CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	0 crisprs	NA	0	3
NZ_CP020487	Enterococcus faecium strain CFSAN059070 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
NZ_CP020484	Enterococcus faecium strain CFSAN059070 chromosome, complete genome	1 crisprs	DEDDh,cas2,RT,DinG,cas3,cas14j,csa3	0	11
NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	1 crisprs	cas14j,RT,DEDDh	2	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2672

Enterococcus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326767.1\|50_401_+	hypothetical protein	NA	NA	NA	NA
WP_073490843.1\|397_568_+	hypothetical protein	NA	NA	NA	NA
WP_001196543.1\|1471_1747_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|1718_2672_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1

DBSCAN-SWA_2

6825 : 14859

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001015311.1\|6825_7506_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002323245.1\|8126_9299_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_001280781.1\|9450_10146_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_002305818.1\|10123_11278_+	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_001059542.1\|11492_12461_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_001079845.1\|12453_13485_+	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
WP_000402347.1\|13490_14099_+	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
WP_001015311.1\|14178_14859_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

DBSCAN-SWA_3

20235 : 47988

Streptococcus_phage(68.42%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062587.1\|20235_20853_+	recombinase family protein	A0A219YA40	Aeromonas_phage	2.9e-16	36.6
WP_002331392.1\|22483_23131_-	type A-7 chloramphenicol O-acetyltransferase	A0A1X9I6V6	Streptococcus_phage	9.0e-69	54.4
WP_002331393.1\|23260_24199_-	replication initiation protein	NA	NA	NA	NA
WP_000635249.1\|26040_26280_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	6.8e-22	81.5
WP_106913981.1\|26328_26397_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_002323245.1\|26434_27607_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_001038795.1\|27868_28606_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	3.1e-134	99.2
WP_086953915.1\|29106_30445_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_032458614.1\|30599_31454_+	ParA family protein	A0A1X9I765	Streptococcus_phage	2.3e-152	97.9
WP_001835296.1\|31545_31761_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_002326825.1\|31778_32051_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
WP_002332783.1\|32052_32916_+	toxin zeta	NA	NA	NA	NA
WP_001067799.1\|33693_34374_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-126	99.1
WP_000205227.1\|34762_34987_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000233000.1\|35001_35871_+	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
WP_000662263.1\|35851_36586_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_001255866.1\|36618_37527_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_001015311.1\|38092_38773_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002349227.1\|38981_39194_+	hypothetical protein	NA	NA	NA	NA
WP_000357244.1\|39355_39874_+	YfbU family protein	NA	NA	NA	NA
WP_000774078.1\|39880_40393_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|40496_41792_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_002288897.1\|42185_42809_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-13	30.1
WP_001015311.1\|42904_43585_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000599739.1\|43782_44388_+	cell filamentation protein	NA	NA	NA	NA
WP_000170424.1\|44403_44976_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_002326781.1\|45227_45485_-	hypothetical protein	NA	NA	NA	NA
WP_002326780.1\|45610_46426_-	hypothetical protein	NA	NA	NA	NA
WP_002323245.1\|46815_47988_+\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020484

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020484_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020484_1

2401986-2402095

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020484_1

>merge|NZ_CP020484|1|2401986-2402095|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP020484|1|1|2401986-2402095|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020484.1\|WP_002294587.1\|2402322_2403012_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP020484.1\|WP_002291638.1\|2403115_2403538_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP020484.1\|WP_002294578.1\|2408520_2408673_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP020484.1\|WP_002287788.1\|2395284_2395998_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP020484.1\|WP_002294581.1\|2406716_2407604_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP020484.1\|WP_002294579.1\|2408326_2408497_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP020484.1\|WP_002294593.1\|2393836_2394976_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP020484.1\|WP_108676096.1\|2405524_2406544_-\|lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP020484.1\|WP_002294580.1\|2407680_2408226_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP020484.1\|WP_002294585.1\|2403880_2404549_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP020484.1\|WP_002294584.1\|2404561_2405434_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP020484.1\|WP_002287792.1\|2392782_2393748_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP020484.1\|WP_002290558.1\|2397186_2398719_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP020484.1\|WP_002294577.1\|2408834_2409479_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP020484.1\|WP_002287787.1\|2396251_2396953_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP020484.1\|WP_002291634.1\|2401409_2401913_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP020484.1\|WP_002294588.1\|2400988_2401357_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP020484.1\|WP_002303469.1\|2390573_2392733_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP020484.1\|WP_002294589.1\|2400193_2400883_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP020484.1\|WP_002303471.1\|2398909_2400112_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882

Protein	Function_ID	Function_description	E-value
NZ_CP020484.1\|WP_002294587.1\|2402322_2403012_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP020484.1\|WP_002291638.1\|2403115_2403538_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP020484.1\|WP_002294578.1\|2408520_2408673_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP020484.1\|WP_002287788.1\|2395284_2395998_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP020484.1\|WP_002294581.1\|2406716_2407604_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP020484.1\|WP_002294579.1\|2408326_2408497_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP020484.1\|WP_002294593.1\|2393836_2394976_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
NZ_CP020484.1\|WP_108676096.1\|2405524_2406544_-\|lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP020484.1\|WP_002294580.1\|2407680_2408226_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP020484.1\|WP_002294585.1\|2403880_2404549_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP020484.1\|WP_002294584.1\|2404561_2405434_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP020484.1\|WP_002287792.1\|2392782_2393748_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP020484.1\|WP_002290558.1\|2397186_2398719_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP020484.1\|WP_002294577.1\|2408834_2409479_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP020484.1\|WP_002287787.1\|2396251_2396953_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP020484.1\|WP_002291634.1\|2401409_2401913_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP020484.1\|WP_002294588.1\|2400988_2401357_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP020484.1\|WP_002303469.1\|2390573_2392733_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP020484.1\|WP_002294589.1\|2400193_2400883_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19
NZ_CP020484.1\|WP_002303471.1\|2398909_2400112_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69

>NZ_CP020484.1|WP_002291634.1|2401409_2401913_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP020484.1|WP_002294588.1|2400988_2401357_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP020484.1|WP_002294589.1|2400193_2400883_-|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP020484.1|WP_002303471.1|2398909_2400112_-|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>NZ_CP020484.1|WP_002290558.1|2397186_2398719_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP020484.1|WP_002287787.1|2396251_2396953_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP020484.1|WP_002287788.1|2395284_2395998_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP020484.1|WP_002294593.1|2393836_2394976_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP020484.1|WP_002287792.1|2392782_2393748_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP020484.1|WP_002303469.1|2390573_2392733_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFLSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYAMAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>NZ_CP020484.1|WP_002294587.1|2402322_2403012_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP020484.1|WP_002291638.1|2403115_2403538_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP020484.1|WP_002294585.1|2403880_2404549_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP020484.1|WP_002294584.1|2404561_2405434_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP020484.1|WP_108676096.1|2405524_2406544_-|lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKYTKLMD
>NZ_CP020484.1|WP_002294581.1|2406716_2407604_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP020484.1|WP_002294580.1|2407680_2408226_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP020484.1|WP_002294579.1|2408326_2408497_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP020484.1|WP_002294578.1|2408520_2408673_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP020484.1|WP_002294577.1|2408834_2409479_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

516753 : 583716

Streptococcus_phage(15.38%)

integrase,tRNA,transposase,protease

attL 512306:512325|attR 590565:590584

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
512306:512325	attL	NA	NA	NA	NA
WP_002286726.1\|516753_517875_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_002295160.1\|518114_519542_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_002286711.1\|519555_520674_+	aminotransferase	NA	NA	NA	NA
WP_002286708.1\|520733_522026_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_002326790.1\|522175_522736_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286704.1\|522864_523242_+	DUF1033 family protein	NA	NA	NA	NA
WP_002304230.1\|523174_525247_+	DNA topoisomerase III	NA	NA	NA	NA
WP_002289773.1\|525457_526405_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	5.0e-84	51.0
WP_002289775.1\|526650_527115_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-18	38.7
WP_002289776.1\|527176_528220_-	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_002291188.1\|528596_529562_-	TDT family transporter	NA	NA	NA	NA
WP_002297022.1\|529795_530641_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002291183.1\|530831_532019_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_002295166.1\|532024_532381_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.7e-22	42.3
WP_002291179.1\|532382_532721_+	glycine cleavage system protein H	NA	NA	NA	NA
WP_002304234.1\|533115_534150_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.2e-28	35.1
WP_002287674.1\|534142_534829_+	ABC transporter permease	NA	NA	NA	NA
WP_002287678.1\|534852_535701_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002287679.1\|535897_536671_+	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	2.1e-08	28.8
WP_002287681.1\|536683_537970_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_002287683.1\|537966_539202_+	cysteine desulfurase	Q2XUY6	environmental_halophage	3.9e-113	47.7
WP_002287684.1\|539188_539659_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_002287686.1\|539663_541055_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_002297218.1\|541170_542466_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002287705.1\|542671_543814_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.3e-58	34.8
WP_002287709.1\|543852_544587_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287723.1\|544818_545094_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_048946547.1\|545191_547189_+	hypothetical protein	A0A1Z1LZK7	Bacillus_phage	5.5e-24	24.4
WP_002301912.1\|547264_547600_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_048946548.1\|547978_548341_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_048946549.1\|548386_548713_+	hypothetical protein	NA	NA	NA	NA
WP_002298390.1\|549555_551379_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002298389.1\|551392_552802_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	3.2e-42	27.6
WP_002298387.1\|552819_553656_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002317770.1\|553720_554503_+	hypothetical protein	NA	NA	NA	NA
WP_094850654.1\|554906_556032_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-75	54.1
WP_002297848.1\|557384_557585_+	sensor histidine kinase	NA	NA	NA	NA
WP_002297850.1\|557660_557858_+	hypothetical protein	NA	NA	NA	NA
WP_002297851.1\|558154_559702_-	2',3'-cyclic-nucleotide 2'-phosphodiesterase	S4VPC4	Pandoravirus	4.6e-10	25.7
WP_002297853.1\|559785_560589_-	metallophosphoesterase	NA	NA	NA	NA
WP_002297855.1\|560591_561374_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_002297856.1\|561370_562150_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_002297857.1\|562121_562913_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-21	39.4
WP_002297858.1\|562973_563903_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297859.1\|564097_564781_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_002340328.1\|564941_565985_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002340332.1\|567924_569103_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002295743.1\|569323_570232_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002321318.1\|570360_570960_+	DUF1819 family protein	NA	NA	NA	NA
WP_002321317.1\|570959_571535_+	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_002344971.1\|571559_575231_+	BREX system P-loop protein BrxC	NA	NA	NA	NA
WP_002340336.1\|575294_578927_+	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
WP_002321314.1\|579042_581565_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_002321313.1\|581682_583716_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
590565:590584	attR	NA	NA	NA	NA

DBSCAN-SWA_2

726195 : 734667

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|726195_726840_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|726854_727184_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|727197_728136_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|728171_728996_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|728988_729336_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|729404_730277_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|730385_731507_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|731560_732163_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|732477_734667_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_3

787676 : 887441

116

Enterococcus_phage(11.63%)

portal,plate,tRNA,integrase,terminase,tail,protease,head,holin,transposase,capsid

attL 836947:836965|attR 872915:872933

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|787676_790475_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|790523_792050_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|792064_792712_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|792895_793225_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|793401_794130_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|794145_795159_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|795158_796436_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_074400891.1\|796498_799201_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|799352_799670_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|799699_800020_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002371581.1\|800127_801588_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|801655_801877_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|801907_802090_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|802089_802503_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|802625_803807_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286676.1\|803877_804042_-	hypothetical protein	NA	NA	NA	NA
WP_002286587.1\|804337_805477_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|805775_806411_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|806523_807159_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|807192_807654_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296613.1\|807783_808215_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|808232_808553_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|808851_809628_+	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|809642_809846_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|809861_810200_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296610.1\|810186_810366_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|810408_810879_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|810965_811664_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|811841_812183_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|812175_812847_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_058825536.1\|812852_813545_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286552.1\|813541_814291_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002304429.1\|814302_814572_+	hypothetical protein	NA	NA	NA	NA
WP_002296607.1\|814577_814742_+	hypothetical protein	NA	NA	NA	NA
WP_002303016.1\|814734_815034_+	hypothetical protein	NA	NA	NA	NA
WP_002303017.1\|815033_815336_+	hypothetical protein	D2IZY1	Enterococcus_phage	2.8e-33	70.7
WP_002303018.1\|815375_815741_+	hypothetical protein	NA	NA	NA	NA
WP_002303019.1\|816230_816371_+	hypothetical protein	NA	NA	NA	NA
WP_002369144.1\|816367_816550_+	hypothetical protein	NA	NA	NA	NA
WP_002347162.1\|816562_816757_+	hypothetical protein	NA	NA	NA	NA
WP_002303022.1\|816789_817002_-	hypothetical protein	NA	NA	NA	NA
WP_002304431.1\|817126_817330_+	hypothetical protein	NA	NA	NA	NA
WP_002303024.1\|817326_817599_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.5e-20	61.6
WP_002303025.1\|817599_817785_+	hypothetical protein	NA	NA	NA	NA
WP_123838300.1\|817771_818119_+	hypothetical protein	NA	NA	NA	NA
WP_002303026.1\|818078_818555_+	DUF1492 domain-containing protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.2e-27	50.8
WP_002349221.1\|818700_819429_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	1.2e-58	52.4
WP_002303029.1\|819476_819755_+	hypothetical protein	NA	NA	NA	NA
WP_002303030.1\|819756_820143_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	1.9e-10	36.7
WP_002304435.1\|820139_820520_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	4.7e-41	64.0
WP_002303032.1\|820631_821084_+	hypothetical protein	A0A2H4JFK0	uncultured_Caudovirales_phage	6.8e-47	66.2
WP_002303033.1\|821080_822808_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	6.9e-265	73.3
WP_002304437.1\|822871_824059_+\|portal	phage portal protein	A0A1B2APW5	Phage_Wrath	1.3e-142	65.5
WP_002303035.1\|824030_824600_+\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	3.6e-69	71.7
WP_002303037.1\|824612_825977_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	2.2e-125	69.1
WP_002303039.1\|825978_826260_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	4.7e-22	62.7
WP_002303041.1\|826237_826564_+\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	2.9e-23	53.4
WP_002303043.1\|826553_826892_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	9.6e-22	45.9
WP_002303045.1\|826881_827247_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002303047.1\|827253_827880_+\|tail	tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	5.7e-28	34.5
WP_002303049.1\|827879_828344_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.4e-15	38.9
WP_002303051.1\|828538_830848_+\|tail	phage tail tape measure protein	Q8W5Z7	Listeria_phage	5.5e-84	50.1
WP_002349218.1\|830859_831564_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002347164.1\|831560_834320_+	CHAP domain-containing protein	D7RWE0	Brochothrix_phage	1.6e-50	55.7
WP_002332773.1\|834332_835241_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
WP_002303523.1\|835240_835858_+	hypothetical protein	NA	NA	NA	NA
WP_002301867.1\|835861_836311_+	hypothetical protein	NA	NA	NA	NA
WP_002305897.1\|836310_836805_+	hypothetical protein	NA	NA	NA	NA
WP_002347165.1\|836818_837250_+	hypothetical protein	NA	NA	NA	NA
836947:836965	attL	NA	NA	NA	NA
WP_002303475.1\|837251_837389_+	XkdX family protein	NA	NA	NA	NA
WP_002303476.1\|837425_837719_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|837715_837940_+\|holin	holin	NA	NA	NA	NA
WP_002303477.1\|837936_838956_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
WP_002302747.1\|839732_840032_-	hypothetical protein	NA	NA	NA	NA
WP_002302745.1\|840037_840268_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|840517_840718_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002296840.1\|841034_842222_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002286469.1\|842496_843729_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|843983_844553_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286465.1\|844730_845171_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|845328_846093_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|846124_847048_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|847123_848263_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|848255_849056_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|849055_849883_+	glycosyltransferase	NA	NA	NA	NA
WP_002286451.1\|849887_850595_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|850694_851561_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|851574_852147_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002294532.1\|852168_853197_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286428.1\|853294_854146_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002302719.1\|854179_856213_+	hypothetical protein	NA	NA	NA	NA
WP_042957143.1\|856256_857537_+	EpaQ family protein	NA	NA	NA	NA
WP_002289081.1\|857746_858553_+	ABC transporter permease	NA	NA	NA	NA
WP_002289079.1\|858564_859785_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
WP_002289078.1\|859774_861361_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002289076.1\|861399_863538_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002289074.1\|863905_864889_-	serine hydrolase	NA	NA	NA	NA
WP_002289073.1\|865266_866658_+	sugar transferase	NA	NA	NA	NA
WP_002289071.1\|866673_867714_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-07	35.3
WP_002289069.1\|867732_868818_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_002289068.1\|868850_869813_+	glycosyl transferase	NA	NA	NA	NA
WP_002292877.1\|869805_871233_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_002302730.1\|871234_872305_+	hypothetical protein	NA	NA	NA	NA
WP_002292875.1\|872291_873713_+	oligosaccharide flippase family protein	NA	NA	NA	NA
872915:872933	attR	NA	NA	NA	NA
WP_002289359.1\|873725_874733_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.2e-40	35.9
WP_002292874.1\|874744_875749_+	N-acetylneuraminate synthase	NA	NA	NA	NA
WP_002289362.1\|875745_876894_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
WP_002289363.1\|876866_877544_+	acetyltransferase	NA	NA	NA	NA
WP_002326811.1\|877533_878676_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L0G1	Tupanvirus	2.4e-24	27.9
WP_002289366.1\|878688_879666_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002289368.1\|879665_880574_+	dehydrogenase	NA	NA	NA	NA
WP_002289370.1\|880574_881327_+	acylneuraminate cytidylyltransferase family protein	NA	NA	NA	NA
WP_002289372.1\|881331_882279_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.8e-50	37.7
WP_060809400.1\|882452_883748_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-54	37.2
WP_000222572.1\|884236_885190_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_000997695.1\|886262_887441_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1160537 : 1170080

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002348948.1\|1160537_1161926_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	7.0e-10	26.0
WP_002297115.1\|1162494_1162872_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1163127_1163856_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1163855_1164110_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1164111_1164783_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1164783_1167006_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1166990_1168430_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002378443.1\|1168461_1169505_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1169501_1170080_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_5

1445886 : 1488571

Streptococcus_phage(23.08%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287525.1\|1445886_1447035_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|1447051_1447456_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002291299.1\|1447759_1447933_+	hypothetical protein	NA	NA	NA	NA
WP_002295138.1\|1448572_1449046_+	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_002295139.1\|1449054_1449282_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002295142.1\|1449917_1450289_+	hypothetical protein	NA	NA	NA	NA
WP_002291278.1\|1450544_1450787_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002296679.1\|1450818_1451721_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002291274.1\|1451733_1451922_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002296677.1\|1451935_1452499_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002300977.1\|1452536_1453430_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.2e-59	46.0
WP_002296674.1\|1453507_1454446_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002296672.1\|1454479_1454830_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002296671.1\|1454862_1455765_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002296670.1\|1455757_1456615_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
WP_002296669.1\|1456948_1457758_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002296667.1\|1457797_1458295_+	cysteine hydrolase	NA	NA	NA	NA
WP_002321681.1\|1458939_1459263_+	hypothetical protein	NA	NA	NA	NA
WP_002296665.1\|1459426_1459681_+	hypothetical protein	NA	NA	NA	NA
WP_002296663.1\|1459750_1459996_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296662.1\|1460071_1460437_+	hypothetical protein	NA	NA	NA	NA
WP_002303842.1\|1460497_1461061_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1461712_1463008_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002302440.1\|1463246_1464548_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002293303.1\|1464651_1464852_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3
WP_002296658.1\|1465247_1465397_+	hypothetical protein	NA	NA	NA	NA
WP_002296656.1\|1465603_1466317_-	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
WP_002296654.1\|1466309_1467395_-	mannonate dehydratase	NA	NA	NA	NA
WP_002296653.1\|1467411_1467855_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002321678.1\|1467888_1468242_-	hypothetical protein	NA	NA	NA	NA
WP_002296650.1\|1468353_1468755_-	hypothetical protein	NA	NA	NA	NA
WP_002296648.1\|1468791_1469301_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002303107.1\|1469322_1470180_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002296646.1\|1470197_1471031_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002303106.1\|1471044_1471842_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002321677.1\|1471874_1472159_-	alcohol dehydrogenase	NA	NA	NA	NA
WP_002296641.1\|1472155_1473157_-	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
WP_002296640.1\|1473158_1474061_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.3e-53	35.3
WP_002296639.1\|1474224_1475073_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002296638.1\|1475718_1475925_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296637.1\|1476126_1477128_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002311095.1\|1477132_1479046_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_002296634.1\|1479213_1479720_-	cysteine hydrolase	NA	NA	NA	NA
WP_002296633.1\|1479879_1480320_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002296632.1\|1480345_1481503_-	hypothetical protein	NA	NA	NA	NA
WP_002296631.1\|1481505_1481862_-	hypothetical protein	NA	NA	NA	NA
WP_002296629.1\|1482159_1483134_-	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_002296628.1\|1483329_1484169_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|1484353_1485241_+	rotamase	NA	NA	NA	NA
WP_002311093.1\|1485834_1486530_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|1486513_1486912_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002287107.1\|1487320_1488571_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_6

1496421 : 1543259

Streptococcus_phage(44.44%)

integrase,transposase

attL 1491611:1491626|attR 1501332:1501347

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1491611:1491626	attL	NA	NA	NA	NA
WP_000997695.1\|1496421_1497600_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_000222572.1\|1497755_1498709_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002288357.1\|1498765_1499893_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_010729348.1\|1500110_1501253_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.5e-39	32.4
WP_010729347.1\|1501257_1501443_-	DUF3173 domain-containing protein	NA	NA	NA	NA
1501332:1501347	attR	NA	NA	NA	NA
WP_002353648.1\|1501796_1502042_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010729346.1\|1502035_1502437_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_010729345.1\|1502623_1504432_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	2.3e-154	48.4
WP_010729344.1\|1504454_1506221_-	hypothetical protein	NA	NA	NA	NA
WP_010729343.1\|1506233_1507028_-	HAD family hydrolase	NA	NA	NA	NA
WP_010729700.1\|1507037_1508414_-	MFS transporter	NA	NA	NA	NA
WP_010729341.1\|1508533_1509181_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_010729340.1\|1509264_1510692_-	glucuronate isomerase	NA	NA	NA	NA
WP_010729339.1\|1510765_1511845_-	mannonate dehydratase	NA	NA	NA	NA
WP_010729338.1\|1511847_1513479_-	mannitol dehydrogenase family protein	NA	NA	NA	NA
WP_025481115.1\|1513788_1514454_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010729336.1\|1515172_1515343_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|1515466_1516786_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_010729334.1\|1517294_1517747_-	hypothetical protein	NA	NA	NA	NA
WP_010729333.1\|1517753_1518302_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|1518555_1519875_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_010729332.1\|1520030_1520363_-	hypothetical protein	NA	NA	NA	NA
WP_033630243.1\|1520376_1520607_-	hypothetical protein	NA	NA	NA	NA
WP_010710550.1\|1520828_1521371_-	hypothetical protein	NA	NA	NA	NA
WP_108680002.1\|1521391_1522471_-	CHAP domain-containing protein	A0A0B5A7F4	Streptococcus_phage	4.6e-25	29.9
WP_010729329.1\|1522489_1524700_-	hypothetical protein	NA	NA	NA	NA
WP_010729328.1\|1524715_1527244_-	hypothetical protein	NA	NA	NA	NA
WP_010729327.1\|1527295_1527706_-	hypothetical protein	NA	NA	NA	NA
WP_002312989.1\|1527718_1527937_-	hypothetical protein	NA	NA	NA	NA
WP_010729326.1\|1527933_1528926_-	conjugal transfer protein	NA	NA	NA	NA
WP_010729325.1\|1529004_1529916_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_010729324.1\|1529934_1530279_-	hypothetical protein	NA	NA	NA	NA
WP_010729321.1\|1530935_1531436_-	hypothetical protein	NA	NA	NA	NA
WP_010729320.1\|1531436_1531982_-	hypothetical protein	NA	NA	NA	NA
WP_010729319.1\|1531978_1533235_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_010729318.1\|1533595_1533907_-	hypothetical protein	NA	NA	NA	NA
WP_050566171.1\|1533929_1535240_-	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	1.3e-61	36.8
WP_010729316.1\|1535853_1536306_-	hypothetical protein	NA	NA	NA	NA
WP_010729315.1\|1536307_1536673_-	hypothetical protein	NA	NA	NA	NA
WP_010729314.1\|1536771_1541055_-	VaFE repeat-containing surface-anchored protein	NA	NA	NA	NA
WP_010729313.1\|1541201_1541441_-	hypothetical protein	NA	NA	NA	NA
WP_002312949.1\|1541530_1541803_-	hypothetical protein	A0A1W6JN36	Lactococcus_phage	1.6e-19	57.4
WP_010710562.1\|1541885_1542137_-	hypothetical protein	D2IZL0	Enterococcus_phage	1.1e-06	58.5
WP_002303350.1\|1542299_1543259_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1647454 : 1769657

110

Streptococcus_phage(35.14%)

integrase,tRNA,transposase,protease

attL 1660015:1660032|attR 1683501:1683518

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000222572.1\|1647454_1648408_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002326695.1\|1648404_1648986_-	DUF443 family protein	NA	NA	NA	NA
WP_002321528.1\|1649172_1649823_-	hypothetical protein	NA	NA	NA	NA
WP_002289698.1\|1650365_1651301_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.0e-53	39.1
WP_002289697.1\|1651334_1652333_-	YvcK family protein	A1IMD5	Streptococcus_phage	2.6e-115	62.9
WP_002289695.1\|1652329_1653214_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.4e-08	31.4
WP_002296517.1\|1653348_1654080_-	aspartate racemase	NA	NA	NA	NA
WP_002294441.1\|1654083_1655349_-	D-aspartate ligase	NA	NA	NA	NA
WP_002296519.1\|1655611_1658428_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.6e-311	57.4
WP_002302999.1\|1658437_1660432_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
1660015:1660032	attL	NA	NA	NA	NA
WP_002296521.1\|1660690_1662193_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_002292113.1\|1662194_1662932_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-34	44.7
WP_010729704.1\|1663102_1664296_-\|integrase	site-specific integrase	A0A1S5SEW7	Streptococcus_phage	3.9e-142	63.8
WP_002341493.1\|1664374_1664581_-	excisionase	A0A1S5SF07	Streptococcus_phage	1.1e-25	87.3
WP_010729705.1\|1664573_1665716_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.5e-63	35.4
WP_008788621.1\|1666227_1666863_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001814923.1\|1667338_1667455_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000691736.1\|1667470_1669390_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_000336323.1\|1669508_1669676_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_001227347.1\|1669735_1670089_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_022278534.1\|1670592_1671012_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_025481129.1\|1671037_1671244_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002296523.1\|1671471_1671645_-	hypothetical protein	NA	NA	NA	NA
WP_158003447.1\|1671620_1672286_+	sugar diacid utilization regulator	NA	NA	NA	NA
WP_002289374.1\|1672367_1673534_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.9e-24	25.7
WP_002292134.1\|1673684_1675514_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-136	48.8
WP_002296525.1\|1675564_1676128_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_002289532.1\|1676221_1677265_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_002300943.1\|1678679_1678907_-	adenosine deaminase	NA	NA	NA	NA
WP_002289535.1\|1679390_1679981_+	glutamine amidotransferase	NA	NA	NA	NA
WP_002289536.1\|1680170_1680884_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1681063_1682359_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002289537.1\|1682520_1683531_-	LD-carboxypeptidase	NA	NA	NA	NA
1683501:1683518	attR	NA	NA	NA	NA
WP_002294466.1\|1683567_1684050_-\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
WP_002294467.1\|1684199_1684568_+	hypothetical protein	NA	NA	NA	NA
WP_002296526.1\|1685032_1685485_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288523.1\|1685608_1686460_-	sugar transporter	NA	NA	NA	NA
WP_002288522.1\|1686472_1687258_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_002288521.1\|1687609_1688551_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_002288520.1\|1688554_1689478_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_002288514.1\|1692655_1692829_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1693099_1694395_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288513.1\|1694589_1694937_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002288511.1\|1694963_1697270_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
WP_002288509.1\|1697282_1697594_-	YlxQ-related RNA-binding protein	NA	NA	NA	NA
WP_002288501.1\|1697590_1697884_-	YlxR family protein	NA	NA	NA	NA
WP_002288500.1\|1697905_1699081_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002288499.1\|1699103_1699577_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_002288497.1\|1699721_1704080_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.9e-21	40.8
WP_002294137.1\|1704291_1706001_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002294136.1\|1706068_1707337_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294135.1\|1707497_1708298_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|1708294_1709107_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002297404.1\|1709515_1710766_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002323245.1\|1711097_1712270_+\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_002293875.1\|1712416_1712974_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|1712976_1713699_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|1713834_1714716_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|1714814_1715597_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|1715955_1716435_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326698.1\|1716651_1717743_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002288432.1\|1718866_1720558_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288434.1\|1720977_1721925_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|1722039_1723059_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|1723149_1724379_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|1724839_1725541_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002301319.1\|1726149_1727166_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288445.1\|1727162_1727627_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288446.1\|1727633_1728176_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|1728159_1728984_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|1729072_1730053_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|1730076_1731561_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|1731572_1732562_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1732809_1732977_+	DUF3042 family protein	NA	NA	NA	NA
WP_010729586.1\|1733038_1734850_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1734846_1735212_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1735374_1735770_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1735787_1736750_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1736749_1736962_-	YqgQ family protein	NA	NA	NA	NA
WP_106913973.1\|1736982_1737681_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1737700_1738243_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002301321.1\|1738374_1739379_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1739375_1740365_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|1740361_1741168_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1741333_1742290_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1742366_1742885_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1742972_1743122_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1743349_1743796_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002305724.1\|1743990_1745886_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002303934.1\|1746210_1747185_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002296332.1\|1747750_1748317_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002296334.1\|1748572_1749904_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1749869_1750220_+	hypothetical protein	NA	NA	NA	NA
WP_002296337.1\|1750731_1751076_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002301399.1\|1751341_1752301_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287776.1\|1752490_1753087_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|1753210_1755010_+	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1755287_1755500_-	hypothetical protein	NA	NA	NA	NA
WP_002293931.1\|1755961_1756111_+	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|1756363_1757323_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002326704.1\|1757535_1758444_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002288573.1\|1758492_1758879_+	YxeA family protein	NA	NA	NA	NA
WP_002288574.1\|1759186_1760533_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002288575.1\|1760644_1761994_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288576.1\|1762110_1763364_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288577.1\|1763434_1763920_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002305727.1\|1763942_1764701_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|1764716_1765895_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002303943.1\|1766124_1768245_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002297185.1\|1768361_1769657_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_8

1775360 : 1846498

Streptococcus_phage(57.89%)

integrase,transposase

attL 1795202:1795219|attR 1853939:1853956

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297218.1\|1775360_1776656_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002302293.1\|1776974_1777277_+	hypothetical protein	NA	NA	NA	NA
WP_002323892.1\|1778420_1778735_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1778851_1780030_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|1780366_1780606_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1780967_1781228_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1781412_1781910_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1782039_1782750_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1782762_1784427_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|1784631_1785294_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|1785303_1786119_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1786380_1786824_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|1786957_1787296_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288986.1\|1787283_1787661_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002288985.1\|1787884_1789078_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|1789243_1789666_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002321037.1\|1790060_1790255_+	hypothetical protein	NA	NA	NA	NA
WP_002288983.1\|1790251_1790746_+	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|1790907_1792080_-	class C sortase	NA	NA	NA	NA
WP_002288981.1\|1792285_1793101_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288979.1\|1793250_1793697_-	cell wall anchor	NA	NA	NA	NA
WP_158003446.1\|1793693_1794698_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002352916.1\|1794737_1795067_-	hypothetical protein	NA	NA	NA	NA
WP_002305732.1\|1795192_1797520_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
1795202:1795219	attL	NA	NA	NA	NA
WP_002288970.1\|1798362_1798656_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002288969.1\|1799058_1800237_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
WP_002300928.1\|1800340_1800655_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288966.1\|1800761_1800977_+	hypothetical protein	NA	NA	NA	NA
WP_002288964.1\|1801276_1801519_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288962.1\|1801505_1801934_-	hypothetical protein	NA	NA	NA	NA
WP_002299190.1\|1802085_1803633_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002287659.1\|1803734_1804088_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|1804077_1804272_-	hypothetical protein	NA	NA	NA	NA
WP_086956687.1\|1804402_1805565_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002289210.1\|1806129_1806504_-	VOC family protein	NA	NA	NA	NA
WP_002296814.1\|1806526_1807927_-	beta-fructofuranosidase	NA	NA	NA	NA
WP_002289214.1\|1807930_1808341_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002289215.1\|1808358_1808850_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002289216.1\|1808859_1809651_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002289217.1\|1809643_1810417_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002289218.1\|1810572_1813107_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002289219.1\|1813188_1814061_-	ROK family protein	NA	NA	NA	NA
WP_002289220.1\|1814096_1814564_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289221.1\|1814573_1816043_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002296810.1\|1816113_1817532_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_002296809.1\|1817653_1818634_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_086956705.1\|1818913_1820076_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5
WP_002305710.1\|1820168_1820678_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002302055.1\|1821016_1821970_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_077828749.1\|1821922_1822159_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002305709.1\|1822578_1823700_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_002321361.1\|1824027_1825437_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002289053.1\|1825433_1826162_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
WP_002289055.1\|1826289_1827201_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
WP_002289057.1\|1827217_1828225_-	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
WP_002305708.1\|1828221_1830351_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.8e-182	60.3
WP_002296840.1\|1830651_1831839_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002298631.1\|1832883_1834710_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	3.7e-11	26.8
WP_002288938.1\|1836943_1837333_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
WP_002305705.1\|1837382_1838279_-	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
WP_002288935.1\|1838281_1840129_-	PHP domain-containing protein	NA	NA	NA	NA
WP_002288934.1\|1840225_1840726_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
WP_002298822.1\|1840738_1840960_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002297187.1\|1840964_1841084_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286934.1\|1841098_1842283_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
WP_002286933.1\|1842538_1842793_-	hypothetical protein	NA	NA	NA	NA
WP_002286932.1\|1842817_1843960_-	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
WP_002349191.1\|1844019_1845372_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.8e-162	64.4
WP_002286928.1\|1845442_1845787_-	hypothetical protein	NA	NA	NA	NA
WP_002286926.1\|1845796_1846171_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
WP_002286925.1\|1846183_1846498_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
1853939:1853956	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1854049 : 1946375

105

Enterococcus_phage(24.07%)

portal,plate,tRNA,integrase,terminase,tail,protease,head,holin,transposase,capsid

attL 1850962:1851002|attR 1892897:1892937

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1850962:1851002	attL	NA	NA	NA	NA
WP_020944989.1\|1854049_1855066_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	9.8e-62	66.7
WP_002302122.1\|1855076_1855274_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
WP_002332427.1\|1855289_1855532_-\|holin	holin	D2J075	Enterococcus_phage	1.2e-21	63.3
WP_002332428.1\|1855566_1855704_-	XkdX family protein	NA	NA	NA	NA
WP_002332429.1\|1855705_1856152_-	hypothetical protein	NA	NA	NA	NA
WP_002290627.1\|1856148_1856298_-	hypothetical protein	NA	NA	NA	NA
WP_010729422.1\|1856314_1858375_-\|plate	BppU family phage baseplate upper protein	A0A249XZH9	Enterococcus_phage	1.7e-65	44.9
WP_002290629.1\|1858392_1859217_-	hypothetical protein	NA	NA	NA	NA
WP_002332431.1\|1859220_1860270_-	hypothetical protein	Q5K5I4	Oenococcus_phage	1.9e-31	27.9
WP_002350711.1\|1860266_1861139_-\|plate	phage baseplate protein	NA	NA	NA	NA
WP_002350712.1\|1861139_1864988_-	tape measure protein	A0A0M5M3L4	Enterococcus_phage	0.0e+00	76.0
WP_002290636.1\|1864987_1865179_-	hypothetical protein	NA	NA	NA	NA
WP_002329391.1\|1865202_1865514_-	hypothetical protein	A0A0S2MY76	Enterococcus_phage	4.0e-14	44.8
WP_002332434.1\|1865638_1866199_-\|tail	phi13 family phage major tail protein	V5UQL2	Enterococcus_phage	3.4e-40	46.2
WP_002329393.1\|1866214_1866586_-	hypothetical protein	A0A060ANH4	Enterococcus_phage	2.5e-23	46.2
WP_002350714.1\|1866582_1866978_-	hypothetical protein	C0LZZ2	Enterococcus_phage	4.3e-21	44.5
WP_002342516.1\|1866974_1867310_-\|head	phage head closure protein	A0A249XUC8	Enterococcus_phage	2.2e-18	44.1
WP_002350715.1\|1867313_1867640_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002350716.1\|1867654_1868848_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.5e-114	55.4
WP_002350717.1\|1868844_1869522_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	4.9e-49	51.0
WP_002350718.1\|1869556_1870777_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	1.2e-61	38.5
WP_010729418.1\|1872331_1873093_-	GIY-YIG nuclease family protein	A0A220BXN1	Staphylococcus_phage	7.9e-40	45.9
WP_010729417.1\|1873185_1873344_+	ribbon-helix-helix domain-containing protein	A0A0A7RUX5	Clostridium_phage	5.3e-07	65.9
WP_002290653.1\|1873810_1874332_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.1e-16	34.2
WP_002350721.1\|1874433_1874598_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.6e-14	69.8
WP_016922443.1\|1874754_1875072_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	2.0e-13	39.8
WP_016922444.1\|1875072_1875618_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016922446.1\|1876029_1876194_-	hypothetical protein	NA	NA	NA	NA
WP_002304479.1\|1876813_1877227_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-56	81.0
WP_012197617.1\|1877713_1878001_-	hypothetical protein	NA	NA	NA	NA
WP_012197619.1\|1877997_1878201_-	hypothetical protein	NA	NA	NA	NA
WP_020944994.1\|1878130_1878400_-	hypothetical protein	NA	NA	NA	NA
WP_012197625.1\|1878396_1878927_-	DUF1642 domain-containing protein	A0A059T7S4	Listeria_phage	1.8e-11	37.2
WP_012197627.1\|1878919_1879234_-	hypothetical protein	D2IZY1	Enterococcus_phage	4.6e-34	72.7
WP_074394665.1\|1879233_1879539_-	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|1879535_1879697_-	antitoxin	NA	NA	NA	NA
WP_002350665.1\|1879693_1880011_-	VRR-NUC domain-containing protein	A0A1B0YA93	Lactobacillus_phage	3.6e-31	61.5
WP_012197635.1\|1880257_1882570_-	phage/plasmid primase P4 family domain-containing protein	R4IBW2	Listeria_phage	1.3e-250	55.9
WP_012197636.1\|1882584_1883085_-	DUF669 domain-containing protein	A8ATF2	Listeria_phage	1.1e-34	52.9
WP_002350668.1\|1883086_1883560_-	transcriptional regulator	A8ATW6	Listeria_phage	7.7e-09	43.9
WP_002350669.1\|1883550_1884900_-	DEAD/DEAH box helicase	A0A0P0ID30	Lactobacillus_phage	4.1e-132	53.4
WP_012197638.1\|1884874_1885561_-	AAA family ATPase	A0A1P8VVS4	Streptococcus_phage	1.1e-61	52.7
WP_025480431.1\|1885679_1885997_-	DUF5406 family protein	F0PIH7	Enterococcus_phage	1.6e-26	57.1
WP_044384563.1\|1886002_1886434_-	hypothetical protein	NA	NA	NA	NA
WP_002350673.1\|1886690_1886867_-	hypothetical protein	D7RWL9	Brochothrix_phage	1.3e-09	60.7
WP_002329420.1\|1886883_1887363_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	5.3e-34	49.0
WP_002350675.1\|1887295_1887613_-	hypothetical protein	NA	NA	NA	NA
WP_002332465.1\|1887780_1888239_+	hypothetical protein	NA	NA	NA	NA
WP_002342492.1\|1888340_1888511_-	hypothetical protein	NA	NA	NA	NA
WP_002325021.1\|1888541_1888790_-	hypothetical protein	NA	NA	NA	NA
WP_002315391.1\|1888802_1888988_-	helix-turn-helix transcriptional regulator	Q5YAA3	Bacillus_phage	8.4e-12	56.7
WP_002315392.1\|1889291_1889666_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7
WP_002350678.1\|1889670_1890099_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_012197642.1\|1890148_1890802_+	hypothetical protein	NA	NA	NA	NA
WP_002350679.1\|1890937_1891504_+	hypothetical protein	A0A0P0IXE0	Lactobacillus_phage	1.9e-06	92.3
WP_012197643.1\|1891619_1892756_+\|integrase	site-specific integrase	A0A1P8BMN3	Lactococcus_phage	8.4e-54	36.8
WP_002286913.1\|1892887_1893235_-	50S ribosomal protein L19	NA	NA	NA	NA
1892897:1892937	attR	NA	NA	NA	NA
WP_002293717.1\|1893370_1894132_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002293716.1\|1894121_1894643_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002297190.1\|1894812_1895604_-	hypothetical protein	NA	NA	NA	NA
WP_002290277.1\|1895728_1895980_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|1895991_1896267_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|1896519_1897074_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|1897152_1897674_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|1897677_1898256_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|1898367_1899786_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|1899806_1900145_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|1900104_1900608_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|1900738_1901443_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297195.1\|1901439_1903176_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002305697.1\|1903278_1905750_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.1e-45	29.2
WP_002289807.1\|1906074_1906965_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002305696.1\|1907161_1907644_-	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|1907851_1908217_+	hypothetical protein	NA	NA	NA	NA
WP_002322761.1\|1908420_1908738_-	hypothetical protein	NA	NA	NA	NA
WP_002287105.1\|1909467_1910442_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002297404.1\|1910851_1912102_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305694.1\|1912387_1912645_+	hypothetical protein	NA	NA	NA	NA
WP_008266934.1\|1912876_1913290_-	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_086953915.1\|1913568_1914908_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_042959742.1\|1914977_1915553_-	hypothetical protein	Q9MCC6	Lactobacillus_phage	4.8e-13	35.9
WP_094932120.1\|1915633_1916795_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.7e-79	51.3
WP_002294835.1\|1917169_1917739_-	prevent-host-death protein	NA	NA	NA	NA
WP_002323057.1\|1917812_1919102_-	hypothetical protein	NA	NA	NA	NA
WP_002305691.1\|1919359_1920304_+	MoxR family ATPase	A0A1C9EGB9	Acidianus_two-tailed_virus	7.6e-08	26.4
WP_002323055.1\|1920317_1921391_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002305688.1\|1921380_1923552_+	transglutaminase	NA	NA	NA	NA
WP_059355943.1\|1923663_1925820_-	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	2.9e-71	32.3
WP_002349136.1\|1925962_1928149_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.4e-121	38.7
WP_002289040.1\|1928148_1928358_-	copper chaperone CopZ	NA	NA	NA	NA
WP_002294855.1\|1928370_1928811_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002349135.1\|1928884_1929358_-	hypothetical protein	A0A097BYE2	Leuconostoc_phage	1.1e-10	28.8
WP_002297185.1\|1929584_1930880_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288779.1\|1931189_1932656_-	amino acid permease	NA	NA	NA	NA
WP_002305684.1\|1932966_1935051_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.9e-117	35.7
WP_002288776.1\|1935574_1935934_-	YccF domain-containing protein	NA	NA	NA	NA
WP_002323072.1\|1935963_1936305_-	hypothetical protein	NA	NA	NA	NA
WP_002305683.1\|1936301_1936976_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002305681.1\|1937770_1939069_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002305679.1\|1939108_1940299_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002348809.1\|1940319_1940847_-	DUF5590 domain-containg protein	NA	NA	NA	NA
WP_002304681.1\|1940893_1943683_-	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
WP_002288762.1\|1943829_1944030_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002323868.1\|1944481_1944802_-	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|1945079_1946375_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_10

2521649 : 2643009

108

Enterococcus_phage(22.86%)

portal,plate,tRNA,integrase,terminase,tail,protease,holin,transposase,capsid

attL 2578100:2578115|attR 2638909:2638924

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002301399.1\|2521649_2522609_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002285985.1\|2522759_2525462_-	alpha-mannosidase	NA	NA	NA	NA
WP_002285982.1\|2525474_2526764_-	glycoside hydrolase family 125 protein	NA	NA	NA	NA
WP_002285981.1\|2526913_2527960_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002285980.1\|2527961_2530115_+	alpha-1,2-mannosidase	NA	NA	NA	NA
WP_002285977.1\|2530587_2532033_-	response regulator transcription factor	NA	NA	NA	NA
WP_002285976.1\|2532035_2533760_-	sensor histidine kinase	NA	NA	NA	NA
WP_002285975.1\|2533752_2534367_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002285974.1\|2534711_2536169_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002285972.1\|2536209_2537130_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002285971.1\|2537141_2538089_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002285969.1\|2538567_2539287_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_002304848.1\|2539335_2540982_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002285964.1\|2541160_2541751_+	transporter	NA	NA	NA	NA
WP_002285962.1\|2541842_2543348_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	NA	NA	NA	NA
WP_002285961.1\|2543431_2544784_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_002285960.1\|2544783_2545302_-	hypothetical protein	NA	NA	NA	NA
WP_002285954.1\|2545317_2545644_-	PTS cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002285949.1\|2545656_2547636_-	BglG family transcription antiterminator	NA	NA	NA	NA
WP_002285948.1\|2547656_2547971_-	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
WP_002285944.1\|2548138_2548432_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_002321621.1\|2548509_2549622_-	FUSC family protein	NA	NA	NA	NA
WP_002297280.1\|2549774_2549999_+	hypothetical protein	NA	NA	NA	NA
WP_002285932.1\|2550008_2550188_+\|transposase	transposase	NA	NA	NA	NA
WP_104674935.1\|2550381_2550552_+	hypothetical protein	NA	NA	NA	NA
WP_016252731.1\|2550975_2551995_-	collagen binding domain-containing protein	NA	NA	NA	NA
WP_002285924.1\|2552141_2555213_-	hypothetical protein	NA	NA	NA	NA
WP_002323245.1\|2556863_2558036_+\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_002303189.1\|2558451_2559213_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002344993.1\|2559312_2561034_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-37	28.0
WP_002304835.1\|2561048_2562833_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.1e-46	28.2
WP_002285917.1\|2563213_2564767_-	glycosyl hydrolase	NA	NA	NA	NA
WP_002285916.1\|2565114_2567529_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
WP_002301403.1\|2567955_2569974_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	5.8e-13	39.6
WP_002285911.1\|2570343_2571000_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002285909.1\|2570999_2571956_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
WP_002285906.1\|2571955_2572522_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
WP_049052232.1\|2572957_2573188_+	hypothetical protein	NA	NA	NA	NA
WP_002337498.1\|2573193_2573493_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|2573528_2573900_-	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|2573901_2574303_-	hypothetical protein	NA	NA	NA	NA
WP_002286474.1\|2574316_2574724_-	hypothetical protein	NA	NA	NA	NA
WP_087046766.1\|2575646_2576809_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286484.1\|2577748_2578774_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
2578100:2578115	attL	NA	NA	NA	NA
WP_002286683.1\|2578770_2578995_-\|holin	holin	NA	NA	NA	NA
WP_002318262.1\|2578991_2579285_-	hypothetical protein	NA	NA	NA	NA
WP_071974452.1\|2579322_2579460_-	XkdX family protein	NA	NA	NA	NA
WP_002347165.1\|2579461_2579893_-	hypothetical protein	NA	NA	NA	NA
WP_002305897.1\|2579906_2580401_-	hypothetical protein	NA	NA	NA	NA
WP_002298034.1\|2580400_2580850_-	hypothetical protein	NA	NA	NA	NA
WP_002303306.1\|2580853_2581474_-	hypothetical protein	NA	NA	NA	NA
WP_048946725.1\|2581473_2582382_-\|plate	phage baseplate upper protein	A0A1P8BKW9	Lactococcus_phage	1.1e-08	24.3
WP_049050347.1\|2582394_2585157_-	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	1.1e-139	39.5
WP_002349898.1\|2585153_2585894_-\|tail	tail protein	NA	NA	NA	NA
WP_002349899.1\|2585883_2588673_-	tape measure protein	D7RWD8	Brochothrix_phage	5.4e-70	38.9
WP_002303297.1\|2588914_2589256_-	hypothetical protein	NA	NA	NA	NA
WP_002303295.1\|2589255_2589864_-\|tail	tail protein	NA	NA	NA	NA
WP_002317765.1\|2589864_2590242_-	hypothetical protein	NA	NA	NA	NA
WP_048946577.1\|2590243_2590639_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002298048.1\|2590631_2591003_-	hypothetical protein	NA	NA	NA	NA
WP_002298050.1\|2591002_2591344_-	hypothetical protein	NA	NA	NA	NA
WP_002311614.1\|2591355_2591571_-	hypothetical protein	NA	NA	NA	NA
WP_002312521.1\|2591593_2592484_-	DUF5309 domain-containing protein	NA	NA	NA	NA
WP_002349163.1\|2592498_2593200_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_002298058.1\|2593248_2593566_-	hypothetical protein	NA	NA	NA	NA
WP_002298060.1\|2593567_2594446_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_002298062.1\|2594537_2596067_-\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	1.7e-28	25.0
WP_048946578.1\|2596078_2597494_-	DEAD/DEAH box helicase family protein	C9E2I7	Enterococcus_phage	1.4e-218	79.4
WP_048946579.1\|2597486_2598320_-\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	4.7e-78	67.9
WP_048946580.1\|2598478_2598709_-	hypothetical protein	NA	NA	NA	NA
WP_060763461.1\|2599455_2599923_-	hypothetical protein	D7RWH7	Brochothrix_phage	2.4e-07	28.5
WP_002341971.1\|2599997_2600438_-	transcriptional regulator	D2IYV6	Enterococcus_phage	5.3e-20	38.4
WP_048946598.1\|2600467_2600761_-	hypothetical protein	NA	NA	NA	NA
WP_048946597.1\|2600791_2600986_-	hypothetical protein	NA	NA	NA	NA
WP_033646791.1\|2601091_2601544_-	hypothetical protein	NA	NA	NA	NA
WP_002318210.1\|2601569_2602031_-	class I SAM-dependent methyltransferase	A0A2H4PBJ4	Lactobacillus_phage	1.1e-60	67.1
WP_002299339.1\|2602231_2603083_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	2.3e-27	30.2
WP_048946585.1\|2603097_2603898_-	hypothetical protein	B4XYS6	Lactobacillus_phage	3.0e-58	54.9
WP_002301573.1\|2603940_2604831_-	hypothetical protein	D2IYT9	Enterococcus_phage	1.4e-136	84.5
WP_033646797.1\|2604832_2605774_-	endonuclease	D2IZK1	Enterococcus_phage	1.0e-145	79.2
WP_002303273.1\|2606006_2606342_-	hypothetical protein	NA	NA	NA	NA
WP_002330811.1\|2606667_2606856_-	hypothetical protein	D2IZW5	Enterococcus_phage	7.4e-08	60.3
WP_002299325.1\|2606933_2607158_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.2e-27	81.1
WP_002299323.1\|2607154_2607310_-	hypothetical protein	NA	NA	NA	NA
WP_002297389.1\|2607449_2607662_-	hypothetical protein	NA	NA	NA	NA
WP_002297388.1\|2607664_2607877_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002297387.1\|2608151_2608562_+	helix-turn-helix transcriptional regulator	Q5YAA4	Bacillus_phage	2.8e-31	51.4
WP_002297386.1\|2608574_2609027_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_048946584.1\|2609117_2610398_+	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	2.8e-61	50.5
WP_033647077.1\|2610469_2611591_+\|integrase	site-specific integrase	C9E2L6	Enterococcus_phage	4.0e-64	38.5
WP_049058602.1\|2611672_2613445_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-54	29.5
WP_002285883.1\|2613447_2615160_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
WP_002303070.1\|2615274_2615943_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_002295567.1\|2616009_2616798_-	esterase family protein	NA	NA	NA	NA
WP_002295566.1\|2616880_2618353_-	MFS transporter	NA	NA	NA	NA
WP_002289731.1\|2618482_2619676_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
WP_002296055.1\|2627985_2629482_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	8.7e-91	40.9
WP_002290055.1\|2629592_2630597_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_002296053.1\|2630597_2631485_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_002287418.1\|2631701_2633813_-\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
WP_002287415.1\|2633902_2634448_-	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
WP_002287414.1\|2634447_2635893_-\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
WP_002287412.1\|2636012_2636483_-	RNA-binding protein S1	NA	NA	NA	NA
WP_002287409.1\|2636528_2636954_-	septum formation initiator family protein	NA	NA	NA	NA
WP_002287407.1\|2637020_2637290_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_002287405.1\|2637300_2638896_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002287403.1\|2638910_2642432_-	transcription-repair coupling factor	NA	NA	NA	NA
2638909:2638924	attR	NA	NA	NA	NA
WP_002287401.1\|2642448_2643009_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA

DBSCAN-SWA_11

2750102 : 2766998

Streptococcus_phage(92.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297366.1\|2750102_2750417_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
WP_002297365.1\|2750429_2750804_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002297364.1\|2750813_2751149_+	hypothetical protein	NA	NA	NA	NA
WP_010729284.1\|2751231_2752572_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	1.5e-163	65.2
WP_002297358.1\|2752649_2753324_+	AAA family ATPase	NA	NA	NA	NA
WP_002297357.1\|2753316_2753481_+	hypothetical protein	NA	NA	NA	NA
WP_002321810.1\|2753556_2753991_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
WP_002297356.1\|2753991_2754699_+	DNA methylase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
WP_002297354.1\|2754688_2754979_+	hypothetical protein	NA	NA	NA	NA
WP_002297353.1\|2755237_2756422_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002297352.1\|2756436_2756556_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|2757301_2759212_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033658092.1\|2759315_2759540_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002297350.1\|2759552_2760056_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_002297349.1\|2760115_2760505_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_010729283.1\|2760491_2762939_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.9
WP_002297347.1\|2762943_2765067_+	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_002297346.1\|2765063_2766068_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297345.1\|2766086_2766998_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP020485

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020485_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020485_1

96524-96651

TypeV

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP020485_1

>merge|NZ_CP020485|1|96524-96651|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP020485|1|1|96524-96651|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020485.1\|WP_010729784.1\|102446_104423_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP020485.1\|WP_002336710.1\|101722_102394_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP020485.1\|WP_002287522.1\|88136_88541_-\|IS200/IS605-like-element-ISEfa4-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP020485.1\|WP_002314387.1\|83672_85922_-\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|225882
NZ_CP020485.1\|WP_002350398.1\|105187_106012_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020485.1\|WP_002323589.1\|92693_93842_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP020485.1\|WP_002323399.1\|91659_91914_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274230
NZ_CP020485.1\|WP_002348857.1\|94548_94743_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020485.1\|WP_010729785.1\|104435_105191_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP020485.1\|WP_002287525.1\|86971_88120_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP020485.1\|WP_002295673.1\|101147_101387_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020485.1\|WP_002295672.1\|101453_101663_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020485.1\|WP_002287522.1\|92272_92677_+\|IS200/IS605-like-element-ISEfa4-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP020485.1\|WP_002297404.1\|99487_100738_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP020485.1\|WP_002295674.1\|98909_99251_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP020485.1\|WP_002290394.1\|91341_91659_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP020485.1\|WP_002336205.1\|82494_83670_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341026
NZ_CP020485.1\|WP_002323647.1\|97958_98291_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020485.1\|WP_025481135.1\|106300_108412_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|275067
NZ_CP020485.1\|WP_002323400.1\|89847_90783_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP020485.1\|WP_002287522.1\|88136_88541_-\|IS200/IS605-like-element-ISEfa4-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	2.76401e-48
NZ_CP020485.1\|WP_002314387.1\|83672_85922_-\|alpha-galactosidase	gnl\|CDD\|225882	COG3345, GalA, Alpha-galactosidase [Carbohydrate transport and metabolism].	0
NZ_CP020485.1\|WP_002323399.1\|91659_91914_-\|hypothetical-protein	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.87793e-06
NZ_CP020485.1\|WP_002323589.1\|92693_93842_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.71026e-54
NZ_CP020485.1\|WP_002295674.1\|98909_99251_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.01693e-48
NZ_CP020485.1\|WP_010729785.1\|104435_105191_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	2.58528e-60
NZ_CP020485.1\|WP_002287525.1\|86971_88120_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.29752e-54
NZ_CP020485.1\|WP_010729784.1\|102446_104423_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	3.93449e-27
NZ_CP020485.1\|WP_002336205.1\|82494_83670_-\|MFS-transporter	gnl\|CDD\|341026	cd17473, MFS_arabinose_efflux_permease_like, Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily. This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.73674e-45
NZ_CP020485.1\|WP_002336710.1\|101722_102394_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	5.03937e-44
NZ_CP020485.1\|WP_002290394.1\|91341_91659_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP020485.1\|WP_002297404.1\|99487_100738_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.21771e-29
NZ_CP020485.1\|WP_025481135.1\|106300_108412_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|275067	TIGR04226, Fimbrial_subunit_type_2, fimbrial isopeptide formation D2 domain. The Streptococcus Pneumoniae pilus backbone protein, RrgB, has three tandem domains with Lys-to-Asn isopeptide bonds, but these three regions are extremely divergent in sequence. This model represents the homology domain family of the D2 domain. It occurs just once in many surface proteins but up to twenty times in some pilin subunit proteins. Three of every four members have the typical Gram-positive C-terminal motif, LPXTG, although in many cases this motif may be involved in pilin subunit cross-linking rather than cell wall attachment. Proteins with this domain include fimbrial proteins with lectin-like adhesion functions, and the majority of characterized members are involved in surface adhesion to host structures.	3.03843e-08
NZ_CP020485.1\|WP_002287522.1\|92272_92677_+\|IS200/IS605-like-element-ISEfa4-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	2.76401e-48

>NZ_CP020485.1|WP_002348857.1|94548_94743_-|hypothetical-protein
MMGFFLRFYIIELTGRLTVFFGNFAIKPFAEVTAHYICKWLDCKNKIKKVFHYISSSPCQIRPG
>NZ_CP020485.1|WP_002323589.1|92693_93842_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MEQLKAYKFRIYPTEEQEIFFAKSFGCVRKVYNLMLDDRKKAYEEVKNDSSKKMTFPTPAKYKKEFPFLKEIDSLALANAQLNLDKAYKNFFRDKSVGFPRFKSKKNPVQSYTTNNQNGTIALIDSKFIKVPKLKSLVRIKLHRQPKGIIKSATISRHSSGKYYISLLCKEEIIELPKTNSTIGIDLGIMDFAILSDGQKIDNNKFTSKMEKKLKREQRKLSRRALLAKNKGTNLFEAKNYQKQKRKVARLHEKVMNQRTDFLNKLSTEMIKNHDIICIEDLNTKGMLRNHKLAKSISDVSWSKFVTKLQYKADWYGRKIIKVDKWFPSSQICSECGHKDGKKSLEIREWTCPVCHTHHDRDINASINILTEGLRLHSMGLA
>NZ_CP020485.1|WP_002287522.1|92272_92677_+|IS200/IS605-like-element-ISEfa4-family-transposase
MELDTNNHSVFLLYYHLVLVTKYRRQVIDDEISDYAKTTFERISESYHITLVEWNHDKDHVHIMFKAQPKTELTKFINAYKSASSRLIKRDFPRVKQFLWKEMFWSKSFCLLTTGGAPIDVIKKYIQNQGNNHK
>NZ_CP020485.1|WP_002323399.1|91659_91914_-|hypothetical-protein
MGKELKVRKIGNSVGVILPSSLGLKSGDIIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP020485.1|WP_002290394.1|91341_91659_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP020485.1|WP_002323400.1|89847_90783_-|hypothetical-protein
MNILNEKRYVWFAGKKYITTFKRLSELMQQTVKSAMPEGYKFNFVQSSVSTESIYFSILSESRLFHFRISSHVKKTDVDIYTFRTNNYKNLNDLSRSISEYLKGNSYLKIRFSHILILLPYLNENFTLIQVDKSFIASGNQGNMNITSNKTSRVLLALMGYGILYRDDQNGQILINRAGRSLLMKYRKFIPEDFQNLQLENMRLEDLFRLAEDDKYRFEVLKIQKNELLNKLYPENAIKAHFGDANHMYSWFIPKRFRGKINAGDQVKVLNRNSTDVVMITDIYVEDEDIIKYMKPVIKLVNKNKGTRGAS
>NZ_CP020485.1|WP_002287522.1|88136_88541_-|IS200/IS605-like-element-ISEfa4-family-transposase
MELDTNNHSVFLLYYHLVLVTKYRRQVIDDEISDYAKTTFERISESYHITLVEWNHDKDHVHIMFKAQPKTELTKFINAYKSASSRLIKRDFPRVKQFLWKEMFWSKSFCLLTTGGAPIDVIKKYIQNQGNNHK
>NZ_CP020485.1|WP_002287525.1|86971_88120_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MEQLKAYKFRIYPTEEQEIFFAKSFGCVRKVYNLMLDDRKKAYEEVKNDSSKKMTFPTPAKYKKEFPFLKEIDSLALANAQLNLDKAYKNFFRDKSVGFPRFKSKKNPVQSYTTNNQNGTVALIDSKFIKVPKLKSLVRIKLHRQPKGIIKSATISRHSSGKYYISLLCKEEIIELPKTNSTIGIDLGIMDFAILSDGQKIDNNKFTSKMEKKLKREQRKLSRRALLAKNKGTNLFEAKNYQKQKRKVARLHEKVMNQRTDFLNKLSTEMIKNHDIICIEDLNTKGMLRNHKLAKSISDVSWSKFVTKLQYKADWYGRKIIKVDKWFPSSQICSECGHKDGKKSLEIREWTCPVCHTHHDRDINASINILTEGLRLHSMGLA
>NZ_CP020485.1|WP_002314387.1|83672_85922_-|alpha-galactosidase
MYKDNEMNIIYRSENQQFHLFNQEISYIFKISEDGKLLHLYYGENLPDNDYSHLIEMHHRPMTTYRNENDLLYSLEHLKQEFPEYGTTDFRHPAISLLQKNGSRLSDFVYQGYEVEEGKPKLEGLPATYVDNNDESKTLKVYILDSVTNVQVELLYTIYRDYPVITRSARVMNKGKDIQIIENISSLSLDLPDANYEWQQLSGAWGRERTIKSRTLQQGIQSIESTRGISSHQHNPFVTLKRKNTDENQGEAIGAALVYSGNFLIQAEVDTWDVTRLQVGINPFGFNWKLNPGEIFTAPEAILVYSSKGLNAMSQTFHQLFRKRLARGKWREKDRPVLINNWEATYFDFDEEKLVNIAKKAFDVGIELFVLDDGWFGERENDCAGLGDWHVNPKRLPRGIGSLSEKIRSFGMKFGLWFEPEMVNKDSELYRTHPNWIISTPNRKPNHGRNQYVLNFGLDEVVENIFDQMCKIIDESNLDYIKWDMNRPLTDVFDSHLSADQQGEVFHRYVLGVYRLYEKLITKYPNILFESCSSGGGRFDPGMLHYAPQAWASDDSDAIERLKIQYGTSMLYPLSSIGAHVSIVPNHQTNRITPIKTRGNVAFFGAFGYELDLNELSEGDLRIVKEQIAFYKKYRTIIHNGTFYRLLSPFDDDNQTAWMVVSHDKKTAIVAHYKTLNEVNAPYRRLKLKGLDNDGLYNVGQNSLRSGMELMRAGLVCSDASSGQINDQNRRPETFDFDSKIWVITQEEK
>NZ_CP020485.1|WP_002336205.1|82494_83670_-|MFS-transporter
MNNQKSLLQKGAILSISLMLTSSQAINGVIPQMKQSLGISQSQSELLGTAPSITVILFILLSSYFAKRIGMKKTIILGLLLAGIGGIIPVFTATFQTVLISRVILGAGLGVYNSLAVTYISSLYSGNTRATLLGIRNSMEALGQTILIFLAGVLVNINWTASFLVYAIAFPVALLFALKVPEIRDENSDIPENHVKEKMNPMVFALVLFAILLVMNSIAISVRFASIATEIKGVNFNASNYLALMPILGILAGFMFGPINKWIGKGTLYLGIIFFIISNLLIAVSNGNMTFLLTGLFLSSITGSWCFPFIFSNLDKVTTKNTINFATSLIFIGCNIGNFIAPIAMQLAQFLTRSTNLTAPFFVFAGIFIVILFVTFFATNKKNTRVTRGAS
>NZ_CP020485.1|WP_002323647.1|97958_98291_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIG
>NZ_CP020485.1|WP_002295674.1|98909_99251_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSFEIIEFVADKEE
>NZ_CP020485.1|WP_002297404.1|99487_100738_-|IS110-family-transposase
MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNDSYHFDQIVIGMESTSMYSFHPSMFFHEDEKLKKLNTLVTIENPFRVKQFSRMFDENKTDRNDALRIADFLRIQRFTTSPIKEEKYMALQRLTRTRYQLIKQLIRTKQHFLENLTYKCNTLAREMRDESTSLFSATLISLMTEDFTLDELAELPLEAFCDLLQEKGKGRFKQPEKIAKAIQRAITMSYRLGALAQESINVVLSVLVREIRALEKNIKELDKAIEQVIVVIPEYQCLTSIPGVGKVYAAGLIAEIGQIERFEDQTKLAKYAGLSWKVNQSGNYQSQNTPLTKQGNRYFRYYLVEAANSVKNYLPEYKAFYQSKYKEVPKHQHKRALVLTARKFTRLVDTLLRKHQLYTPPRSVIEK
>NZ_CP020485.1|WP_002295673.1|101147_101387_+|hypothetical-protein
MARPVLEAMDMDTLTKGRYVQLLARGYSPKEVFKALSKGTDMEKERLRKEFDYWRTHNGIKDLKPARPVIKRKKKITQD
>NZ_CP020485.1|WP_002295672.1|101453_101663_+|hypothetical-protein
MNYEEIENRKKVSKEMEEKLLKTMKQKHLKRLSVAQYINDMQLTGKEKACLLGSMKNFEQLRRTYRIHF
>NZ_CP020485.1|WP_002336710.1|101722_102394_+|class-A-sortase
MKKWLFGFLGVTLIVFCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPGYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP020485.1|WP_010729784.1|102446_104423_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYQVHAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVQDVEDKGSNSEYVKNATNKITSAVDENGEITFTDQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDKTGSGFLKNIHLYPKNIVSKLSFELTKFGDDGADQSKQTLLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDQEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGKGLSYVAEKADIKVTNNDGSVVLKENTDYKIENSDSGFVIDFIVNNGQVSDTVANLHGQDLKMTYNMFVNDSAEIANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLEGAEFAAKNAEGKYYGGLTDTDKDGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGDYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQSYVLISCLLLGAGGLSAVVYFKKKA
>NZ_CP020485.1|WP_010729785.1|104435_105191_+|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPVVETNVAKFQQQQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFCVPIIFIYKKIRRRSE
>NZ_CP020485.1|WP_002350398.1|105187_106012_+|hypothetical-protein
MNKRKWLFVCVAALFSTVAYSQLSFADSSDSSTTQTIDNSITAPSETDSSENTTEETADSNISFTESTNPTSESSSETSEKPQDVEDTQVIKQAIHIQKIISSNQINNQGSQVAQQEGINGAKFIVYDITNILEEMSQDDNEKNQSVEIIESKLKDRAKKLSYDQLKKVAEGETKTIDDQEGVIEFSIEVPANKKQAYYIVNESSPENISNSEDIVLLTPVSNEKGEFLTDVWLYPKSEKSEPKEEIKKVVSTGVKKNFFENCWEFFAQLFFDN
>NZ_CP020485.1|WP_025481135.1|106300_108412_+|isopeptide-forming-domain-containing-fimbrial-protein
MEGIMENKIHCTTGRVITLVLFLFLLLFARGTAVQALEKVDPSQIKENNNLVLYHDSDSLRNIEVTGINGFKILDEYSTKKQKVLAWPKVKDLKSTSKIVAHYQKVGTYLGKEIDCDVTFSNFVAHAGVNQDGLAKTINGKKYYNYLLFDKNIYRGFFMQSINVMNAKLEFKYAGTKTKVALSEPQPEIQSKMRSMRAAGIDLNDTFLSIYSLNGQYQQRVSWYNDNNESVGERNIDMREFVGYEKMGSLPYFVTTDTACAEYKAPALSTNNLTSKVVGGRAEKAYSSNDHFTDVVGADTYHRSGVTYTLQGASPTFMIGANTNSMMFSFDTALLWTPQPSKPTKEVFNKANTEEAAHNIDKKVIPQGSDVYYHIHQKFDALTVNTMNKYKSFKITDTFDSKNFDMVSDGKNYDGALWYVEANGTWKKADTGGKLTVSGNTVTYTASDSFLANAANYGRDYILQLHMRAKNDAKGIAPNVATVTFNNDPNKGTQKTNTVENYFSLKPNKKVEQDGKDVDGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDIASDHYKQFSIQDPVEDRLTYKEGSARVIDMSTGKDITSEGTLTYDSNSRTLKWEASADFLSKNLLDGREIQLIFTAKTPLNEELDIDNQAKVSVESIEKATNVVTIGVKPNLPQIIVPKTGSNHLVLTVIGSILFLTLASLGYVVLKLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.2\|96610\|19\|NZ_CP020485\|CRISPRCasFinder	96610-96628	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP020485_1	1.1\|96547\|40\|NZ_CP020485\|CRISPRCasFinder	96547-96586	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|96610|19|NZ_CP020485|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|96547|40|NZ_CP020485|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2691 : 55756

Bacillus_phage(28.57%)

integrase,transposase

attL 3942:3958|attR 12723:12739

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002300314.1\|2691_3861_+\|transposase	IS256 family transposase	NA	NA	NA	NA
3942:3958	attL	NA	NA	NA	NA
WP_002290383.1\|4333_4888_+\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002290382.1\|5060_5534_-\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
WP_002342357.1\|5545_6082_+	glyoxalase	NA	NA	NA	NA
WP_002290380.1\|6121_6493_+	glyoxalase	NA	NA	NA	NA
WP_002290379.1\|6776_8048_+	substrate-binding domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	4.1e-17	45.0
WP_002338088.1\|8292_9318_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002350067.1\|9611_10721_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002350071.1\|11715_12540_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002329911.1\|12571_13882_+	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
12723:12739	attR	NA	NA	NA	NA
WP_002290371.1\|14029_15289_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_002290370.1\|15298_16171_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002290368.1\|16182_17013_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002290367.1\|17052_19236_+	alpha-galactosidase	NA	NA	NA	NA
WP_002342361.1\|19296_20517_+	hypothetical protein	NA	NA	NA	NA
WP_002335326.1\|20513_21974_+	sucrose phosphorylase	NA	NA	NA	NA
WP_002290357.1\|23478_23688_+	DUF3173 domain-containing protein	NA	NA	NA	NA
WP_002290356.1\|23680_23830_+	hypothetical protein	NA	NA	NA	NA
WP_002290352.1\|24932_26018_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_002290351.1\|26351_26585_+	addiction module antitoxin	NA	NA	NA	NA
WP_002329899.1\|26581_26989_+	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	4.0e-14	38.9
WP_002287870.1\|28125_28644_-	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002305874.1\|29010_29259_+	hypothetical protein	NA	NA	NA	NA
WP_108676098.1\|29761_30923_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002300328.1\|31421_31898_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289252.1\|31910_33413_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002289253.1\|33426_34116_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289254.1\|34276_35095_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289255.1\|35324_35555_+	resolvase	NA	NA	NA	NA
WP_002301718.1\|36140_36596_-\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_086953894.1\|36838_38264_+\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002297218.1\|38440_39736_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_002302077.1\|39956_40919_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_002302078.1\|40920_42360_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002293868.1\|42544_44491_+	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002292418.1\|44754_45627_+	ROK family protein	NA	NA	NA	NA
WP_010729776.1\|47484_47955_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.5e-09	33.6
WP_000824191.1\|47999_48167_-	hypothetical protein	NA	NA	NA	NA
WP_000366408.1\|48200_48500_-	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|48540_49158_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_002304891.1\|49482_49878_-	hypothetical protein	NA	NA	NA	NA
WP_000344083.1\|49957_52309_-	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_000718009.1\|52433_53123_-	hypothetical protein	NA	NA	NA	NA
WP_000751236.1\|53136_53589_-	hypothetical protein	NA	NA	NA	NA
WP_086968564.1\|53823_54965_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
WP_001015311.1\|55075_55756_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

DBSCAN-SWA_2

69251 : 110507

Streptococcus_phage(45.45%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059355947.1\|69251_70874_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-121	47.3
WP_002301195.1\|71159_72536_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|72535_73192_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|73201_74479_-	ABC transporter permease	NA	NA	NA	NA
WP_087121905.1\|74728_75890_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_010729386.1\|75920_76370_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_002298088.1\|76525_77068_-	hypothetical protein	NA	NA	NA	NA
WP_002331383.1\|78061_78742_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_002292680.1\|78989_79847_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002292678.1\|80408_80738_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002314366.1\|80814_81087_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002297422.1\|81086_81350_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002336205.1\|82494_83670_-	MFS transporter	NA	NA	NA	NA
WP_002314387.1\|83672_85922_-	alpha-galactosidase	NA	NA	NA	NA
WP_002287525.1\|86971_88120_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|88136_88541_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002323400.1\|89847_90783_-	hypothetical protein	NA	NA	NA	NA
WP_002290394.1\|91341_91659_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002323399.1\|91659_91914_-	hypothetical protein	NA	NA	NA	NA
WP_002287522.1\|92272_92677_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002323589.1\|92693_93842_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
WP_002348857.1\|94548_94743_-	hypothetical protein	NA	NA	NA	NA
WP_002326172.1\|96094_97135_+	replication protein RepA	NA	NA	NA	NA
WP_002323647.1\|97958_98291_+	hypothetical protein	NA	NA	NA	NA
WP_002295674.1\|98909_99251_+	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	1.5e-35	62.5
WP_002297404.1\|99487_100738_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295673.1\|101147_101387_+	hypothetical protein	NA	NA	NA	NA
WP_002295672.1\|101453_101663_+	hypothetical protein	NA	NA	NA	NA
WP_002336710.1\|101722_102394_+	class A sortase	NA	NA	NA	NA
WP_010729784.1\|102446_104423_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_010729785.1\|104435_105191_+	class C sortase	NA	NA	NA	NA
WP_002350398.1\|105187_106012_+	hypothetical protein	NA	NA	NA	NA
WP_025481135.1\|106300_108412_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002350400.1\|108449_110507_-\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

146867 : 194217

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010861579.1\|146867_147548_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	98.7
WP_010729797.1\|147601_148312_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010729798.1\|148295_149030_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002301686.1\|149246_150260_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002301685.1\|150270_150681_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002301684.1\|150680_151148_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002301683.1\|151165_151912_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002301682.1\|151911_152721_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_080114943.1\|154683_155085_-	hypothetical protein	A0A0N9S006	Staphylococcus_phage	2.5e-24	49.2
WP_010729801.1\|155311_156490_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.7e-23	27.1
WP_074394709.1\|156537_157275_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_002299198.1\|157432_158362_-	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	1.1e-06	23.3
WP_002299197.1\|158434_159046_-	VanZ family protein	NA	NA	NA	NA
WP_010729802.1\|159261_160170_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002311511.1\|161628_162471_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002298377.1\|162795_163212_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002298375.1\|163208_163679_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_010729805.1\|163692_164466_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298371.1\|164479_165292_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002322451.1\|165345_166311_+	SIS domain-containing protein	NA	NA	NA	NA
WP_010729806.1\|166446_169170_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_010729807.1\|169182_169815_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	3.0e-08	27.9
WP_077974475.1\|170019_170247_+	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_014748823.1\|170315_170582_+	antitoxin	NA	NA	NA	NA
WP_002389879.1\|170571_170841_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	8.7e-18	48.8
WP_002302440.1\|171019_172321_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002296127.1\|172549_174097_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002287659.1\|174198_174552_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002285758.1\|174541_174736_-	hypothetical protein	NA	NA	NA	NA
WP_010729749.1\|174814_176107_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002336724.1\|176869_177838_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002288615.1\|177848_178664_+	fructoselysine 6-kinase	NA	NA	NA	NA
WP_010729750.1\|178731_179442_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002288620.1\|179477_180719_+	amidohydrolase family protein	NA	NA	NA	NA
WP_002296840.1\|180776_181964_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002298077.1\|182498_183899_+	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
WP_002322961.1\|183931_184099_+	hypothetical protein	NA	NA	NA	NA
WP_002350223.1\|184964_185825_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162846309.1\|186257_187178_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_016922376.1\|187226_187832_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.3e-56	53.2
WP_002339142.1\|187851_189072_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.9e-57	58.5
WP_002336713.1\|189129_189810_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_002331328.1\|190305_190527_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002342384.1\|190542_191385_+	hypothetical protein	NA	NA	NA	NA
WP_010729753.1\|191447_193250_+	exonuclease DNA polymerase III epsilon subunit	A0A0A7RWA3	Clostridium_phage	7.6e-33	30.4
WP_010729754.1\|193308_194217_-\|transposase	IS982 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020486

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP020484

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP020485

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection