CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP020036	Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence	0 crisprs	NA	0
NZ_CP020034	Vibrio parahaemolyticus strain 20130629002S01 chromosome I, complete sequence	0 crisprs	DEDDh,WYL,DinG,cas3,csx1,csa3	3
NZ_CP020035	Vibrio parahaemolyticus strain 20130629002S01 chromosome II, complete sequence	2 crisprs	DEDDh,WYL,csa3,cas3	2
NZ_CP020037	Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX2, complete sequence	0 crisprs	NA	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020035_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020035_1

54224-54321

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP020035_1

>merge|NZ_CP020035|1|54224-54321|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP020035|1|1|54224-54321|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020035.1\|WP_005460804.1\|53382_54165_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP020035.1\|WP_031822518.1\|44205_44610_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020035.1\|WP_005467181.1\|55732_56053_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP020035.1\|WP_085576876.1\|44619_45711_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP020035.1\|WP_025612130.1\|50717_51428_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP020035.1\|WP_005460834.1\|58757_59381_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP020035.1\|WP_005482884.1\|57816_58746_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP020035.1\|WP_031855868.1\|48960_49767_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP020035.1\|WP_005464966.1\|46617_47457_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP020035.1\|WP_031855867.1\|51430_53299_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP020035.1\|WP_005482916.1\|54420_55182_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP020035.1\|WP_031855865.1\|61434_62112_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP020035.1\|WP_031855864.1\|62127_64356_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020035.1\|WP_031855866.1\|56806_57718_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP020035.1\|WP_005460779.1\|56093_56729_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP020035.1\|WP_005482833.1\|45710_46172_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP020035.1\|WP_005464962.1\|47518_48667_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP020035.1\|WP_085577174.1\|59565_61305_-\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP020035.1\|WP_005497706.1\|55200_55725_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP020035.1\|WP_005464972.1\|49847_50717_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159

Protein	Function_ID	Function_description	E-value
NZ_CP020035.1\|WP_005460804.1\|53382_54165_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP020035.1\|WP_005467181.1\|55732_56053_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP020035.1\|WP_085576876.1\|44619_45711_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.89478e-44
NZ_CP020035.1\|WP_025612130.1\|50717_51428_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	1.18467e-38
NZ_CP020035.1\|WP_005460834.1\|58757_59381_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP020035.1\|WP_005482884.1\|57816_58746_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP020035.1\|WP_031855868.1\|48960_49767_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	2.29303e-95
NZ_CP020035.1\|WP_005464966.1\|46617_47457_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	5.2905e-143
NZ_CP020035.1\|WP_031855867.1\|51430_53299_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.41362e-139
NZ_CP020035.1\|WP_005482916.1\|54420_55182_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP020035.1\|WP_031855865.1\|61434_62112_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.32082e-24
NZ_CP020035.1\|WP_031855866.1\|56806_57718_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	5.43533e-18
NZ_CP020035.1\|WP_005460779.1\|56093_56729_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP020035.1\|WP_005482833.1\|45710_46172_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP020035.1\|WP_005464962.1\|47518_48667_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP020035.1\|WP_085577174.1\|59565_61305_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	8.83288e-109
NZ_CP020035.1\|WP_005497706.1\|55200_55725_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50
NZ_CP020035.1\|WP_005464972.1\|49847_50717_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108

>NZ_CP020035.1|WP_005460804.1|53382_54165_-|DNA-binding-transcriptional-regulator-KdgR
MEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP020035.1|WP_031855867.1|51430_53299_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRNVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP020035.1|WP_025612130.1|50717_51428_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVVDDWPIVLKDYLQRPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP020035.1|WP_005464972.1|49847_50717_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP020035.1|WP_031855868.1|48960_49767_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVMLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSEGEQTELELEPGQAYLDALKEHFGIELDAQYGDLRPLPDA
>NZ_CP020035.1|WP_005464962.1|47518_48667_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP020035.1|WP_005464966.1|46617_47457_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP020035.1|WP_005482833.1|45710_46172_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP020035.1|WP_085576876.1|44619_45711_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLKNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP020035.1|WP_031822518.1|44205_44610_-|hypothetical-protein
MMRKFMQILLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGRIYQYHNDLWVPKSDGKLQHFLVSATTNYVR
>NZ_CP020035.1|WP_005482916.1|54420_55182_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP020035.1|WP_005497706.1|55200_55725_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP020035.1|WP_005467181.1|55732_56053_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP020035.1|WP_005460779.1|56093_56729_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP020035.1|WP_031855866.1|56806_57718_+|alpha/beta-hydrolase
MHVAPITSLQTWFSEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFEITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGVDSARVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSIVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLTEKARR
>NZ_CP020035.1|WP_005482884.1|57816_58746_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP020035.1|WP_005460834.1|58757_59381_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP020035.1|WP_085577174.1|59565_61305_-|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVIVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAYTTPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALDQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSCQQLMVGKIATVVSGVLATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSLPLTPRESKDLSVVATLAVHLLVTGGFFLSTRVFYAKESPSIQQSRTALAIQLATPISDEEQSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP020035.1|WP_031855865.1|61434_62112_+|porin
MKVRYITSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP020035.1|WP_031855864.1|62127_64356_+|hypothetical-protein
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGDVVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYLEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNGKVVAKQTVTAGELFSQWLTLGSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDFATAVELLPAGGTIILKDGDYQGMEIPLTASGSVDKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKTLAPLKQASVIDTQQAIPGKQEAMQLKQLIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020035_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020035_2

601212-601345

Orphan

Consensus_repeat	Method
GGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020035_2

>merge|NZ_CP020035|2|601212-601345|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAAGGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

>NZ_CP020035|2|2|601212-601345|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGG	TCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAA
GGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020035.1\|WP_031429030.1\|607424_607976_+\|membrane-protein	unknown	unknown	gnl\|CDD\|227700
NZ_CP020035.1\|WP_017448088.1\|596282_597086_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP020035.1\|WP_031856165.1\|609793_611398_-\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
NZ_CP020035.1\|WP_017448089.1\|597157_599164_-\|exoribonuclease-II	unknown	unknown	gnl\|CDD\|179920
NZ_CP020035.1\|WP_031856166.1\|608910_609756_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|235664
NZ_CP020035.1\|WP_031429028.1\|608011_608914_-\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|180206
NZ_CP020035.1\|WP_005462115.1\|594105_594786_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NZ_CP020035.1\|WP_017448084.1\|588956_591326_-\|arylsulfatase	unknown	unknown	gnl\|CDD\|293749
NZ_CP020035.1\|WP_005462121.1\|594840_595668_-\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270371
NZ_CP020035.1\|WP_005482667.1\|587713_587887_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020035.1\|WP_050505278.1\|587999_588935_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP020035.1\|WP_005455792.1\|612680_613055_-\|MerR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133403
NZ_CP020035.1\|WP_005462123.1\|595924_596278_+\|DUF3024-domain-containing-protein	unknown	unknown	gnl\|CDD\|371425
NZ_CP020035.1\|WP_005485953.1\|606520_607399_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP020035.1\|WP_025789597.1\|592707_593661_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP020035.1\|WP_021821499.1\|601549_603088_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP020035.1\|WP_005483382.1\|603448_604642_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|183528
NZ_CP020035.1\|WP_031856037.1\|591333_592572_-\|anaerobic-sulfatase-maturase	unknown	unknown	gnl\|CDD\|188457
NZ_CP020035.1\|WP_031856164.1\|611432_612602_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173845
NZ_CP020035.1\|WP_031429032.1\|604921_606235_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|206779

Protein	Function_ID	Function_description	E-value
NZ_CP020035.1\|WP_031429030.1\|607424_607976_+\|membrane-protein	gnl\|CDD\|227700	COG5413, COG5413, Uncharacterized integral membrane protein [Function unknown].	2.70825e-24
NZ_CP020035.1\|WP_017448088.1\|596282_597086_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	6.54448e-25
NZ_CP020035.1\|WP_031856165.1\|609793_611398_-\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NZ_CP020035.1\|WP_017448089.1\|597157_599164_-\|exoribonuclease-II	gnl\|CDD\|179920	PRK05054, PRK05054, exoribonuclease II; Provisional.	0
NZ_CP020035.1\|WP_031856166.1\|608910_609756_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	5.37672e-98
NZ_CP020035.1\|WP_031429028.1\|608011_608914_-\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|180206	PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyase; Provisional.	2.28893e-178
NZ_CP020035.1\|WP_005462115.1\|594105_594786_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	4.13783e-69
NZ_CP020035.1\|WP_017448084.1\|588956_591326_-\|arylsulfatase	gnl\|CDD\|293749	cd16025, PAS_like, Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	0
NZ_CP020035.1\|WP_005462121.1\|594840_595668_-\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.95335e-86
NZ_CP020035.1\|WP_025789597.1\|592707_593661_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.15092e-30
NZ_CP020035.1\|WP_050505278.1\|587999_588935_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.91909e-26
NZ_CP020035.1\|WP_005455792.1\|612680_613055_-\|MerR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|133403	cd04776, HTH_GnyR, Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	3.20261e-51
NZ_CP020035.1\|WP_005462123.1\|595924_596278_+\|DUF3024-domain-containing-protein	gnl\|CDD\|371425	pfam11225, DUF3024, Protein of unknown function (DUF3024). This family of proteins has no known function.	1.37712e-19
NZ_CP020035.1\|WP_005485953.1\|606520_607399_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	5.12613e-12
NZ_CP020035.1\|WP_021821499.1\|601549_603088_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.96718e-91
NZ_CP020035.1\|WP_005483382.1\|603448_604642_+\|acetate/propionate-family-kinase	gnl\|CDD\|183528	PRK12440, PRK12440, acetate/propionate family kinase.	0
NZ_CP020035.1\|WP_031856037.1\|591333_592572_-\|anaerobic-sulfatase-maturase	gnl\|CDD\|188457	TIGR03942, sulfatase_rSAM, anaerobic sulfatase-maturating enzyme. Members of this protein family are radical SAM family enzymes, maturases that prepare the oxygen-sensitive radical required in the active site of anaerobic sulfatases. This maturase role has led to many misleading legacy annotations suggesting that this enzyme maturase is instead a sulfatase regulatory protein. All members of the seed alignment are radical SAM enzymes encoded next to or near an anaerobic sulfatase. Note that a single genome may encode more than one sulfatase/maturase pair. [Protein fate, Protein modification and repair].	0
NZ_CP020035.1\|WP_031856164.1\|611432_612602_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|173845	cd01156, IVD, Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA. IVD is a homotetramer and has the greatest affinity for small branched chain substrates.	0
NZ_CP020035.1\|WP_031429032.1\|604921_606235_+\|PAS-domain-S-box-protein	gnl\|CDD\|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	2.1106e-45

>NZ_CP020035.1|WP_017448089.1|597157_599164_-|exoribonuclease-II
MFQDNPLLAQLKQQIQENLPKKEGSIKATDKGFGFLEVDSKTSFFIPPAYMKKCIHGDKVVAIIRTENEREVAEPQELIEQSLTRFIGRVKMFKGKLNVVPDHPQLKKLSLKAKLKKGLKPDNFAEGDWVVAHLVRHPLKGDNTFFVEISEKITDADDKIAPWWVTLAQNDLPNSEPAGIENWELKDDADLERIDMTHVPFVTIDGESTKDMDDALYAKKTESGDFELTIAIADPTAYITPEDEMDKVARERGYTIYLPGRNIPMLPRDLADNLCSLIEGEIRPAICCTVTVSKDGVIGDDIKFFAANIKSHARLAYDHVSDWLENGNSDAWQPSEEIATIVRDLYEFSLARAEWREKNAVVFPDRPDYRFELSEDNDVIAIHADMRRSANRLVEESMITANICAGRTLREKFETGVFNTHAGLKPEKIEEVVQLVNPEGTLEFTAESIATLEGFAALRRWLAVQETSYLDNRIRKFQAYSEVGNQPLPHYAMGLDIYATWTSPIRKYGDMINHRMLKAVILDKEPVQKPDDQVGEELALHRKHHKIAERNVSDWLYARTLADEPSKQTCFTGEIFDINRAGARVRLLENGAAAFIPGALILDNKERIECNGDNGTISIDKEVVYKLGDTLEIVLADVNQENRSLVAKPTQVFADQPAAQTEQTVSEE
>NZ_CP020035.1|WP_017448088.1|596282_597086_-|helix-turn-helix-transcriptional-regulator
MPNIEIIRFNHFTARKSERYTATHNGLYVVEEGALVVHQPNGEQFELQAGDFTLYNSSDLRSAEAIPGENGFKAVALVFDISLFCEFKKAHPGLHSEAEHRRFYPFSPESNSEITQLKNTLLALASRNAPDYTQSHIAMALLSLMVEVQPDILSIIDDASSLTASQKAIKYIEKNIEKDITLEGLAAHMSMSIATLKRRLAAENLSFSQILKVKRINYAATQLRVSQKSITEIAFESGFKSAAHFSTAFKSIYNITPKDFRNQVVRG
>NZ_CP020035.1|WP_005462123.1|595924_596278_+|DUF3024-domain-containing-protein
MSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVELHHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEEIRWIPYKKLPHSHTLEDLLAELESDPQACFWE
>NZ_CP020035.1|WP_005462121.1|594840_595668_-|phosphate-ABC-transporter-substrate-binding-protein
MLRFTVATLLAMAVSLPSAMAKEVNISGSTSVARVMDVLAEEYNKTHPDNYIAVQGIGSSAGITMVNKGVVKLGMSSRYLTESEKGEDLNVFPIAYDGLAVVVNRTNSVTNLSAQQLFDIYKGEIKNWKEVGGADQPIAVVTREASSGSRYSFESLLGLTKIINDRLVSDISPNNLVVNSNSMVKTIVNHNTRAIGFISVGSVDLSVKAIQFNGIEPTAANIANHKYKLARPFLVLYKVDSLDQAGKDFVAFLKSEAGQKTIADYGYIPVKNFNQ
>NZ_CP020035.1|WP_005462115.1|594105_594786_+|MaoC-family-dehydratase
MKVTNLFKDKVDAISAHQSEFMNWMSPTLRDYWSDFLGKAQNSFLFSNVRDHNQPAVNEEVAPQPAPIVLQPEAQKLYDELSGKIGEVIHTGDWVHVSQERINQFGAVTEDMQWIHTDPERASVESPFKTTIAHGFLTLALLPKLTDSVDADKPLFPTAKLVVNLGLNQVRFPYPVKAGNNVRAVSTLTKVTPIKKGLEIEREIKVEIEGVRRPGAVVVSVIQLHF
>NZ_CP020035.1|WP_025789597.1|592707_593661_+|LysR-family-transcriptional-regulator
MIFNYNLLKPLALLLETKSITATANQMSTSASAVSRTLRSLREIFQDELLTRKNGRMELTPKAISIRAKLNNIIHDIDDLTEDMSFDPSTSDIKINIAMNSYIAYWLAPEIIQYFSENAPNIELTIEDWNELTPDRINNQLVHFGIHYFPLNLNKNLVQRKVGKDMSVMVCRKDHPINNESISLETIASYPLAIHLQKHWNERQDKLSRLLLSHGIDFKVKLKTTHINVIINAVETTDLLFPCSIYIAEQLGEKFSYITSSDEVFLPLQEKEFGFIYDKAYKNDPMIVWLHSTISKLMNDFLDVYNKKFDSRYEKSR
>NZ_CP020035.1|WP_031856037.1|591333_592572_-|anaerobic-sulfatase-maturase
MAGLHTTVKVVGSKCNYDCQYCFYLEKDLLLKSKKSMNIETLKTYIKNYISSQDTPIVEFAWHGGEPTLIGIDFFEKAVEFQKQYANGKLIKNTIQTNGSKLNSDWCRFFRENNFLVGLSLDGPEWLQEKYRTKQGKSAFKESFSALKLLQKMNVEYNVLACVTKEYCKHAEAIYSFFRKNKVKHIQFSPLVESSPSETEQARGQHFGSNLIFSTDKRHTDPQKYEPIAWSVDAKEYGRFLTDVFHLWVSQDVGKVFISNFEQALTQYLGNPSPNCIHAKKCGSSYAVEANGDVYFCDHVAYPESKLGNVFETSLHEMSLNHELQFNKESRLSMRCKQCQFLSLCNGGCPKHRYLSDTGEHENVLCDGYFYFFSSVQKYLQAMTTLLAHGYPASYVMQALDGPLILTPSNKR
>NZ_CP020035.1|WP_017448084.1|588956_591326_-|arylsulfatase
MDILKTTVTITGALAPCLVAAGTVDRTKLPIPDIEPQTYTQLDVRDVQRPEPTRRIAAPKDAPNVLVILLDDVGFSQSSLFGGAVDMPTLDALAKQGLIYNQFHTTGVSSATRTALLTGRNHHQNNMGSIAETSTAFPGNTSVRPNYIAALPKILKYNGYSTAMFGKNHEIPAWETGPAGNQTLWPSEVGFDKFYGFFGGETDQFQPVLIDGNTRIKTPRKKNYHFTADMTDQTIEWLNLQHSYNADQPFFAYYAPGAAHAPHQAPREWIDKFKGKFSMGWDKLRQESFERQKKLGIIPQDTVLPPMPDFVPRWDSLSSDEKRVFERQMEVYAGFLAHTDHEIGRVIDTLKKNGEFDNTLIFYIVGDNGASAEGNRNGSFNSLAFYNLITEDPNRVLENIDKLGGPDSFPHYASGWAVAGDSPFTWTKGMSSDFGGTRNGMVVSWPAGIDNKGQPLRDQWSHVVDIAPTVLEAANLPVPKEVDGVEQIPMAGVSFTNTFKETKAQTRHKPQYFELGGNRAIYHEGWLARVTHWALTEGSTKFRDLQDDKWELYDTTKDFSLANDLAKSNPQKLEELKKLFDKEAEKNHVYPIDDRTMERVNAEIAGRPDALFGKKSLTLYEGARGIPENSFLNIKNKSFDIVADISTDNASKTNGVIIAQGGNFGGWTLYVKNGVPTFEYNWLTYEYTKVSGSKLKEGKNEIKVAFRYDENGQGGKGNAAGRGKGGNVYLYVNDKLVEKKLIPNTNSRLFSLDDGVGIGEDEGGAVSKDYQAPFEFNQKIEQVTTSIVQ
>NZ_CP020035.1|WP_050505278.1|587999_588935_-|LysR-family-transcriptional-regulator
MLIVAQESLLTPVDFPNNSLLEFKMSKAIDLNLINTFIVVTECLSYTKAADKLGVTQPAISASIKRLERTTNTKLFTKRGRNIELTSTAQKWLPQLQQALSVIDSVITQPAPYNVYCSNIYPAQQSKLENVFFHESTLSENHLFSLLYSNEADLLLGDIESREASIIVEDVCREPCVVICRNGHPRIGDHISTEMLSDEKHCVLASKWSFDTEFEKHLGLIVKSNNIDSIASNYLGILTHVAQNDCIGVIPLSLAKKWGKTFNIKHFTSPLGACFIQYQIAYHQRKVNCKRHGAMRALIKSKVLEGQQRII
>NZ_CP020035.1|WP_005482667.1|587713_587887_+|hypothetical-protein
MVTQNTNFSPEQPKHEKDEQQNVAIVEFNSSVLSRQSTDFLTHEELKMLEAVIGIAF
>NZ_CP020035.1|WP_021821499.1|601549_603088_-|bifunctional-diguanylate-cyclase/phosphodiesterase
MTKNICSKTEVPGWTWLLMLISCFIFAYAAFLHAIMKKPVASLLETGVSLLLFGGSIFVVLVIKWSNDSILELHSVAEREKRNAVHDSLTGLPNRKYCFELIDDRIQSGDPFSVILFDVVNFKQVNDAMGHFCGDQLLIQIGQRLQDKLKGSDKIFRVGGDEFVILTSSACEKTGTELIESLDCALSARFHLDEFQVSSRVVFGISTYPYDAISNDLLIKHADIAMYHAKRNGNLFAFYHDDMNVGAKYQLEISSRIQCALEKEEFQLYYQPLIDANTNLAVGFEAVIRWHDENGKTISPNDFIPIAERSNQVHNITMWVLGQVEKDLKTFIEKGIKLPVHVNLSAKDLSSNLLFHRLEKLLENNPQFADLISLEITETMAIDRVVELNPLIHQIKGLGIKISLDDFGTGYSSLSLLRDLPVDQIKIDRSFLCTANRTEGSRSIVENTIALAHGLGYSVVAEGVQDMDTLYFLRSRGCDIIQGYLFCPALPLNEVINWVNEHDDKQSHTRRA
>NZ_CP020035.1|WP_005483382.1|603448_604642_+|acetate/propionate-family-kinase
MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARMSWKFNGEKKEISIEGDDSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTKTVRITEEVTQEIEKLADLAPLHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFTGAIAKELYTDFGIRRYGFHGTSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAINNGESVDTSMGFTPLSGLMMGTRCGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVSGLTSDARGILEAMEEGHEGAALAFQVFTYRVSKYIASYLAALDSFDGIIFTGGIGENSMPIRREILKNLKLLGFVEDVKGNEDARFGNAGVIATSELLGAKALVIPTNEEWVIAQQSVELL
>NZ_CP020035.1|WP_031429032.1|604921_606235_+|PAS-domain-S-box-protein
MFFNKSLQQENQRLKQELYSLQQIQQSLDEEMLRLTLDAKGNVTSANQKFLQQLSLSDKDILAKHISDLVPSNVRNTDHFYRMKQSVQAKAFWNGAFQITKGDGEEAWLRVVIQPVRNTSDQVESFFVFASELTRTITTSREYEDMLNALSRSMAVIEFTLDGTVLKGNDNFLSTMGYKHEQIVGKHHRIFCLPEEANSSAYHDFWKRLASGQFVTDRFKRVDQYGSVVWLEASYNPIHNDRGELYKVVKFATNITQQVLQEQSMAQAAQLANEVSQETGTQTVQGRQVIGSTLEKMQTLSEQMQQANAAIEDLKAHSSKISELVNSISGIADQTNLLALNAAIEAARAGDHGRGFAVVADEVRQLAMRTNTTTDEIVSMVTENLERTNNAVALISQCQKEALDTLELSEKAGNVMNDIQDGASRVVEAVAQFNRTL
>NZ_CP020035.1|WP_005485953.1|606520_607399_+|DMT-family-transporter
MFNSERKATVILVATTMIAALGWIFSKETIQGLPPFGFIGLRFTIASLCLLPLCYRPLKAARLKDVLAASGVGLLLGGAVMTWIYAISISDTLGEGAFIMSLSMLFVPIVAWVMFQQRPQRIFWISLPIAVIGLACLSLAGGWKQSASQLWFLGAALILALHFNVNSKYSQKLPVLLLTCVQLFSAGCLGLLVSFLMESRPEQVDSSIWWWFALSTLLATSLRYVMQTMGQKFVQAGNAALIMILEPVWTVVLSILWYGEVLTANKLVGCLLILFSLVIYRTGGRFRFPKRA
>NZ_CP020035.1|WP_031429030.1|607424_607976_+|membrane-protein
MANTEHQETLDFLDKLSVCLYRAGISVFAIALLGLAALESQWLDGVDGRYRAVFAVFAIAGAMSASNIHVYSKSVRTIISWSGWIGVILMVCDPELNRVWLALGFIFVTFSGIALKESFCFKVLGLKLVPTLLVVTTFALWFEQSTIVAISALLAGLIMAYLSIAKWRMPLHFDIGIKENYEV
>NZ_CP020035.1|WP_031429028.1|608011_608914_-|hydroxymethylglutaryl-CoA-lyase
MTLPTNVTIVEVGPRDGLQNESPVSTRTKIRLIDLLSDTGLSHIEAGSFVSPKWVPQMADSKEVMQNITRRASVTYSALTPNLQGLEQALDAGANQVAIFTSASEGFCQHNINCSIAESLKRFEPLMVQADKYHVPVRGYLSCVVDCPYDGATSPTQVANISQALIELGCYEVSLGDTIGTGTPNRVKEMLESVLASIPNQRLAVHFHDTWGQALANIYQALSMGINTVDSSVAGLGGCPYAHGASGNVATEDVLYLCQGLGIETGVDLELLAKAGWMISDELQRQPTSKVSQALCHRME
>NZ_CP020035.1|WP_031856166.1|608910_609756_-|enoyl-CoA-hydratase/isomerase-family-protein
MQERQPSIVPNAQRHNDVLWQVDEFGVATLTLNRTKKHNAFDACMIDLIIHRLDYLALRTDVRCLVLRSNGKHFSSGADLAWMQSMANSTRKENLVDAQSLARLMETLDAFPKPTIAVVQGSAFGGALGLICCSDIAIASHSAEFCLSEVKLGLVPATIAPYVMRAMGNRQARRYILSGEVIPAVKAQQFGIVHEVKKDDELESCVSKVVASLLLNSPDAMRKAKALCEQCHQNPIDSQLIRYTSQLIADIRVSPQGQDGLQAFLEKRPPSWVHQPDAEEE
>NZ_CP020035.1|WP_031856165.1|609793_611398_-|methylcrotonoyl-CoA-carboxylase
MAIIKSKTKPTDELFLSNQAAMEMLVEKLQKDIATIKLGGGERAIAHQRQKGKLPVRERISHLLDDGSNFLEIGQFAAWQVYDESIPCAGVVAGIGMIEGIQCMVIANDPSVKGGTYYPLTVKKHLRAQEIAQRCQLPCVYLVDSGGANLPHQSDVFPDKDHFGRIFFNQARMSAKGIPQIAVVMGLCTAGGAYVPAMADVSIMVKEQGTIFLAGPPLVKAATGEVVTGEELGGADVHCRKSGVADYYAENDEHALDLARKAIANANRPKQPKSNSAILPPRYDAEEMYGIVNANLRLSFDVREIIARIVDDSDFDEFKALYGRTLVCGFARIHGQLIGIVANNGILFSDSSQKGAHFIELCAKRKTPLLFLQNITGFMVGKKVEEEGIAKHGAKLVMAVACADVPKFTVIIGGSYGAGNYGMCGRAYDPTMMWMWPNARISVMGEEQAAGVLTQVRKEINQRRGEEWSEQEEHTFKESIIDLYETQGHPYFASARLWDDGIIDPRETRNVLAQALMAALNAPIPDSEFGIFRM
>NZ_CP020035.1|WP_031856164.1|611432_612602_-|isovaleryl-CoA-dehydrogenase
MKTSYIPLNFGLGETIDMLRDHVNAFASEHIAPIAADIDHYNQFPSHLWPLLGEMGLLGVTVSEEYGGAEMGYLAHVVAMEEISRASASVALSYGAHSNLCVNQIFRNGTPTQREKYLPKLVDGSHIGALAMSEVNSGSDVVSMQLKAEDKGDHFLLNGTKMWITNGPDADVVVVYARTDADAGSRGITAFIVERSFTGFSDAQKLDKLGMRGSNTSELVFNNCKVPKENILGALNCGVEVLMSGLDYERVVLAAGPLGIMQACMDIVVPYVHERKQFGKSIGEFQLVQGKLADMYSRMNAAKAYVYTVAAACDRGECTRKDAAGVILYSAELATQMALNAIQLLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRMLIGRELFEESR
>NZ_CP020035.1|WP_005455792.1|612680_613055_-|MerR-family-DNA-binding-transcriptional-regulator
MEKYKISDLAKEFDITTRSIRFYEDVGLIEPERKGNMRVYQRRDKIRLKLILRGKRLGFSLAEIRELFELYDMQQTDEQLLKMLNIIEEKQAVLQQQLNDIGVVMGELNAAKERCLQTLKNNEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

765802 : 802608

Gordonia_phage(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024702350.1\|765802_766834_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_108744620.1\|767471_769020_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	3.9e-09	25.5
WP_031856292.1\|770331_770886_+	hypothetical protein	NA	NA	NA	NA
WP_138058906.1\|770980_771484_+	hypothetical protein	NA	NA	NA	NA
WP_158090639.1\|771510_774237_+	TcfC E-set like domain-containing protein	NA	NA	NA	NA
WP_139833625.1\|774250_774961_+	hypothetical protein	NA	NA	NA	NA
WP_031856297.1\|774944_776039_+	hypothetical protein	NA	NA	NA	NA
WP_031856298.1\|776035_776689_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_050505292.1\|776700_779001_+	hypothetical protein	NA	NA	NA	NA
WP_031856300.1\|779099_779975_+	hypothetical protein	NA	NA	NA	NA
WP_031856301.1\|779979_781428_+	EAL domain-containing protein	NA	NA	NA	NA
WP_031856302.1\|781501_781912_+	hypothetical protein	NA	NA	NA	NA
WP_158090023.1\|782127_782601_+	transglutaminase-like cysteine peptidase	NA	NA	NA	NA
WP_108744620.1\|783516_785066_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	3.9e-09	25.5
WP_024702350.1\|785703_786735_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_031856440.1\|787961_788192_+	hypothetical protein	NA	NA	NA	NA
WP_031856441.1\|788188_788707_+	hypothetical protein	NA	NA	NA	NA
WP_139833612.1\|789209_791234_+	TcfC E-set like domain-containing protein	NA	NA	NA	NA
WP_031855789.1\|791202_792246_+	hypothetical protein	NA	NA	NA	NA
WP_139833613.1\|792256_792484_+	hypothetical protein	NA	NA	NA	NA
WP_085576883.1\|792655_793765_+	CZB domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-14	46.8
WP_031855791.1\|793923_794844_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.3e-166	92.5
WP_031855792.1\|797654_798347_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.1e-37	39.3
WP_031855794.1\|799155_799491_+	hypothetical protein	NA	NA	NA	NA
WP_031855795.1\|799546_800794_+	outer membrane protein transport protein	NA	NA	NA	NA
WP_085576882.1\|800849_802004_+	hypothetical protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-20	27.4
WP_031855796.1\|802185_802608_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	7.3e-19	34.1

DBSCAN-SWA_2

1060334 : 1070018

Vibrio_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108744628.1\|1060334_1060691_-	hypothetical protein	Q9MCC3	Vibrio_phage	4.5e-38	78.8
WP_108744629.1\|1060896_1061220_+	hypothetical protein	U3PB60	Vibrio_phage	4.6e-05	59.2
WP_108744630.1\|1061219_1061777_+	3'-5' exonuclease	W6ASW5	Vibrio_phage	2.9e-55	57.7
WP_108744631.1\|1061779_1063807_+	replication endonuclease	A0A0F6YPA7	Vibrio_phage	3.3e-186	57.6
WP_168192512.1\|1063885_1064200_+	chemotaxis protein	Q2PZB5	Vibrio_virus	1.2e-23	50.5
WP_146186907.1\|1064267_1064447_+	hypothetical protein	NA	NA	NA	NA
WP_108744632.1\|1064461_1064665_+	hypothetical protein	NA	NA	NA	NA
WP_108744633.1\|1064802_1066326_+	hypothetical protein	NA	NA	NA	NA
WP_108744634.1\|1066325_1066661_+	DUF2523 domain-containing protein	NA	NA	NA	NA
WP_108744635.1\|1066673_1067987_+	hypothetical protein	A0A077JGB2	Xanthomonas_phage	6.0e-19	26.4
WP_061009273.1\|1067986_1069171_+	hypothetical protein	A7BJX1	Enterobacteria_phage	6.5e-41	29.7
WP_061009274.1\|1069438_1069807_-	phage protein	Q9MCC4	Vibrio_phage	2.6e-41	66.4
WP_108744636.1\|1069766_1070018_-	hypothetical protein	Q9MCC3	Vibrio_phage	4.2e-14	60.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020034

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

559159 : 576339

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455581.1\|559159_560800_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4
WP_005455579.1\|560878_562180_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455577.1\|562589_562871_+	cell division protein FtsB	NA	NA	NA	NA
WP_005478544.1\|562872_563577_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	5.9e-05	23.6
WP_005380896.1\|563594_564071_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_021450029.1\|564117_565161_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005478553.1\|565160_565937_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.0e-66	52.4
WP_005455562.1\|565936_566563_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_021486791.1\|566577_567501_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005478537.1\|567581_568571_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_085577166.1\|568650_571212_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.2e-34	24.0
WP_005455551.1\|571296_571779_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.7e-27	48.7
WP_005478550.1\|571979_573023_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_005455548.1\|573146_573614_+	recombination regulator RecX	NA	NA	NA	NA
WP_005455546.1\|573756_576339_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9

DBSCAN-SWA_2

1913081 : 1922488

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005495404.1\|1913081_1913483_-	recombination protein NinG	A0A2I7S3K0	Vibrio_phage	3.7e-20	45.0
WP_025526418.1\|1913651_1914302_-	DUF1367 family protein	K7PKS6	Enterobacteria_phage	1.6e-20	32.8
WP_031855936.1\|1914294_1914675_-	hypothetical protein	NA	NA	NA	NA
WP_085576899.1\|1914671_1915625_-	helix-turn-helix domain-containing protein	A0A1V0E831	Vibrio_phage	2.9e-39	35.7
WP_005495414.1\|1915690_1915909_-	hypothetical protein	NA	NA	NA	NA
WP_025526421.1\|1915905_1916370_-	hypothetical protein	K7PJS5	Enterobacterial_phage	1.4e-18	48.8
WP_021486590.1\|1916389_1916611_-	helix-turn-helix transcriptional regulator	A0A1P8DTF8	Proteus_phage	2.8e-06	40.6
WP_024702645.1\|1916719_1917388_+	helix-turn-helix domain-containing protein	A0A1V0E8B5	Vibrio_phage	1.1e-66	57.1
WP_127463331.1\|1918098_1918278_+	hypothetical protein	NA	NA	NA	NA
WP_085576900.1\|1918290_1921455_+	hypothetical protein	I3PUZ3	Vibrio_phage	8.7e-24	33.6
WP_031855931.1\|1921447_1921975_+	siphovirus Gp157 family protein	NA	NA	NA	NA
WP_005495429.1\|1922299_1922488_+	hypothetical protein	F6LQB8	Bdellovibrio_phage	2.3e-09	54.7

DBSCAN-SWA_3

2650745 : 2657447

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005440184.1\|2650745_2651216_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3
WP_005496254.1\|2651385_2652495_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_005483039.1\|2652664_2653318_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_025625922.1\|2653330_2654455_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.0e-48	36.0
WP_005482986.1\|2654462_2654912_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_031855514.1\|2655039_2656290_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.8e-98	47.7
WP_005483011.1\|2656307_2657447_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP020037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2509 : 23108

Aeromonas_phage(48.0%)

portal,plate,capsid,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_108744660.1\|2509_4564_+\|terminase	phage terminase large subunit family protein	A2I2W6	Vibrio_virus	1.6e-114	39.3
WP_050505259.1\|4766_6326_+\|portal	phage portal protein	A0A067ZJA4	Vibrio_phage	5.5e-96	41.8
WP_158272261.1\|6353_7766_+	S49 family peptidase	A0A219YA27	Aeromonas_phage	2.6e-68	40.8
WP_031855855.1\|7768_8140_+	hypothetical protein	A0A0S4L3C3	Pseudomonas_phage	2.5e-15	44.3
WP_108744662.1\|8193_9126_+\|capsid	phage capsid protein	Q5ZQX7	Pseudomonas_phage	4.9e-76	49.0
WP_031855800.1\|9192_9564_+	hypothetical protein	NA	NA	NA	NA
WP_050505242.1\|9547_10165_+	hypothetical protein	A0A2I7R3I3	Vibrio_phage	1.1e-12	31.6
WP_031855802.1\|10151_10688_+	hypothetical protein	A0A219Y9U4	Aeromonas_phage	8.6e-25	38.8
WP_085609536.1\|10680_11331_+\|plate	phage baseplate assembly protein V	A0A219YA41	Aeromonas_phage	1.6e-36	40.9
WP_085609535.1\|11340_11538_+	hypothetical protein	R9TR72	Vibrio_phage	1.4e-12	63.1
WP_050505244.1\|11562_11910_+	hypothetical protein	A0A219Y9P2	Aeromonas_phage	1.1e-17	41.1
WP_108744663.1\|11902_12742_+\|plate	baseplate J/gp47 family protein	A0A219YAY1	Aeromonas_phage	9.6e-71	48.7
WP_108744664.1\|12738_13482_+\|tail	phage tail protein I	A0A219YA10	Aeromonas_phage	9.8e-35	47.1
WP_108744693.1\|13499_14003_+\|tail	phage tail protein	A2I2X8	Vibrio_virus	1.9e-29	46.7
WP_108744665.1\|14012_14378_+	hypothetical protein	Q6R4V8	Vibrio_virus	1.8e-18	43.4
WP_085609530.1\|14370_14682_+	hypothetical protein	Q6R4V9	Vibrio_virus	7.7e-10	39.1
WP_108744666.1\|14678_15032_+	hypothetical protein	NA	NA	NA	NA
WP_108744667.1\|15038_15800_+	hypothetical protein	B0ZSG5	Halomonas_phage	2.7e-08	33.1
WP_108744668.1\|15813_16119_+\|tail	phage tail assembly chaperone	M1TW54	Prochlorococcus_phage	5.1e-06	33.7
WP_158272262.1\|16228_17365_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A219Y8Y1	Aeromonas_phage	7.5e-111	56.8
WP_031855812.1\|17377_17890_+\|tail	phage major tail tube protein	A0A219YA39	Aeromonas_phage	2.7e-44	52.9
WP_085609525.1\|17954_18206_+\|tail	phage tail assembly protein	A0A219YBU5	Aeromonas_phage	4.2e-14	46.6
WP_139833970.1\|18220_18361_+\|tail	GpE family phage tail protein	A0A2H4ETI8	Aeromonas_phage	4.2e-08	55.8
WP_108744670.1\|18424_21367_+\|tail	phage tail tape measure protein	A0A2K9VGW0	Faecalibacterium_phage	4.0e-63	39.0
WP_050505250.1\|21421_21850_+\|tail	phage tail protein	A0A219YA28	Aeromonas_phage	7.9e-29	46.8
WP_031855817.1\|21849_22053_+\|tail	tail protein X	A0A0F7LCN2	Escherichia_phage	6.0e-11	50.7
WP_108744671.1\|22136_23108_+	hypothetical protein	A0A219Y8Z2	Aeromonas_phage	6.5e-63	40.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020035

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP020034

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP020037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection