2R4AS58	Mycobacterium_phage	1.6e-10	26.3
WP_002289159.1\|979379_980555_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_002289156.1\|980690_981170_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_002292871.1\|981338_982070_+	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_002289154.1\|982066_983134_+	sensor histidine kinase	NA	NA	NA	NA
WP_002289153.1\|983140_983773_+	response regulator transcription factor	NA	NA	NA	NA
WP_002289151.1\|983912_984578_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_002303172.1\|984605_984899_+	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_002289148.1\|984966_985914_-	2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_002289147.1\|986091_986895_-	DUF1189 domain-containing protein	NA	NA	NA	NA
WP_002317368.1\|987040_987955_+	cation transporter	A0A1V0SED0	Indivirus	2.1e-10	31.5
WP_002292862.1\|988002_988473_+	GtrA family protein	NA	NA	NA	NA
WP_002295401.1\|988557_989166_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	7.7e-70	60.1
WP_002292860.1\|989299_989500_+	cold-shock protein	Q9AZD3	Lactococcus_phage	7.6e-19	67.7
WP_002295400.1\|990253_991480_+	LytR family transcriptional regulator	NA	NA	NA	NA
WP_002296956.1\|991587_992058_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_002292856.1\|992379_992958_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	9.7e-14	34.4
WP_002295399.1\|993131_994514_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.5e-86	37.4
WP_002295398.1\|994620_995418_+	recombination regulator RecX	NA	NA	NA	NA
WP_002296955.1\|995410_996589_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_002290817.1\|996682_997216_+	DUF402 domain-containing protein	NA	NA	NA	NA
WP_002290819.1\|997293_997728_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002301399.1\|997893_998853_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002354485.1\|999257_999944_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000751236.1\|1000068_1000521_+	hypothetical protein	NA	NA	NA	NA
WP_000718009.1\|1000534_1001224_+	hypothetical protein	NA	NA	NA	NA
WP_000344083.1\|1001348_1003700_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_002304891.1\|1003779_1004175_+	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|1004499_1005117_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_000366408.1\|1005157_1005457_+	hypothetical protein	NA	NA	NA	NA
WP_000824191.1\|1005490_1005658_+	hypothetical protein	NA	NA	NA	NA
WP_002321606.1\|1005702_1006308_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.0e-25	36.9
WP_000343406.1\|1006432_1009420_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.3e-206	38.3
WP_029756604.1\|1010070_1010427_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	3.4e-25	60.9
WP_005228365.1\|1010940_1011108_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	8.1e-14	64.0
WP_002405437.1\|1011195_1013136_-	tetracycline resistance ribosomal protection protein Tet(S)	A0A2K5B2A5	Erysipelothrix_phage	6.0e-294	78.7
WP_002354485.1\|1013808_1014495_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002354485.1\|1015367_1016054_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001096887.1\|1016140_1016935_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_000627290.1\|1017027_1017570_-	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001255866.1\|1017566_1018475_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|1018507_1019242_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000233000.1\|1019222_1020092_-	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
WP_000205227.1\|1020106_1020331_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002390960.1\|1020473_1022018_-	recombinase family protein	A0A2K5B2B4	Erysipelothrix_phage	1.8e-256	88.7
WP_000323438.1\|1022037_1022454_-	recombinase	A0A2K5B2B3	Erysipelothrix_phage	1.2e-71	98.6
WP_002354485.1\|1022590_1023277_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000599739.1\|1023474_1024080_+	cell filamentation protein	NA	NA	NA	NA
WP_000170424.1\|1024095_1024668_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_073120187.1\|1025140_1025713_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_086953888.1\|1025813_1026976_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002322130.1\|1027016_1027271_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_000199136.1\|1027381_1027636_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_001196543.1\|1027828_1028104_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|1028075_1029029_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1
WP_000947691.1\|1029640_1031134_+	replication protein RepR	NA	NA	NA	NA
WP_000053907.1\|1031268_1031565_+	replication control protein PrgN	NA	NA	NA	NA
WP_000222573.1\|1031588_1032548_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	26.8
WP_002354485.1\|1033404_1034091_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002354485.1\|1035286_1035973_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002295395.1\|1037026_1038403_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002295394.1\|1038803_1040384_+	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	5.1e-33	28.4
WP_002297218.1\|1040560_1041856_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002287661.1\|1042103_1042328_+	hypothetical protein	NA	NA	NA	NA
WP_002290825.1\|1042532_1042853_-	DUF1827 family protein	NA	NA	NA	NA
WP_002287598.1\|1043000_1045235_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.1e-127	39.1
WP_002287602.1\|1045713_1045980_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_002287603.1\|1045979_1047707_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	9.3e-20	35.9
WP_002287604.1\|1047837_1048917_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002287605.1\|1048933_1050157_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002287606.1\|1050245_1051133_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_002287607.1\|1051218_1051449_+	YkuJ family protein	NA	NA	NA	NA
WP_002287608.1\|1051505_1052471_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_002287610.1\|1052776_1053217_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002287612.1\|1053226_1054189_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_002287614.1\|1054241_1054466_+	acyl carrier protein	NA	NA	NA	NA
WP_002296950.1\|1054572_1055490_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_002287617.1\|1055501_1056239_+	3-oxoacyl-[acyl-carrier-protein] reductase	Q06VL0	Trichoplusia_ni_ascovirus	4.1e-17	29.7
WP_106914368.1\|1056257_1057493_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_002287620.1\|1057495_1057972_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_002287621.1\|1057996_1058416_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_002287622.1\|1058423_1059803_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_002287623.1\|1059803_1060673_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_002287624.1\|1060665_1061451_+	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_002287626.1\|1061630_1062158_+	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_002302927.1\|1062154_1063264_+	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
WP_002287630.1\|1063279_1063591_+	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_002322947.1\|1063603_1064251_+	nicotinate-nucleotide adenylyltransferase	G3MA22	Bacillus_virus	4.8e-22	33.2
WP_002287635.1\|1064234_1064828_+	HD domain-containing protein	NA	NA	NA	NA
WP_033582077.1\|1064884_1065208_+	ribosome silencing factor	NA	NA	NA	NA
WP_002287639.1\|1065211_1065952_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002287640.1\|1066168_1067320_+	nucleotidyltransferase	NA	NA	NA	NA
WP_002287641.1\|1067450_1068170_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002287642.1\|1068348_1068996_+	hypothetical protein	NA	NA	NA	NA
WP_002287644.1\|1069088_1071368_-	AAA family ATPase	NA	NA	NA	NA
WP_002287647.1\|1071645_1073469_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.5e-64	29.1
WP_002287649.1\|1073515_1073695_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_002287651.1\|1074031_1075972_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.3e-114	35.2
WP_002287653.1\|1076195_1077044_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002302928.1\|1077337_1079491_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_002297218.1\|1079723_1081019_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002296740.1\|1081198_1082008_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002295362.1\|1082300_1083737_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.8e-43	29.0
WP_002290958.1\|1083906_1085103_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_002295359.1\|1085164_1085350_-	YjzD family protein	NA	NA	NA	NA
WP_002311576.1\|1085580_1088895_+	DNA polymerase III subunit alpha	R4TB75	Streptomyces_phage	1.8e-149	33.0
WP_002304759.1\|1089062_1090025_+	6-phosphofructokinase	NA	NA	NA	NA
WP_002295355.1\|1090098_1091883_+	pyruvate kinase	NA	NA	NA	NA
WP_000122610.1\|1091986_1093279_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9

DBSCAN-SWA_5

1106699 : 1157789

Lysinibacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297185.1\|1106699_1107995_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002317647.1\|1108316_1109192_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002288811.1\|1109295_1110060_+	carbohydrate deacetylase	NA	NA	NA	NA
WP_002298714.1\|1110076_1111489_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002288815.1\|1112842_1113301_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_045136022.1\|1113592_1114894_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002295336.1\|1114920_1115181_+	diacylglycerol kinase	NA	NA	NA	NA
WP_002288819.1\|1116179_1117415_-	glycosyl transferase	NA	NA	NA	NA
WP_002288821.1\|1117981_1118809_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002288823.1\|1119081_1119852_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_045136021.1\|1120069_1121137_+	L-ascorbate 6-phosphate lactonase	NA	NA	NA	NA
WP_010728432.1\|1121154_1121616_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002324626.1\|1121635_1123120_+	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_045136020.1\|1123162_1123462_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002288832.1\|1123476_1124115_+	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	NA	NA	NA	NA
WP_002289048.1\|1124119_1124980_+	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_002295327.1\|1124969_1125680_+	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_002289050.1\|1125911_1126346_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289065.1\|1126442_1126742_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1127045_1128224_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002289063.1\|1128356_1128551_-	hypothetical protein	NA	NA	NA	NA
WP_002295324.1\|1128778_1129540_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_002307018.1\|1129859_1130105_+	hypothetical protein	NA	NA	NA	NA
WP_002307017.1\|1130288_1131038_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.1e-17	26.7
WP_044383301.1\|1131223_1131928_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002307014.1\|1131967_1132525_+	SIS domain-containing protein	NA	NA	NA	NA
WP_106914365.1\|1132989_1134168_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002307011.1\|1135016_1135448_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_010728428.1\|1135461_1136907_+	PTS mannitol transporter subunit IICB	NA	NA	NA	NA
WP_010728427.1\|1137192_1138818_+	acetyltransferase	A0A193GZ69	Enterobacter_phage	4.3e-19	30.6
WP_002307007.1\|1139449_1139803_+	hypothetical protein	NA	NA	NA	NA
WP_101699706.1\|1141855_1143034_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002297404.1\|1143927_1145178_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002288285.1\|1145587_1145887_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_044383392.1\|1145959_1147321_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002288318.1\|1147342_1147603_+	hypothetical protein	NA	NA	NA	NA
WP_002288278.1\|1147616_1148369_+	aldolase	NA	NA	NA	NA
WP_002294361.1\|1148462_1149068_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002297941.1\|1149123_1150098_-	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_077940815.1\|1150475_1151255_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002294365.1\|1151321_1152593_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_002297943.1\|1152745_1154143_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_002289467.1\|1154223_1154664_+	universal stress protein	NA	NA	NA	NA
WP_002289468.1\|1154810_1155137_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_002289470.1\|1155137_1155887_+	hypothetical protein	NA	NA	NA	NA
WP_002302217.1\|1155912_1156323_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002297271.1\|1156829_1157789_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1301005 : 1310143

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002348948.1\|1301005_1302394_+	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	7.0e-10	26.0
WP_002297115.1\|1302557_1302935_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1303190_1303919_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1303918_1304173_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1304174_1304846_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1304846_1307069_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1307053_1308493_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002321731.1\|1308524_1309568_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1309564_1310143_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_7

1582284 : 1624126

Lysinibacillus_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297218.1\|1582284_1583580_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002290686.1\|1583798_1584041_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002295944.1\|1584072_1584630_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002295945.1\|1584642_1584831_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002295947.1\|1584843_1585410_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002287525.1\|1585844_1586993_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|1587009_1587414_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002295138.1\|1588530_1589004_+	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_002295139.1\|1589012_1589240_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002295142.1\|1589875_1590247_+	hypothetical protein	NA	NA	NA	NA
WP_002291278.1\|1590502_1590745_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002296679.1\|1590776_1591679_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002291274.1\|1591691_1591880_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002296677.1\|1591893_1592457_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002296675.1\|1592494_1593388_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	8.9e-59	46.0
WP_002296674.1\|1593465_1594404_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002296672.1\|1594437_1594788_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002296671.1\|1594820_1595723_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002296670.1\|1595715_1596573_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
WP_002296669.1\|1596906_1597716_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002296667.1\|1597755_1598253_+	cysteine hydrolase	NA	NA	NA	NA
WP_002321681.1\|1598897_1599221_+	hypothetical protein	NA	NA	NA	NA
WP_002296665.1\|1599384_1599639_+	hypothetical protein	NA	NA	NA	NA
WP_002296663.1\|1599708_1599954_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296662.1\|1600029_1600395_+	hypothetical protein	NA	NA	NA	NA
WP_002303842.1\|1600455_1601019_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1601670_1602966_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002302440.1\|1603204_1604506_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002293303.1\|1604609_1604810_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3
WP_002296656.1\|1605561_1606275_-	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
WP_002296654.1\|1606267_1607353_-	mannonate dehydratase	NA	NA	NA	NA
WP_002296653.1\|1607369_1607813_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002321678.1\|1607846_1608200_-	hypothetical protein	NA	NA	NA	NA
WP_002296650.1\|1608311_1608713_-	hypothetical protein	NA	NA	NA	NA
WP_002296648.1\|1608749_1609259_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002303107.1\|1609280_1610138_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002296646.1\|1610155_1610989_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002303106.1\|1611002_1611800_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002321677.1\|1611832_1612117_-	alcohol dehydrogenase	NA	NA	NA	NA
WP_002296641.1\|1612113_1613115_-	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
WP_102993993.1\|1613116_1614019_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	1.8e-51	35.0
WP_002296639.1\|1614182_1615031_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002296638.1\|1615675_1615882_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296637.1\|1616083_1617085_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002311095.1\|1617089_1619003_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_002296634.1\|1619170_1619677_-	cysteine hydrolase	NA	NA	NA	NA
WP_002296633.1\|1619836_1620277_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002296632.1\|1620302_1621460_-	hypothetical protein	NA	NA	NA	NA
WP_002296631.1\|1621462_1621819_-	hypothetical protein	NA	NA	NA	NA
WP_002296629.1\|1622116_1623091_-	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_102993991.1\|1623286_1624126_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_8

1627277 : 1660069

Streptococcus_phage(30.0%)

transposase,integrase

attL 1631568:1631583|attR 1641289:1641304

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287107.1\|1627277_1628528_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296760.1\|1628669_1629665_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002289423.1\|1629682_1630237_-	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289422.1\|1630224_1630716_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289421.1\|1630708_1632577_-	HTH domain-containing protein	NA	NA	NA	NA
1631568:1631583	attL	NA	NA	NA	NA
WP_002289420.1\|1632595_1633396_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289418.1\|1633619_1633835_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002303864.1\|1633973_1634459_+	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|1634914_1635328_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002322258.1\|1635464_1635725_+	hypothetical protein	NA	NA	NA	NA
WP_002321532.1\|1635842_1636133_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1636378_1637557_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_060804964.1\|1637712_1638666_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002288357.1\|1638722_1639850_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_010729348.1\|1640067_1641210_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.5e-39	32.4
WP_010729347.1\|1641214_1641400_-	DUF3173 domain-containing protein	NA	NA	NA	NA
1641289:1641304	attR	NA	NA	NA	NA
WP_002353648.1\|1641753_1641999_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010729346.1\|1641992_1642394_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_010729345.1\|1642580_1644389_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	2.3e-154	48.4
WP_010729344.1\|1644411_1646178_-	hypothetical protein	NA	NA	NA	NA
WP_010729343.1\|1646190_1646985_-	HAD family hydrolase	NA	NA	NA	NA
WP_010729700.1\|1646994_1648371_-	MFS transporter	NA	NA	NA	NA
WP_010729341.1\|1648490_1649138_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_010729340.1\|1649221_1650649_-	glucuronate isomerase	NA	NA	NA	NA
WP_010729339.1\|1650722_1651802_-	mannonate dehydratase	NA	NA	NA	NA
WP_010729338.1\|1651804_1653436_-	mannitol dehydrogenase family protein	NA	NA	NA	NA
WP_010729337.1\|1653739_1654411_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287525.1\|1654727_1655876_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|1655892_1656297_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_000122610.1\|1657091_1658384_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_159037556.1\|1658526_1658724_-	hypothetical protein	NA	NA	NA	NA
WP_000195429.1\|1658896_1660069_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0

DBSCAN-SWA_9

1697718 : 1753507

Lysinibacillus_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288335.1\|1697718_1698420_-\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002297218.1\|1698624_1699920_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288333.1\|1700165_1700606_-	lipoprotein	NA	NA	NA	NA
WP_002288331.1\|1700734_1701661_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	5.1e-33	41.3
WP_002288329.1\|1701660_1703034_-	Replication initiation and membrane attachment	NA	NA	NA	NA
WP_002288327.1\|1703056_1703548_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_002288325.1\|1703859_1704192_-	hypothetical protein	NA	NA	NA	NA
WP_002288324.1\|1704243_1704873_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_002288323.1\|1704836_1705673_-	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	1.8e-24	30.2
WP_002296395.1\|1705717_1708363_-	DNA polymerase I	F8WQ35	Bacillus_phage	3.0e-54	35.7
WP_002296397.1\|1708488_1709172_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_002296398.1\|1709164_1709650_-	dehydratase	NA	NA	NA	NA
WP_002303667.1\|1710058_1711399_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.1e-66	36.0
WP_002296400.1\|1711498_1712833_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_002296401.1\|1712963_1713725_-	YdcF family protein	NA	NA	NA	NA
WP_002296402.1\|1713740_1714223_-	SprT family protein	NA	NA	NA	NA
WP_002296403.1\|1714242_1716423_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_002296404.1\|1716566_1717298_-	serine/threonine protein phosphatase	A7KV25	Bacillus_phage	1.7e-15	30.8
WP_002296405.1\|1717366_1718308_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_002296407.1\|1718487_1718856_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_002297218.1\|1719218_1720514_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002295194.1\|1720988_1722380_-	L-cystine transporter	NA	NA	NA	NA
WP_002291995.1\|1722592_1722979_-	DUF1149 family protein	NA	NA	NA	NA
WP_002295196.1\|1723034_1723658_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_002295197.1\|1723721_1724390_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_002322028.1\|1724401_1724842_-	hypothetical protein	NA	NA	NA	NA
WP_002295199.1\|1724900_1725572_-	transcriptional regulator	NA	NA	NA	NA
WP_002287525.1\|1725757_1726906_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|1726922_1727327_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002295200.1\|1727647_1728046_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_002296408.1\|1728042_1728816_-	DUF1538 domain-containing protein	NA	NA	NA	NA
WP_002296409.1\|1728812_1729496_-	DUF1538 domain-containing protein	NA	NA	NA	NA
WP_002289130.1\|1729662_1730550_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002289132.1\|1730546_1731416_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002289133.1\|1731552_1732839_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002289134.1\|1733111_1733690_+	response regulator	NA	NA	NA	NA
WP_002289135.1\|1733689_1734619_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002289136.1\|1734615_1736352_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.0e-21	30.6
WP_002289137.1\|1736414_1737251_-	prephenate dehydratase	NA	NA	NA	NA
WP_002289138.1\|1737247_1737757_-	shikimate kinase	NA	NA	NA	NA
WP_002289139.1\|1737749_1739045_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_002289140.1\|1739057_1740149_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_002289142.1\|1740165_1741332_-	chorismate synthase	A0A291AU41	Pandoravirus	1.6e-39	35.3
WP_002289143.1\|1741333_1742398_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_002289144.1\|1742430_1743453_-	3-deoxy-7-phosphoheptulonate synthase	NA	NA	NA	NA
WP_002289516.1\|1744111_1745086_-	beta-galactosidase	NA	NA	NA	NA
WP_002289518.1\|1745066_1746950_-	glycoside hydrolase family 2	L0N6M2	Herpes_simplex_virus	1.1e-98	34.4
WP_002296412.1\|1746967_1749193_-	alpha-galactosidase	NA	NA	NA	NA
WP_002296414.1\|1749307_1750342_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002296415.1\|1750408_1751422_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	7.9e-11	23.3
WP_002288466.1\|1751499_1751688_-	hypothetical protein	A0A218MNE0	uncultured_virus	2.6e-08	50.9
WP_002297185.1\|1752211_1753507_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_10

1838668 : 1891230

unidentified_phage(14.29%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002347409.1\|1838668_1840378_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002294136.1\|1840445_1841714_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_106914070.1\|1841874_1842675_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|1842671_1843484_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002293875.1\|1843678_1844236_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|1844238_1844961_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|1845096_1845978_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|1846076_1846859_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|1847217_1847697_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326249.1\|1847913_1849005_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002293884.1\|1848997_1849783_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002293885.1\|1850128_1851820_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	9.9e-75	32.8
WP_002288434.1\|1852241_1853189_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|1853303_1854323_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|1854413_1855643_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|1856103_1856805_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002297185.1\|1856976_1858272_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002301319.1\|1858935_1859952_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288445.1\|1859948_1860413_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288446.1\|1860419_1860962_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|1860945_1861770_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|1861858_1862839_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|1862862_1864347_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|1864358_1865348_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1865595_1865763_+	DUF3042 family protein	NA	NA	NA	NA
WP_002288458.1\|1865824_1867636_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1867632_1867998_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1868160_1868556_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1868573_1869536_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1869535_1869748_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|1869768_1870467_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1870486_1871029_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002301321.1\|1871160_1872165_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1872161_1873151_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|1873147_1873954_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1874119_1875076_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1875152_1875671_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1875758_1875908_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1876135_1876582_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002288533.1\|1876776_1878672_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002303934.1\|1878996_1879971_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002296332.1\|1880536_1881103_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002296334.1\|1881358_1882690_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1882655_1883006_+	hypothetical protein	NA	NA	NA	NA
WP_002297629.1\|1883097_1883517_-	cupin domain-containing protein	NA	NA	NA	NA
WP_002296337.1\|1883517_1883862_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002301399.1\|1884127_1885087_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287776.1\|1885276_1885873_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|1885996_1887796_+	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1888073_1888286_-	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|1889149_1890109_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002326704.1\|1890321_1891230_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1896220 : 1954250

Streptococcus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288577.1\|1896220_1896706_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288579.1\|1896728_1897487_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|1897502_1898681_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002303943.1\|1898910_1901031_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002297218.1\|1901211_1902507_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002296838.1\|1902775_1903501_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1903490_1904000_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1904069_1905518_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288590.1\|1905517_1906234_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|1906214_1906565_-	SdpI family protein	NA	NA	NA	NA
WP_106914072.1\|1906708_1907482_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002302293.1\|1908238_1908541_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1908822_1910001_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|1910337_1910577_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1910938_1911199_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1911383_1911881_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1912010_1912721_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1912733_1914398_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|1914602_1915265_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|1915274_1916090_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1916351_1916795_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|1916928_1917267_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002302962.1\|1917254_1917632_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002322902.1\|1917855_1919049_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|1919214_1919637_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002303955.1\|1920226_1920682_+	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|1920843_1922016_-	class C sortase	NA	NA	NA	NA
WP_002303963.1\|1925146_1927474_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288970.1\|1928316_1928610_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002286913.1\|1928867_1929215_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293717.1\|1929350_1930112_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002293716.1\|1930101_1930623_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002297190.1\|1930792_1931584_-	hypothetical protein	NA	NA	NA	NA
WP_002290277.1\|1931708_1931960_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|1931971_1932247_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|1932499_1933054_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|1933132_1933654_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|1933657_1934236_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|1934347_1935766_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|1935786_1936125_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|1936084_1936588_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|1936718_1937423_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002303966.1\|1937419_1939156_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002297196.1\|1939258_1941730_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.0e-45	28.8
WP_002326707.1\|1942002_1943277_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.5e-54	35.9
WP_002289807.1\|1943563_1944454_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002300070.1\|1944650_1945133_-	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|1945340_1945706_+	hypothetical protein	NA	NA	NA	NA
WP_000195429.1\|1945928_1947101_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_106914372.1\|1947071_1947446_-	hypothetical protein	NA	NA	NA	NA
WP_002301399.1\|1948187_1949147_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002301623.1\|1949269_1950244_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	7.1e-25	31.8
WP_002297404.1\|1950653_1951904_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295273.1\|1952189_1952447_+	hypothetical protein	NA	NA	NA	NA
WP_008266934.1\|1952678_1953092_-	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002295743.1\|1953341_1954250_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

2066899 : 2114424

Streptococcus_phage(30.77%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289566.1\|2066899_2067250_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_002322015.1\|2067249_2067567_-	PspC domain-containing protein	NA	NA	NA	NA
WP_002289495.1\|2067866_2069435_-	daptomycin-sensing surface protein LiaX	NA	NA	NA	NA
WP_002289493.1\|2069534_2070302_-	YibE/F family protein	NA	NA	NA	NA
WP_106914373.1\|2070298_2071318_-	YibE/F family protein	NA	NA	NA	NA
WP_002289490.1\|2071567_2072245_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_002326757.1\|2072257_2073016_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.9e-20	31.3
WP_002289486.1\|2073031_2073838_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-13	28.4
WP_002326758.1\|2073852_2074737_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_002292761.1\|2074736_2075657_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_002292763.1\|2075771_2076629_-	phosphate ABC transporter substrate-binding protein PstS	NA	NA	NA	NA
WP_002304589.1\|2076965_2078414_-	cardiolipin synthase	NA	NA	NA	NA
WP_002317241.1\|2078565_2079459_-	ABC transporter permease	NA	NA	NA	NA
WP_002292768.1\|2079442_2080129_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.5e-29	34.7
WP_096157771.1\|2080233_2081335_-	peptide chain release factor 2	NA	NA	NA	NA
WP_002289770.1\|2081460_2083995_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_002289771.1\|2084216_2084768_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_002304587.1\|2084895_2085615_-	ComF family protein	NA	NA	NA	NA
WP_002290048.1\|2085611_2086925_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	1.4e-63	37.9
WP_002292778.1\|2087005_2087326_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002294988.1\|2087433_2087721_-	hypothetical protein	NA	NA	NA	NA
WP_002304585.1\|2087846_2088491_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.6e-49	50.8
WP_002292782.1\|2088549_2089257_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002288997.1\|2090017_2090251_-	DUF2969 domain-containing protein	NA	NA	NA	NA
WP_002288998.1\|2090367_2091252_-	ROK family protein	NA	NA	NA	NA
WP_002294994.1\|2091336_2091804_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289000.1\|2091988_2092285_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	3.0e-19	58.0
WP_002289019.1\|2092419_2092596_-	DNA-directed RNA polymerase subunit beta	NA	NA	NA	NA
WP_002289003.1\|2092608_2093910_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_002289004.1\|2094006_2094237_-	DUF1146 domain-containing protein	NA	NA	NA	NA
WP_002297218.1\|2094535_2095831_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_049058656.1\|2096085_2097381_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.5e-09	20.7
WP_060804931.1\|2097622_2098921_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.6e-54	37.4
WP_002289005.1\|2099291_2099714_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_002289006.1\|2099727_2101134_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_060805069.1\|2101156_2102059_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_002317884.1\|2102072_2103629_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_002292794.1\|2103651_2104194_-	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_002292796.1\|2104180_2104705_-	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_002292797.1\|2104795_2105011_-	ATP synthase F0 subunit C	NA	NA	NA	NA
WP_002300474.1\|2105063_2105783_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_002292799.1\|2106084_2106549_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.0e-45	58.5
WP_002312230.1\|2106570_2108928_-	ribonuclease R	Q0GXV6	Lactococcus_phage	6.8e-98	41.7
WP_002289016.1\|2108930_2109677_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002289017.1\|2109788_2110025_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_002296443.1\|2110142_2110421_-	N-acetyltransferase	NA	NA	NA	NA
WP_002317887.1\|2110533_2111502_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002326761.1\|2111784_2112693_+	purine nucleosidase	NA	NA	NA	NA
WP_002287522.1\|2112854_2113259_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002287525.1\|2113275_2114424_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4

DBSCAN-SWA_13

2181722 : 2187395

uncultured_Caudovirales_phage(50.0%)

portal,head,terminase,tail,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296483.1\|2181722_2182058_-\|head	phage head closure protein	V5UQC7	Enterococcus_phage	4.7e-13	35.6
WP_002296484.1\|2182044_2182329_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002296485.1\|2182384_2183908_-\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
WP_002296486.1\|2183900_2185076_-\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002317249.1\|2185079_2185265_-	hypothetical protein	NA	NA	NA	NA
WP_002296487.1\|2185230_2186925_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8
WP_002296488.1\|2186921_2187395_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA

DBSCAN-SWA_14

2412313 : 2445765

uncultured_virus(15.38%)

bacteriocin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296840.1\|2412313_2413501_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002288864.1\|2413913_2415539_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002288862.1\|2415589_2415874_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288860.1\|2416098_2416761_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002288858.1\|2416836_2418129_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002288856.1\|2418298_2418928_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_002288854.1\|2419030_2419840_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
WP_002288853.1\|2419894_2420764_-	hypothetical protein	NA	NA	NA	NA
WP_002288852.1\|2420764_2422081_-	hypothetical protein	NA	NA	NA	NA
WP_002288851.1\|2422077_2423913_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.0e-37	37.7
WP_002288850.1\|2423917_2424622_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_002288847.1\|2424811_2425672_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	24.4
WP_002322652.1\|2425658_2426228_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_000222572.1\|2426857_2427811_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002321654.1\|2427807_2427954_-\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002287810.1\|2428057_2428369_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002304799.1\|2428370_2428568_-	enterocin	NA	NA	NA	NA
WP_002287807.1\|2428961_2430689_-	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002287805.1\|2430681_2431875_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287801.1\|2432061_2432706_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002290587.1\|2432799_2432934_-	hypothetical protein	NA	NA	NA	NA
WP_002287799.1\|2432935_2435068_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_002287797.1\|2435064_2435538_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287795.1\|2435938_2436163_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287793.1\|2436321_2438481_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287792.1\|2438530_2439496_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287791.1\|2439584_2440724_-	AI-2E family transporter	NA	NA	NA	NA
WP_002287788.1\|2441032_2441746_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287787.1\|2441999_2442701_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002290558.1\|2442934_2444467_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002295743.1\|2444856_2445765_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

2739594 : 2796672

Streptococcus_phage(63.64%)

tRNA,transposase,integrase

attL 2747999:2748014|attR 2794082:2794097

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287490.1\|2739594_2740578_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_002287492.1\|2740993_2741764_-	ABC transporter permease	NA	NA	NA	NA
WP_002287494.1\|2741756_2742692_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.1e-26	35.1
WP_106914381.1\|2743285_2744935_-	DNA mismatch repair protein MutS	A0A0N9R0S5	Chrysochromulina_ericina_virus	6.4e-18	29.2
WP_002287497.1\|2745129_2746026_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002287499.1\|2746018_2746699_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-24	30.8
WP_002287500.1\|2746699_2747482_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002287502.1\|2747474_2748392_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-42	43.8
2747999:2748014	attL	NA	NA	NA	NA
WP_002287509.1\|2748394_2748679_-	hypothetical protein	NA	NA	NA	NA
WP_002305526.1\|2749466_2752694_+	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002303694.1\|2752805_2753120_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.9e-24	51.5
WP_002302502.1\|2753132_2753507_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	6.4e-35	63.9
WP_002305525.1\|2753507_2753861_+	hypothetical protein	NA	NA	NA	NA
WP_002330682.1\|2753929_2754946_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.6e-104	58.7
WP_002330681.1\|2755539_2757414_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_096929203.1\|2757539_2757896_+	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	1.3e-45	84.6
WP_002302494.1\|2757940_2759083_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.6e-129	62.4
WP_002305523.1\|2759617_2760802_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	8.3e-145	63.2
WP_002302478.1\|2760798_2760912_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002298822.1\|2760940_2761162_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002302474.1\|2761174_2761678_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	2.0e-52	60.4
WP_002302472.1\|2761804_2762842_+	hypothetical protein	NA	NA	NA	NA
WP_002303688.1\|2762856_2764554_+	ThiF family protein	NA	NA	NA	NA
WP_002302466.1\|2764546_2765008_+	hypothetical protein	NA	NA	NA	NA
WP_002302464.1\|2765020_2765881_+	hypothetical protein	NA	NA	NA	NA
WP_106914388.1\|2765918_2766296_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	2.7e-41	65.9
WP_106914365.1\|2766324_2767503_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002302460.1\|2767627_2770075_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.4
WP_002302459.1\|2770079_2772188_+	FUSC family protein	A0A1S5SF30	Streptococcus_phage	4.5e-178	60.9
WP_002302457.1\|2772184_2773189_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	64.8
WP_002302456.1\|2773207_2774119_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.0e-62	41.1
WP_002297343.1\|2774780_2774996_-	hypothetical protein	NA	NA	NA	NA
WP_094029191.1\|2775254_2775422_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	4.4e-12	75.0
WP_002303678.1\|2777753_2778425_-	hypothetical protein	A0A0C5K996	Enterococcus_phage	4.1e-08	33.9
WP_010727027.1\|2778773_2780225_-	peptidoglycan DD-metalloendopeptidase family protein	A0A075BS18	Microcystis_phage	1.9e-18	46.1
WP_002303673.1\|2780336_2781680_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_106914382.1\|2781813_2787270_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_002303670.1\|2787886_2788192_-	hypothetical protein	NA	NA	NA	NA
WP_002303669.1\|2788336_2789542_-	YSIRK-targeted surface antigen transcriptional regulator	NA	NA	NA	NA
WP_002302419.1\|2790235_2790622_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002302418.1\|2790719_2790911_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002305515.1\|2791424_2791757_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002303668.1\|2791666_2791870_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_002348988.1\|2792053_2792209_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002303667.1\|2792484_2793825_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.1e-66	36.0
WP_002330794.1\|2795797_2796016_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
2794082:2794097	attR	NA	NA	NA	NA
WP_106914383.1\|2796036_2796672_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-17	35.1

DBSCAN-SWA_16

2825111 : 2885699

Streptococcus_phage(22.22%)

transposase,integrase,protease

attL 2832836:2832851|attR 2853301:2853316

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002351803.1\|2825111_2826431_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_002303714.1\|2827171_2828152_-	ornithine cyclodeaminase family protein	NA	NA	NA	NA
WP_002302368.1\|2828164_2829043_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_002303713.1\|2829058_2829859_-	TrmB family transcriptional regulator	NA	NA	NA	NA
WP_002303711.1\|2831250_2831577_+\|transposase	transposase	Q9JMN8	Wolbachia_phage	8.1e-10	34.6
WP_002303710.1\|2831584_2832493_+\|transposase	IS110 family transposase	NA	NA	NA	NA
2832836:2832851	attL	NA	NA	NA	NA
WP_071875986.1\|2833121_2833373_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_002302358.1\|2833914_2834073_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002303709.1\|2834144_2835371_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_002287505.1\|2835459_2835852_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_002295975.1\|2835867_2836311_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_002297290.1\|2836829_2837297_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_076713753.1\|2837416_2838955_-	gluconokinase	NA	NA	NA	NA
WP_002288144.1\|2839034_2839721_+	prepilin peptidase	NA	NA	NA	NA
WP_002288119.1\|2839921_2840449_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002288121.1\|2840532_2841210_-	beta-phosphoglucomutase	A0A1D8KNV9	Synechococcus_phage	1.6e-07	23.2
WP_002288122.1\|2841206_2842337_-	glycerate kinase	W6LM47	Streptococcus_phage	1.6e-73	51.6
WP_002288124.1\|2842336_2844520_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002288127.1\|2844516_2845542_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002288129.1\|2845586_2846414_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_002288131.1\|2846410_2847478_-	zinc-binding alcohol dehydrogenase	NA	NA	NA	NA
WP_002288133.1\|2847503_2848340_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288134.1\|2848336_2849206_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002288135.1\|2849275_2850559_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002288137.1\|2850572_2852258_-	sucrose phosphorylase	NA	NA	NA	NA
WP_002288139.1\|2852532_2853558_+	LacI family transcriptional regulator	NA	NA	NA	NA
2853301:2853316	attR	NA	NA	NA	NA
WP_002340553.1\|2854152_2857806_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.1e-62	24.9
WP_025479755.1\|2857884_2861511_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	4.5e-48	24.6
WP_002289394.1\|2862229_2863198_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_048946534.1\|2863215_2864121_+	ABC transporter permease	NA	NA	NA	NA
WP_002289388.1\|2864117_2864924_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.3e-08	25.1
WP_010706310.1\|2865080_2866049_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_002289384.1\|2866365_2866890_-	DUF664 domain-containing protein	NA	NA	NA	NA
WP_060804656.1\|2867176_2868931_+	collagen-binding MSCRAMM adhesin Scm	NA	NA	NA	NA
WP_002296623.1\|2869037_2870333_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002289380.1\|2870596_2871583_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_002304808.1\|2871605_2872172_-	Gx transporter family protein	NA	NA	NA	NA
WP_002294810.1\|2872185_2872602_-	NusG domain II-containing protein	NA	NA	NA	NA
WP_002289023.1\|2873058_2874993_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_002289025.1\|2875294_2876230_+	FMN-binding protein	NA	NA	NA	NA
WP_002294811.1\|2876319_2877423_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_002289029.1\|2877435_2878389_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_002289031.1\|2879323_2880670_-	glutathione-disulfide reductase	NA	NA	NA	NA
WP_021415055.1\|2880803_2882045_-	U32 family peptidase	Q6DW11	Phage_TP	1.2e-42	32.9
WP_002289033.1\|2882062_2882986_-	U32 family peptidase	NA	NA	NA	NA
WP_002289035.1\|2883206_2885699_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A0A8J958	Klebsiella_phage	9.0e-125	38.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP027505

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1656 : 9330

Streptococcus_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|1656_2343_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001814874.1\|2482_2566_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_106914398.1\|2690_3392_+	23S ribosomal RNA methyltransferase Erm	E4ZFQ0	Streptococcus_phage	2.4e-123	99.1
WP_002354485.1\|3425_4112_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001280781.1\|4812_5508_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_002305818.1\|5485_6640_+	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_000122610.1\|6737_8030_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_001059542.1\|8361_9330_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP027503

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP027503_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP027503_1

509-588

Orphan

Consensus_repeat	Method
AAACCCTTGATAATACTGGAAATGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP027503_1

>merge|NZ_CP027503|1|509-588|CRISPRCasFinder
AAACCCTTGATAATACTGGAAATGCGGAAATCGCACGTCGAGAAAAAACAGCTGAAACCCTTGATAACACTGGAAATGCG

>NZ_CP027503|1|1|509-588|CRISPRCasFinder
AAACCCTTGATAATACTGGAAATGCG	GAAATCGCACGTCGAGAAAAAACAGCTG
AAACCCTTGATAACACTGGAAATGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP027503.1\|WP_069314875.1\|4945_6922_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP027503.1\|WP_002314399.1\|3135_3477_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP027503.1\|WP_002296346.1\|3896_4136_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027503.1\|WP_002318076.1\|1896_2229_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027503.1\|WP_069314873.1\|7686_8511_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027503.1\|WP_069314874.1\|6934_7690_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP027503.1\|WP_002296227.1\|2819_3149_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027503.1\|WP_069314872.1\|8800_10912_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|275067
NZ_CP027503.1\|WP_002299885.1\|3590_3830_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP027503.1\|WP_002322905.1\|4221_4893_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680

Protein	Function_ID	Function_description	E-value
NZ_CP027503.1\|WP_069314874.1\|6934_7690_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.96266e-60
NZ_CP027503.1\|WP_069314875.1\|4945_6922_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	5.62922e-31
NZ_CP027503.1\|WP_002314399.1\|3135_3477_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	4.95939e-49
NZ_CP027503.1\|WP_069314872.1\|8800_10912_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|275067	TIGR04226, Fimbrial_subunit_type_2, fimbrial isopeptide formation D2 domain. The Streptococcus Pneumoniae pilus backbone protein, RrgB, has three tandem domains with Lys-to-Asn isopeptide bonds, but these three regions are extremely divergent in sequence. This model represents the homology domain family of the D2 domain. It occurs just once in many surface proteins but up to twenty times in some pilin subunit proteins. Three of every four members have the typical Gram-positive C-terminal motif, LPXTG, although in many cases this motif may be involved in pilin subunit cross-linking rather than cell wall attachment. Proteins with this domain include fimbrial proteins with lectin-like adhesion functions, and the majority of characterized members are involved in surface adhesion to host structures.	3.16329e-08
NZ_CP027503.1\|WP_002322905.1\|4221_4893_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	2.55767e-44

>NZ_CP027503.1|WP_002318076.1|1896_2229_+|hypothetical-protein
MSYTGILSLEDICHYGKRCTATEKITKKLSTGQSKAVVQCKKYIIQKDKVSEEMIYYTGKRKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP027503.1|WP_002296227.1|2819_3149_+|hypothetical-protein
MIQKFAKMSKTAWIEKLENDLSVMRLAPKKFKREIAEKEAILSVLNAVDDKCPVKISFSDIATIIEGIYYGEVDEEISSTKDLLDFLDKNKDTFIVLTDYEEVTTNEKL
>NZ_CP027503.1|WP_002314399.1|3135_3477_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP027503.1|WP_002299885.1|3590_3830_+|hypothetical-protein
MARPVLEAMDMDTLTKGRYVQLLARGYSPKDVFKSLSKGTDMEKERLRKEFDYWRTHNGIKDLKPARPVIKRKKKITQD
>NZ_CP027503.1|WP_002296346.1|3896_4136_+|hypothetical-protein
MNYEEIENRKKVSKEMEEKLLKTMKQKHLKRLSVMQYINDMQITGKEKACLLGSMKNFEQLRRTYVKKSSNCQLLLEVS
>NZ_CP027503.1|WP_002322905.1|4221_4893_+|class-A-sortase
MRKWLFGFLGVALIVFCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPGYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP027503.1|WP_069314875.1|4945_6922_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYQVHAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVQDVEDKGSNSEYVKNATNKITSAVDENGEITFTDQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDKTGSGFLKNIHLYPKNIVSKLSFELTKFGDDGADQSKQTLLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDQEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYSNNPFNQEEHHEKTKADAVTYGAKFLKADGGLFGTGIKATPLEGAEFAVKNAEGKYYGGLVDTDKDGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPTGYQKLTEDIAFKVNKNSFKEENRITVKNNQKAAIPLTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP027503.1|WP_069314874.1|6934_7690_+|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPSVETNVAKFQQQQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFCVPIIFIYKKIRRRSE
>NZ_CP027503.1|WP_069314873.1|7686_8511_+|hypothetical-protein
MNKRKWLFVCVAALFSTAAYSQLSFADSSDSSTTQTIDNSITAPSETDSSENTTEETADSNISFTESTNPTSESSSETSEKPQDVEDTQVIKQAIHIQKIISSNQINNQGSQVAQQEGINGAKFIVYDITNILEEMSQDDNEKNQPVEIIESKLKDRAKKLSYDQLKKVAEGETKTIDDQEGVIEFSIEVPANKKQAYYIVNESSPENISNSEDIVLLTPVSNEKGEFLTDVWLYPKSEKSEPKEEIKKVVSTGVKKNFFENCWEFFAQLFFDN
>NZ_CP027503.1|WP_069314872.1|8800_10912_+|isopeptide-forming-domain-containing-fimbrial-protein
MEGIMENKIHCTTGRVITLVLFLFLLLFARGTAVQALEKVDPSQIKENNNLVLYHDSDSLRNIEVTGINGFKILDEYSTKKQKVLAWPKVKDLKSTSKIVAHYQKVGTYLGKEIDCDVTFSNFVAHAGVNQDGLAKTINGKKYYNYLLFDKNIYRGFFMQSINVMNAKLEFKYAGTKTKVALSEPQPEIQSKMRSMRAAGIDLNDTFLSIYSLNGQYQQRVSWYNDNNESVGERNIDMREFVGYEKMGSLPYFVTTDTACAEYKAPALSTNNLTSKVVGGRAEKAYSSNDHFTDVVGADTYHRSGVTYTLQGASPTFMIGANTNSMMFSFDTALLWTPQPSKPTKEVFNKANTEEAAHNIDKKVIPQGSDVYYHIHQKFDALTVNTMNKYKSFKITDTFDNKNFDMVSDGEKYDGALWYVEANGTWKKADTGGKLTVSGNTVTYTASDSFLANAANYGRDYILQLHMRAKNDAKGIAPNVATVTFNNDPNKGTQKTNTVENYFSLKPNKKVEQDGKDVDGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDIASDHYKQFSIQDPVEDRLTYKEGSARVIDMSTGKDITSEGTLTYDSNSRTLKWEASADFLSKNLLDGREIQLIFTAKTPLNEELDIDNQAKVSVESIEKATNVVTIGVKPNLPQIIVPKTGSNHLVLTVIGSILFLTLASLGYVVLKLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	535-562	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	7565-7592	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	534-561	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	535-562	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135289	Enterococcus faecium isolate E7199 plasmid 3	6943-6970	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135334	Enterococcus faecium isolate E7471 plasmid 4	17550-17577	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP046078	Enterococcus faecium strain VRE plasmid p4_03A17012, complete sequence	10341-10368	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	151673-151700	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	535-562	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	535-562	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	2044-2071	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	53250-53277	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	19611-19638	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	508-535	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	23729-23756	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	23729-23756	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135309	Enterococcus faecium isolate E7240 plasmid 3	34007-34034	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	23729-23756	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	23729-23756	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP016165	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence	42882-42909	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	7565-7592	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	31483-31510	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	23729-23756	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	23729-23756	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	11086-11113	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	53945-53972	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	9918-9945	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135200	Enterococcus faecium isolate E6055 plasmid 4	4393-4420	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135261	Enterococcus faecium isolate E4457 plasmid 4	41932-41959	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	80048-80075	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135477	Enterococcus faecium isolate E8423 plasmid 3	11195-11222	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	52939-52966	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR135347	Enterococcus faecium isolate E8202 plasmid 4	5561-5588	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	46437-46464	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	9701-9728	1.0
NZ_CP027503_1	1.1\|535\|28\|NZ_CP027503\|CRISPRCasFinder	535-562	28	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	49352-49379	1.0

1. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

2. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

3. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

4. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

5. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135289 (Enterococcus faecium isolate E7199 plasmid 3) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

6. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135334 (Enterococcus faecium isolate E7471 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

7. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP046078 (Enterococcus faecium strain VRE plasmid p4_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

8. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

9. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

10. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

11. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

12. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

13. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

14. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

15. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

16. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

17. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135309 (Enterococcus faecium isolate E7240 plasmid 3) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

18. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

19. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

20. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP016165 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

21. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

22. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

23. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

24. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

25. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

26. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

27. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

28. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135200 (Enterococcus faecium isolate E6055 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

29. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135261 (Enterococcus faecium isolate E4457 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

30. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

31. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135477 (Enterococcus faecium isolate E8423 plasmid 3) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

32. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

33. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR135347 (Enterococcus faecium isolate E8202 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

34. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

35. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

36. spacer 1.1|535|28|NZ_CP027503|CRISPRCasFinder matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 0, identity: 1.0

gaaatcgcacgtcgagaaaaaacagctg	CRISPR spacer
gaaatcgcacgtcgagaaaaaacagctg	Protospacer
****************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage