CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP029603	Bradyrhizobium diazoefficiens strain XF7 chromosome, complete genome	1 crisprs	RT,DEDDh,csa3,WYL,PD-DExK	0	1	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP029603_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029603_1

6851748-6851824

Orphan

Consensus_repeat	Method
TGTCGTTGCCGGATCCGCCGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP029603_1

>merge|NZ_CP029603|1|6851748-6851824|CRISPRCasFinder
TGTCGTTGCCGGATCCGCCGTTGAGCACGTTGGCGATGGCGTTGCCGACGATGGTGTCGTTGCCGGATCCGCCGATG

>NZ_CP029603|1|1|6851748-6851824|CRISPRCasFinder
TGTCGTTGCCGGATCCGCCGTTG	AGCACGTTGGCGATGGCGTTGCCGACGATGG
TGTCGTTGCCGGATCCGCCGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029603.2\|WP_110116727.1\|6856360_6856696_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029603.2\|WP_110116721.1\|6846109_6847048_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133007
NZ_CP029603.2\|WP_110116719.1\|6842965_6844474_-\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|240533
NZ_CP029603.2\|WP_110116728.1\|6861913_6863434_-\|tripartite-tricarboxylate-transporter-permease	unknown	unknown	gnl\|CDD\|225870
NZ_CP029603.2\|WP_060908279.1\|6866509_6866884_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029603.2\|WP_110116730.1\|6866971_6867769_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|180424
NZ_CP029603.2\|WP_162603669.1\|6847072_6848404_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029603.2\|WP_162603667.1\|6842249_6842963_-\|FkbM-family-methyltransferase	unknown	unknown	gnl\|CDD\|273628
NZ_CP029603.2\|WP_110116725.1\|6852991_6853294_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029603.2\|WP_028173158.1\|6867810_6869010_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|178031
NZ_CP029603.2\|WP_162603668.1\|6844454_6845369_-\|FkbM-family-methyltransferase	unknown	unknown	gnl\|CDD\|273628
NZ_CP029603.2\|WP_162603671.1\|6853413_6854607_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP029603.2\|WP_110116716.1\|6838104_6838674_-\|acyltransferase	unknown	unknown	gnl\|CDD\|100053
NZ_CP029603.2\|WP_162603670.1\|6848411_6849236_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NZ_CP029603.2\|WP_171463853.1\|6840259_6842098_-\|asparagine-synthase-(glutamine-hydrolyzing)	unknown	unknown	gnl\|CDD\|273676
NZ_CP029603.2\|WP_110116715.1\|6837135_6838062_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212494
NZ_CP029603.2\|WP_110116731.1\|6869127_6870411_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP029603.2\|WP_162603672.1\|6864207_6865182_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_CP029603.2\|WP_028173161.1\|6863446_6863989_-\|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl\|CDD\|377815
NZ_CP029603.2\|WP_110116717.1\|6838670_6839609_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777

Protein	Function_ID	Function_description	E-value
NZ_CP029603.2\|WP_110116731.1\|6869127_6870411_-\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.1952e-97
NZ_CP029603.2\|WP_110116721.1\|6846109_6847048_+\|glycosyltransferase	gnl\|CDD\|133007	cd02514, GT13_GLCNAC-TI, GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13.	6.05828e-05
NZ_CP029603.2\|WP_110116719.1\|6842965_6844474_-\|oligosaccharide-flippase-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.65078e-17
NZ_CP029603.2\|WP_110116728.1\|6861913_6863434_-\|tripartite-tricarboxylate-transporter-permease	gnl\|CDD\|225870	COG3333, COG3333, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP029603.2\|WP_110116730.1\|6866971_6867769_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|180424	PRK06144, PRK06144, enoyl-CoA hydratase; Provisional.	1.24008e-156
NZ_CP029603.2\|WP_162603667.1\|6842249_6842963_-\|FkbM-family-methyltransferase	gnl\|CDD\|273628	TIGR01444, 2-O-methyltransferase_NoeI, methyltransferase, FkbM family. Members of this family are characterized by two well-conserved short regions separated by a variable in both sequence and length. The first of the two regions is found in a large number of proteins outside this subfamily, a number of which have been characterized as methyltransferases. One member of the present family, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548.	4.34503e-30
NZ_CP029603.2\|WP_028173158.1\|6867810_6869010_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|178031	PLN02409, PLN02409, serine--glyoxylate aminotransaminase.	2.84408e-141
NZ_CP029603.2\|WP_162603668.1\|6844454_6845369_-\|FkbM-family-methyltransferase	gnl\|CDD\|273628	TIGR01444, 2-O-methyltransferase_NoeI, methyltransferase, FkbM family. Members of this family are characterized by two well-conserved short regions separated by a variable in both sequence and length. The first of the two regions is found in a large number of proteins outside this subfamily, a number of which have been characterized as methyltransferases. One member of the present family, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548.	3.6284e-27
NZ_CP029603.2\|WP_162603671.1\|6853413_6854607_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	2.77501e-141
NZ_CP029603.2\|WP_110116716.1\|6838104_6838674_-\|acyltransferase	gnl\|CDD\|100053	cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.	5.45677e-34
NZ_CP029603.2\|WP_162603670.1\|6848411_6849236_+\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	7.81425e-87
NZ_CP029603.2\|WP_171463853.1\|6840259_6842098_-\|asparagine-synthase-(glutamine-hydrolyzing)	gnl\|CDD\|273676	TIGR01536, Asparagine_synthetase_1, asparagine synthase (glutamine-hydrolyzing). This model describes the glutamine-hydrolysing asparagine synthase. A poorly conserved C-terminal extension was removed from the model. Bacterial members of the family tend to have a long, poorly conserved insert lacking from archaeal and eukaryotic sequences. Multiple isozymes have been demonstrated, such as in Bacillus subtilis. Long-branch members of the phylogenetic tree (which typically were also second or third candidate members from their genomes) were removed from the seed alignment and score below trusted cutoff. [Amino acid biosynthesis, Aspartate family].	7.46614e-121
NZ_CP029603.2\|WP_110116715.1\|6837135_6838062_-\|SDR-family-oxidoreductase	gnl\|CDD\|212494	cd08946, SDR_e, extended (e) SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.69643e-51
NZ_CP029603.2\|WP_162603672.1\|6864207_6865182_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	2.6528e-79
NZ_CP029603.2\|WP_028173161.1\|6863446_6863989_-\|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl\|CDD\|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	1.66173e-08
NZ_CP029603.2\|WP_110116717.1\|6838670_6839609_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	8.82111e-06

>NZ_CP029603.2|WP_162603670.1|6848411_6849236_+|glycosyltransferase
MRNDQAFHGTTASFPTLSIVTPSFNQAPFLQQTLDSVLDQKYPGLEYIVIDGGSTDGSREILESYSDRLTFWVSEKDRGQVHALNKGFERATGDWVGWQNSDDFYLPGAFESFAVATRRFPDADIVLADIVLVDEAGTPIRDVRYVKPTYGSLFAEGMVLANQAAFWRRALHERVGFLDEQYNCSFDYDWFMRLLKSGRAVHVREHWGCLRYHGQSKTSVLTERFAKENMAIRGGRAPSGLSVAYSQLRRLALMLAHRDIGYVMRGLWRRAGRN
>NZ_CP029603.2|WP_162603669.1|6847072_6848404_+|hypothetical-protein
MSGVLLRSLSLTLLSLLPIASLVYFLSLQLLGINHESSYFTVWSVAVWFIPLALLLPNLIRRQVSITAIDVTFCLVSVLLAVHLKVFTLHAGLRDWALLVTFWVGPYAAARLVSAQDITRILKILGAIALTVSAAVFTWQFSLQLTAGDNLRPVMLGLNHGVLIVAVALGISVVIQVSDASAKYSLATYARPMIAALVTADLVVLGARGVVIADIATALLMVLAPTRDGRRGRIVVFAAILVGATLALILNHVARDFMVRTYLPLEPPAGAGVPDFGVPGLGVPGLGRDSRAECDQLNKMVDSTPIRIWLLQQGFLLFQETPVFGIGLENFAAHTCPGSFPHSTILQAFVEMGAVGGIAYALLLATAIFSLIGLTINRLPCKSRPVIVVLALLSFFIILDQFYGRILLSSTASLLLGFSASLVTRSEHPHLRGRPIPNSENSR
>NZ_CP029603.2|WP_110116721.1|6846109_6847048_+|glycosyltransferase
MAAPIALFVFRRPDKTRATLASLARCRGIENIDLYIFCDGPRDTRDEQAVADVRAIVEAFDHPRKTLVISTENQGLARSIIAGVTRLCEQYGRVIVVEDDLTVSPAFLDYMNTGLDTFAGDPRVMQISGFAFARSNASPNSTARFLPITTSWGWATWERSWHDFDPDARDTDALRSNYALRSRFDLGGLFGYYDMLQRQEAGRIDSWAIRWYWSVFRRDGLVLYPPISLVRNDGLDSSGTHTSRSKLLWRGLNHELPESSPPMPDQVAINQASLAELASIVDPLFYRRARNLLRGLLFRVNLMMQTSMRGPR
>NZ_CP029603.2|WP_162603668.1|6844454_6845369_-|FkbM-family-methyltransferase
MSRSLSGELAEAFEAAVARRNASRIQRLVADPLRAVTPAFLRRLGRVKEVPAQTFWGETMRVVVPEPVSAMIYRFGYYDENVCRFLLAALHEGNTFVDIGAHFGFFSKLAVRLIGGSGHVVAFEPMPRTRSLLSANLSGSIGAGCASVVEYAAFDEEKTLEFRDYGDAHSSFNSAFVGRGLERTGIPVDVRARRFDDIWNELGHQRIDVMKIDAESAELRVLIGAEQSLAKYKPVVIAEFGDFDLPNVPASRSIVEWLLPRGYVAFEASRSGPRPHQTQVRYGYTNLMFVPRDKLGLIDARDSH
>NZ_CP029603.2|WP_110116719.1|6842965_6844474_-|oligosaccharide-flippase-family-protein
MRATVTRQAIASLADVAIQGVALAFLYGYLLRALGSDQVGLWAVVFSIAAIGRGADLGLSRGLIRYLPLQTDDPRRSPDLVDSAVVGTLVLLAPLGLVSAAALWFLIPLSVQGSLHEARALVPWALVLLAVMTMGQVYLNALTAVFRTDQRSYANITATLVMLSATVSLVPVYGLLGVASAQIIQHVVSIAVSALHLKRSLPGFRFVPRRAGRKDMRLLFAYGLKLHVAGLAMLVFEPATRIILARVETLDAVAYYDMASRLLQQARNLIVMANQVMSPYFARLSALSRVELLAAYRSALSMTLFFSLPTMAFLVVSAPLIAILWIGKSNDSFVVFVAVLSVGWTINILSAPSYFLATAAGYLSPVIVSHLLISVGSSVLAYAFSLLAGERGVVVGVTSGLVVGSVWCMRMVHAKNLGGSEHLWRPSDLRFAILCVVAPIASLTFYFAMRASLGTSTSALAGLAGGTLVIGLAVLTNPSTRLIRDSLLPSLKRHGGTKAVDI
>NZ_CP029603.2|WP_162603667.1|6842249_6842963_-|FkbM-family-methyltransferase
MKHLATAFLAKFDLHIERLSKHPKETLLGISGENVRNVLDIGANTGQFARVALNRFPRAKIWCFEPLPAAYKLLKCMEQDSDDRMTALNFALGARPGVVNMHFHSEHSPSSSLMPTTGMCEELFPQTRAQTNFPVEVRTLDGVCAEFPTPPLEDLVIKIDVQGYEAEVIAGGRKTIAAAKAVIVEISFDELYKGAPTFEDLSKLLGETGHRFAGAIEQFTAGDGHVIFMDALFKKLG
>NZ_CP029603.2|WP_171463853.1|6840259_6842098_-|asparagine-synthase-(glutamine-hydrolyzing)
MCGIAGIVDFRGNAIEQEAISRLTNLLAHRGPNGAGTWFSADRDVAMGHRRLAVIDPGEGGYQPMLSADRRHVIVFNGEIYNFLELRRELEERGAIFRTQSDTEVILAAWREWREGMLSRFNGMWALAIYDTETRELFLARDRFGIKPLLYAMSPERFVFASEQRALVRSGLIGTSLDVDVARRLLLDAFGVEGSERTLCQDARRLQSGHCLWLRHGQLEIRRWWRTIDHLPEVPKTEAERVERFRELFQDAVALRMRSDVPIGTCLSGGFDSSAVICTMASHEKAGMGPRDSTSWRHAFVATFPGASNDERPMAEEAAAWAEVNPTYLEIGRADALTELDQILDDNDDVYIGLPSAIWLIYRELRRQNVPVSIDGHGADELMGGYFQGGQYGAFWIRNALAGISSNSALTRRGVDLLRALMIKRQGQYFLRGGLRQVPGQLSLVGDDDVLPRDWGSFNRRLYRMFHGTVLPTILRNYDRLSMAHGIEVRMPFMDWRLVTYTMALPESSKSSSGLTKVIARRAMENQMPESIRMGRRKVGFNSPMPEWLNGPLAGWTASLLDQNVPAFAELVDEPALRRAVGRLTTSKAWDWESVGRVWPYLNMKWMLARRT
>NZ_CP029603.2|WP_110116717.1|6838670_6839609_-|methyltransferase-domain-containing-protein
MMLFKQAGDNYRERAPHAPLGHRRTGDQRMHVDGALFKAKELLDATLLPVHALRGCPPWSLGYYTRKKRAIVDAIDQNVVRPNAPLPAGFGIGLDERVVEYPWLFSCLRASGQLGKVLDAGSTLNHEYILSRDPLDKADLTLMTLAPEKRCYWHMGYSYVFGDFRKSPFQDALFDTLISISTLEHVGLDNTLLYTNDRSKAESDQFGFSAAMSEFRRIVRPGGRCFVTVPYGQYEDFGWFQLFDAQMLERLINSFGPSTHQVEFFSYRRQGWERATQATVESATAFDPHSGRGRTEDKAGCARAIACIQMTR
>NZ_CP029603.2|WP_110116716.1|6838104_6838674_-|acyltransferase
MNLDLLLQRLLGRPTCELAAGARLLRTARIRNIRRDAKSIRIGEHSIIRGELLTFAHGGRIEIGSWCYVGEGARIWSGCSISLGDRVLIAHGANLFDNLTHPINHHDRHKQIREIFTKGHPAEIDLDDRPIAIGDDTWVGAGAYILRGVQIGARAVIGAGAVVTKDVAADTIVAGNPAVMVGRVDESYV
>NZ_CP029603.2|WP_110116715.1|6837135_6838062_-|SDR-family-oxidoreductase
MSVWVTGGNGFIGRHLIAHLAREGERVYGIGHGAIDETDRRKLGLSDWINGEISAPNLDGLVERGGAPGAIFHLAGGSSVARSIEQPYEDFSRTVGATASLLEWLRYSARECRLVVASSAAVYGAHHACAISEQASTQPMSPYGHHKLIMEQLCRSYADSFGIRVTIVRLFSVYGPSLRKQLLWDLCVRLGQGQRELMLGGTGNETRDWIDVRDVVRLLARLQHGDSTPLKVLNGGSGIPTSVAEIAQIVTNAWGGNIAVRFSGIVRAGDPFSLVADAGQLAVLPFNWRIPVHDGIAQYVSWFKGQSH
>NZ_CP029603.2|WP_110116725.1|6852991_6853294_+|hypothetical-protein
MKRHSLPAGLFGALIALAGLPLQPLGGLPVMVEKAKADDNGKAGRAPSMPMARDPAVAVAEEYEAARRKGTREALELFIARHGDDPLAEQARAGLKRLPR
>NZ_CP029603.2|WP_162603671.1|6853413_6854607_+|CoA-transferase
MPFPHASEALSRFTVLDLTRVRSGPTCVRQLADWGANVIKIDALTEDAGGEQPGGPRRGSDFQNLHRNKRAMTLNLKDERGLAVFKRLAVKADVVVENFRPDVKKKLGIDYDSLAKINPRIVYGSISGFGQDGPYHKRPGFDQIAQGMGGLMSITGAPGEGPMRVGIPVADLTAGLFCAMGILTALLEREVSGKGQWVQTSLLQAQIFMLDFQAARWLMEKEVAKQAGNNHPTSIPTGVFKTSDGYINIATTGGRIWERCAQAISAPELYAHPDYATAPARSKNRDALNAEIEKRTVTKSTETWVRELNEAGVPCGPIYAIDQMFDDAQVKHLGIAQDVPNEEGRHIRLVGQPVTLSRTPSRMVARPPEFGEQTDEVLKEFGFESYEIASLREAGIV
>NZ_CP029603.2|WP_110116727.1|6856360_6856696_+|hypothetical-protein
MQNLEPFIGEALVVLANQIEFRTDQGVKAVRYAANFLPEVCAVFARAQRAGVLKVAQRNIAHRAGIIAEHLQRSGTTSLIDEATGYREISRAVDAPGGYGRGEYIQARPQS
>NZ_CP029603.2|WP_110116728.1|6861913_6863434_-|tripartite-tricarboxylate-transporter-permease
MEALGLLLHGFAVLLTWKTLVLMMVGLVLGIFVGVLPGLGGPNGVAILLPLTFTMDPTSAIVMLSCIYWGALFGGAITSILFNIPGEAWSVATTFDGYPMAQQGRAAEALTAAFTSSFIGSLVAVLLITFLAPMISSFALKFGPPEFFAVYLLTFGSFVGLGREAKHKTVISMSLGLLLAGIGMDTVSGNLRMTFGSAELLRGINFLVAVIGLFGISEILLTMEERLALRGHAASISLRVVLGVWKDLPKYWVTLLRSSFIGCWLGITPGGAIAASFMGYNLAKRFSKDPESFGKGRIEGVFAPETAAHASGTAALLPMLALGIPGSGTAAILLGGLMVWGLNPGPLLFVEHKDFVWGLIASMYLGNVVGLVLVLTTVPIFASILRVPFAAVAPMIVVSCAIGAYAIQNAMFDIWLMLGFGVVGYVFKKIGIPLAPFTLALVLGNRAEDAFRLSMIGSGGTLKVFWSNGLVGSITTLAIVLLFWPVIDGLLGRVGWRQRDKSAIKD
>NZ_CP029603.2|WP_028173161.1|6863446_6863989_-|tripartite-tricarboxylate-transporter-TctB-family-protein
MSQTDIEIVVDDPTAPEEDSPSIVSSGTIEILVCLLLLALAITLGYDNWRTGASWDATGPEPGYFPFYLSVILGGGSLYGLIAALVARRAASGSFVTRAQARRVMAVFVPTLLFCLVTQFLGLYVASFLLIAAFMRLVGKIALWKSLLTAFLFTAIMFVTFDIAFDVIMPKGPLEAAFGH
>NZ_CP029603.2|WP_162603672.1|6864207_6865182_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKATIVLAAALCGTPAFAGWEPTKPVEIVVAAGAGGASDQMARMMQAAIQKNNLMKQPMVVSLKGGASGAEALMYMKSSEGDPNKVLIAYSLIYMLPLSAKIPFNWRELTPVSVIALDQFVLWDNSAGPKTVKEFVEAAKAASSPFKMGGTGSKREDHVLTVFLEQKTGAKFSYLPYKSGGEAATQLVGNHTEANVNNPSENLEVWRAGQVRPLCVFDKERISYTSKVTDTQSWADIPTCKEEGVDVQYLMLRAMFLPGKVTAEQQAFYVELFHKVTQTAEYKDYMEKQALKPIFLTGKDMVQFLEEDDAINKALMTEAGFVAK
>NZ_CP029603.2|WP_060908279.1|6866509_6866884_+|hypothetical-protein
MITYSGFMMGLGRLSKGRQHHRGGVKLPSLLTLQNLEPFIGEDFAVIAKQIEFRTKQGAKAFGYSANLLPEVCDVFARAQRAGVLNATQRYIADRVRIISEQLQGSGTIRLIDKATGYQKVREK
>NZ_CP029603.2|WP_110116730.1|6866971_6867769_-|enoyl-CoA-hydratase/isomerase-family-protein
MNAPTTTNEDLLYSVQDGIARITFNRPQARNAMTFAMYDRMAEICLEINADRSIKALILTGAGDKAFASGTDISQFRAFETAQDALDYEARIDRVLGTLEQCRVPVIAAIAGACTGGGAGIAACCDLRIGTETTRMGFPIARTLGNCLSMSNISRVVALVGPARTKDLIFKARLVEAPEALALGLLNEVVPDVETLQRRADETAKLVASHAPLTLEATKEAVRRIRRTLSREEGEDLILKAYMSEDFREGMDAFLNKRTPVWKGK
>NZ_CP029603.2|WP_028173158.1|6867810_6869010_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MTVHTGRHFLQIPGPTNVPDRVLRAMDMPTLDHRGPEFAELGFGVLAAMQRVFRTKQPVIIFPSSGTGAWEAAMVNVFSPGDKVLMCETGQFAVLWRGIADKFKLDVDFIPSDWRHGADLAEIEQRLAADKQHTIKAVCVVHNETSTGCVTPPLEVRKLLDRVKHPALLMVDTISGLGSMEYEHDAWGIDVSVAGSQKGLMLPPGLGFNAVSEKALAVAKANPGMRSYWDWQEVISFNKLGTFPYTPATNLLYGLREAVKMLEEEGLENVWTRHKRHSAATRAAVKVWGLETQCADPAAHSPALTGVRVPDGHDADAFRKVVLENFDMSLGTGLNKVKGKVFRIGHIGHFNDLMLMGTLAGVEMGLDLAKIPHRSGGVLAAMDVLKGRDVVPMAKAQVA
>NZ_CP029603.2|WP_110116731.1|6869127_6870411_-|MFS-transporter
MGVRFKATHVVLAMLCAMYFITYVDRVNIGTAAGEIQKELGLSNTQLGLVFSAFAYPYLLFQVIGGWVGDHFGPRKTLFWCGMIWAAATIMTGFVNGLAALFVARFALGFGEGATFPTATRAMQYWTPANRRGFAQGLTHSFARLGNAVTPPVVALLILWLTWRGAFVVLGFVSLIWGVIWVWYFRNEPKEHASITEAELAALPPRPTGERPRVPWGPLLGRMWPVTLTYFCYGWCLWLYLNWLPLFFKNNYSLDIKNSALFASGVFFAGVVGDSVGGVLSDKILDRTGNVRLARLSVTVAGFTGALLLLFPILFVHDITIVALCLSAGFFCAELVIGPMWSIPMDIAPKYSGTAAGIMNTGSAFAAIVSPLVAGFVIDVTGNWYLPFLMSMGLLLLGGFSAFLMHPERPFAEAEGRLPSGRVVAAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	594957-594987	5	0.839
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	204221-204251	5	0.839
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP017423	Arthrobacter sp. ZXY-2 plasmid pZXY22, complete sequence	21198-21228	5	0.839
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	77544-77574	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	465442-465472	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	492532-492562	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP040453	Halomonas sp. PA16-9 plasmid p_unnamed2, complete sequence	75385-75415	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP029211	Aquabacterium olei strain NBRC 110486 plasmid pTB101, complete sequence	330951-330981	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1858196-1858226	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	20416-20446	6	0.806
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	241899-241929	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	212103-212133	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	380184-380214	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	493438-493468	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	840795-840825	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	281048-281078	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_017791	Deinococcus gobiensis I-0 plasmid P2, complete sequence	331051-331081	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_014563	Pantoea vagans C9-1 plasmid pPag2, complete sequence	133196-133226	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	MN586025	Mycobacterium phage Mdavu, complete genome	21513-21543	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KT281789	Mycobacterium phage Enkosi, complete genome	21525-21555	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	MH020245	Mycobacterium phage SgtBeansprout, complete genome	21525-21555	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KX808132	Mycobacterium phage Amelie, complete genome	21525-21555	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	MH399770	Mycobacterium phage Biglebops, complete genome	21525-21555	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	MF919518	Mycobacterium phage LilPharaoh, complete genome	21525-21555	7	0.774
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1308526-1308556	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1364606-1364636	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1230261-1230291	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1293611-1293641	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1229358-1229388	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	299078-299108	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1271936-1271966	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1271927-1271957	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1230253-1230283	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1229608-1229638	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1230244-1230274	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1308664-1308694	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1308647-1308677	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1308635-1308665	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP010955	Sphingobium sp. YBL2 plasmid 1pYBL2-1, complete sequence	15104-15134	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	424010-424040	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	701168-701198	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1632269-1632299	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	214416-214446	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	180993-181023	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1598702-1598732	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	124616-124646	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	532956-532986	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	14684-14714	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1238594-1238624	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP018224	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL3, complete sequence	11455-11485	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP041019	Sphingobium fuliginis ATCC 27551 plasmid pSF2, complete sequence	39568-39598	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	893780-893810	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1978897-1978927	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP047221	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed2, complete sequence	31345-31375	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	809446-809476	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	707920-707950	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	60283-60313	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	242471-242501	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_014159	Tsukamurella paurometabola DSM 20162 plasmid pTpau01, complete sequence	8275-8305	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	248167-248197	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	MN552147	Leuconostoc phage P974, complete genome	25943-25973	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KX578044	Leuconostoc phage CHA, complete genome	26154-26184	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KC013028	Leuconostoc phage phiLNTR2, complete genome	26337-26367	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KX578043	Leuconostoc phage CHB, complete genome	26277-26307	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KC013027	Leuconostoc phage phiLN34, complete genome	26024-26054	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	KC013029	Leuconostoc phage phiLNTR3, complete genome	26016-26046	8	0.742
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	519113-519143	9	0.71
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP023550	Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence	150654-150684	9	0.71
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1710723-1710753	9	0.71
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	33579-33609	9	0.71
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	232871-232901	9	0.71
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	191733-191763	9	0.71
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1324673-1324703	10	0.677
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	46581-46611	10	0.677
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP044217	Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence	257609-257639	10	0.677
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	276580-276610	10	0.677
NZ_CP029603_1	1.1\|6851771\|31\|NZ_CP029603\|CRISPRCasFinder	6851771-6851801	31	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	184845-184875	10	0.677

1. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.839

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
agctcgttggcgatggcgttgccgatcgcgg	Protospacer
*** *********************. ..**

2. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 5, identity: 0.839

agcacgttggcgatggcgttgccg-acgatgg	CRISPR spacer
agcacgctggcgatggcggtgccgcacggcg-	Protospacer
******.*********** ***** ***..*

3. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP017423 (Arthrobacter sp. ZXY-2 plasmid pZXY22, complete sequence) position: , mismatch: 5, identity: 0.839

---agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcaagcac---ggcgatggtgttgcggacgatgg	Protospacer
   *****   ********.***** ********

4. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcgtaga	Protospacer
 ***** *****************.**  *.

5. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcgtaga	Protospacer
 ***** *****************.**  *.

6. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aggatgagggcgatggcggcgccgacgatgg	Protospacer
** *.*  ********** .***********

7. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP040453 (Halomonas sp. PA16-9 plasmid p_unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcgtaga	Protospacer
 ***** *****************.**  *.

8. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP029211 (Aquabacterium olei strain NBRC 110486 plasmid pTB101, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcgtaga	Protospacer
 ***** *****************.**  *.

9. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgtt----ggcgatggcgttgccgacgatgg	CRISPR spacer
----ccttccggggcgatggcgatgccgacgatgg	Protospacer
    * **    ********** ************

10. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 6, identity: 0.806

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
agggcgtaggcgatggcgttgccgaggaacg	Protospacer
** .*** ***************** **  *

11. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ggtgtgtgggcgatggcgttgccgacgaggt	Protospacer
.*...** ******************** *

12. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcataga	Protospacer
 ***** *****************.*.  *.

13. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcataga	Protospacer
 ***** *****************.*.  *.

14. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatggcgttgccggcataga	Protospacer
 ***** *****************.*.  *.

15. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgtt----ggcgatggcgttgccgacgatgg	CRISPR spacer
----ccttccggtgcgatggcgatgccgacgatgg	Protospacer
    * **     ********* ************

16. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
atcggcttggcgaaggcgtcgccgacgatcg	Protospacer
* *.  ******* *****.********* *

17. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_017791 (Deinococcus gobiensis I-0 plasmid P2, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgtt---ggcgatggcgttgccgacgatgg	CRISPR spacer
---tcgtcccaggcggcggcgttgccgacgatgg	Protospacer
    ***.   ****..*****************

18. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_014563 (Pantoea vagans C9-1 plasmid pPag2, complete sequence) position: , mismatch: 7, identity: 0.774

agcacgtt---ggcgatggcgttgccgacgatgg	CRISPR spacer
---ccgctgggggcgatagcgttgccgacaatgg	Protospacer
    **.*   ******.***********.****

19. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to MN586025 (Mycobacterium phage Mdavu, complete genome) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aacacgttggcgatgccgtcgccgagttcgg	Protospacer
*.************* ***.*****   .**

20. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KT281789 (Mycobacterium phage Enkosi, complete genome) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aacacgttggcgatgccgtcgccgagttcgg	Protospacer
*.************* ***.*****   .**

21. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to MH020245 (Mycobacterium phage SgtBeansprout, complete genome) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aacacgttggcgatgccgtcgccgagttcgg	Protospacer
*.************* ***.*****   .**

22. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KX808132 (Mycobacterium phage Amelie, complete genome) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aacacgttggcgatgccgtcgccgagttcgg	Protospacer
*.************* ***.*****   .**

23. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to MH399770 (Mycobacterium phage Biglebops, complete genome) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aacacgttggcgatgccgtcgccgagttcgg	Protospacer
*.************* ***.*****   .**

24. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to MF919518 (Mycobacterium phage LilPharaoh, complete genome) position: , mismatch: 7, identity: 0.774

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
aacacgttggcgatgccgtcgccgagttcgg	Protospacer
*.************* ***.*****   .**

25. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

26. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

27. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

28. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

29. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

30. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
agcacgtcggcgatggcattgccggcctcct	Protospacer
*******.*********.******.*  .

31. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

32. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

33. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

34. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

35. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

36. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

37. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

38. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcggtattggcgatgccgttgccggcgatgg	Protospacer
   ...********* ********.******

39. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP010955 (Sphingobium sp. YBL2 plasmid 1pYBL2-1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcatgttgacgatggcgttgccgatttcgt	Protospacer
 ***.****.***************.  .*

40. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccctccggcgcgatggcgatgccgacgatgg	Protospacer
  * *    ********* ************

41. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccctccggcgcgatggcgatgccgacgatgg	Protospacer
  * *    ********* ************

42. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ttggcgttgtcgaaggcgttgccgacgaaga	Protospacer
   .***** *** ************** *.

43. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ggggtgtgggcgacggcgttgccgacgaggt	Protospacer
.* ..** *****.************** *

44. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ttggcgttgtcgaaggcgttgccgacgaaga	Protospacer
   .***** *** ************** *.

45. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ggggtgtgggcgacggcgttgccgacgaggt	Protospacer
.* ..** *****.************** *

46. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

------agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccttccggc------gcgatggcgatgccgacgatgg	Protospacer
      .**      ********* ************

47. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.742

------agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccttccggc------gcgatggcgatgccgacgatgg	Protospacer
      .**      ********* ************

48. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
agcacggtggcgatggcgttgcgcacttcca	Protospacer
****** ***************  **  . .

49. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccctccggcgcgatggcgatgccgacgatgg	Protospacer
  * *    ********* ************

50. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP018224 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL3, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcatgttgacgatggcgttgccgatttcgt	Protospacer
 ***.****.***************.  .*

51. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP041019 (Sphingobium fuliginis ATCC 27551 plasmid pSF2, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcatgttgacgatggcgttgccgatttcgt	Protospacer
 ***.****.***************.  .*

52. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccctccggcgcgatggcgatgccgacgatgg	Protospacer
  * *    ********* ************

53. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
cgcacgtcgtcgatggcgttgccgtagcgcg	Protospacer
 ******.* **************  *   *

54. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP047221 (Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcatgttgacgatggcgttgccgatttcgt	Protospacer
 ***.****.***************.  .*

55. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.742

------agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccttccggc------gcgatggcgatgccgacgatgg	Protospacer
      .**      ********* ************

56. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
acggcgttggcgatggcggcgccgacgccgc	Protospacer
*  .************** .******* .*

57. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcacggtggcgatcgcgttgccggcataga	Protospacer
 ***** ******* *********.*.  *.

58. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
atgacgtcggcgatggcgatgccgactttct	Protospacer
*  ****.********** *******  *

59. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_014159 (Tsukamurella paurometabola DSM 20162 plasmid pTpau01, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ctggcgcaggcgatcgcgttggcgacgatgg	Protospacer
   .**. ****** ****** *********

60. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ggggtgtgggcgacggcgttgccgacgaggt	Protospacer
.* ..** *****.************** *

61. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to MN552147 (Leuconostoc phage P974, complete genome) position: , mismatch: 8, identity: 0.742

agcac-gttggcgatggcgttgccgacgatgg	CRISPR spacer
-gtgcagttggagatggcgttgccgatgacac	Protospacer
 *..* ***** **************.**..

62. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KX578044 (Leuconostoc phage CHA, complete genome) position: , mismatch: 8, identity: 0.742

agcac-gttggcgatggcgttgccgacgatgg	CRISPR spacer
-gtgcagttggagatggcgttgccgatgacac	Protospacer
 *..* ***** **************.**..

63. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KC013028 (Leuconostoc phage phiLNTR2, complete genome) position: , mismatch: 8, identity: 0.742

agcac-gttggcgatggcgttgccgacgatgg	CRISPR spacer
-gtgcagttggagatggcgttgccgatgacac	Protospacer
 *..* ***** **************.**..

64. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KX578043 (Leuconostoc phage CHB, complete genome) position: , mismatch: 8, identity: 0.742

agcac-gttggcgatggcgttgccgacgatgg	CRISPR spacer
-gtgcagttggagatggcgttgccgatgacac	Protospacer
 *..* ***** **************.**..

65. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KC013027 (Leuconostoc phage phiLN34, complete genome) position: , mismatch: 8, identity: 0.742

agcac-gttggcgatggcgttgccgacgatgg	CRISPR spacer
-gtgcagttggagatggcgttgccgatgacac	Protospacer
 *..* ***** **************.**..

66. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to KC013029 (Leuconostoc phage phiLNTR3, complete genome) position: , mismatch: 8, identity: 0.742

agcac-gttggcgatggcgttgccgacgatgg	CRISPR spacer
-gtgcagttggagatggcgttgccgatgacac	Protospacer
 *..* ***** **************.**..

67. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 9, identity: 0.71

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
gtgacgttggcgatggcgttctcgacccggt	Protospacer
.  ***************** .****   *

68. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP023550 (Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccgccgttggcgttggcgttgtcgacgctct	Protospacer
    ******** ********.***** *

69. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.71

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcgctgctggcgatggggttgccgacggtgc	Protospacer
    .*.********* **********.**

70. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 9, identity: 0.71

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tgcaggttggcgatgccgttgccgcgcagcc	Protospacer
 *** ********** ********   *

71. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 9, identity: 0.71

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tatccagcggcgatggcgatgccgatgatgg	Protospacer
 .. *. .********** ******.*****

72. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 9, identity: 0.71

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ttcacgttggcgatggcgtggtcgagagcgt	Protospacer
  ***************** *.*** ...*

73. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 10, identity: 0.677

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ttcacgttggcgatggcgtggtcgagcgcat	Protospacer
  ***************** *.***  ...

74. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 10, identity: 0.677

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
cctggcttggcgaaggggttgccgacgatat	Protospacer
  ..  ******* ** ************.

75. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP044217 (Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
tcaacctcggcgatggcgttgccgacacgct	Protospacer
   ** *.******************.

76. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 10, identity: 0.677

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
gtcacattggcgatggcgtggccgatcggca	Protospacer
. ***.************* *****. .  .

77. spacer 1.1|6851771|31|NZ_CP029603|CRISPRCasFinder matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 10, identity: 0.677

agcacgttggcgatggcgttgccgacgatgg	CRISPR spacer
ccggtactggcgatgcccttgccgacgatgt	Protospacer
   ....******** * ************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1585630 : 1592720

Salmonella_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011084134.1\|1585630_1586095_+	ribonuclease HI	J9Q745	Salmonella_phage	8.5e-45	58.3
WP_011084135.1\|1586214_1586700_-	peroxiredoxin	M1I839	Pelagibacter_phage	6.8e-21	45.8
WP_011084136.1\|1586808_1587363_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.7e-15	31.8
WP_011084137.1\|1587378_1589064_-	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	6.9e-44	26.9
WP_011084138.1\|1589257_1590721_-	penicillin-binding protein	B6DZZ7	Stx2-converting_phage	3.0e-27	35.1
WP_011084139.1\|1590911_1592720_-	glucan ABC transporter ATP-binding protein/ permease	W8CYL7	Bacillus_phage	3.8e-32	25.0

DBSCAN-SWA_2

1841740 : 1900171

Bacillus_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038971398.1\|1841740_1842775_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_131233107.1\|1843245_1843449_-	hypothetical protein	NA	NA	NA	NA
WP_038971399.1\|1843920_1844154_+	hypothetical protein	NA	NA	NA	NA
WP_154694120.1\|1844363_1844522_+	hypothetical protein	NA	NA	NA	NA
WP_028142010.1\|1844586_1844886_+	hypothetical protein	NA	NA	NA	NA
WP_074077659.1\|1845580_1845760_-	hypothetical protein	NA	NA	NA	NA
WP_011084366.1\|1847392_1847554_+	Flp family type IVb pilin	NA	NA	NA	NA
WP_110115943.1\|1847623_1848688_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_162603489.1\|1848852_1851792_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.4e-12	35.2
WP_028142008.1\|1852156_1853179_+	c-type cytochrome	NA	NA	NA	NA
WP_154694119.1\|1853211_1853373_-	hypothetical protein	NA	NA	NA	NA
WP_050995610.1\|1853686_1854679_+	hypothetical protein	NA	NA	NA	NA
WP_011084371.1\|1854683_1855043_-	methylamine utilization protein	NA	NA	NA	NA
WP_028142006.1\|1855706_1856543_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_110115943.1\|1857314_1858379_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_085971921.1\|1858535_1859295_+\|transposase	IS5-like element ISBj2 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.6e-08	35.5
WP_053815125.1\|1859542_1859935_-	hypothetical protein	NA	NA	NA	NA
WP_028144252.1\|1860242_1860626_-	hypothetical protein	NA	NA	NA	NA
WP_014498117.1\|1860948_1861143_-	hypothetical protein	NA	NA	NA	NA
WP_080670268.1\|1861934_1863140_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_154694118.1\|1863924_1864098_+	hypothetical protein	NA	NA	NA	NA
WP_038936786.1\|1865534_1865807_+	hypothetical protein	NA	NA	NA	NA
WP_080670263.1\|1866302_1866470_+	DUF3551 domain-containing protein	NA	NA	NA	NA
WP_038973697.1\|1869148_1870483_+	NtaA/DmoA family FMN-dependent monooxygenase	NA	NA	NA	NA
WP_110115945.1\|1870515_1872204_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_110115946.1\|1872200_1873163_+	ABC transporter permease	NA	NA	NA	NA
WP_028144229.1\|1873159_1874041_+	ABC transporter permease	NA	NA	NA	NA
WP_014498066.1\|1874037_1875765_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-15	28.7
WP_014498065.1\|1876053_1876236_+	hypothetical protein	NA	NA	NA	NA
WP_011084760.1\|1877920_1878250_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_110115947.1\|1878390_1880004_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	9.5e-67	32.5
WP_080704061.1\|1880072_1880669_+	hypothetical protein	NA	NA	NA	NA
WP_071916625.1\|1882565_1882871_+	hypothetical protein	NA	NA	NA	NA
WP_028144227.1\|1883518_1884304_+	hypothetical protein	NA	NA	NA	NA
WP_014498063.1\|1886273_1887236_+	DUF1738 domain-containing protein	A0A1B1IWW8	uncultured_Mediterranean_phage	1.2e-37	35.0
WP_049801967.1\|1887341_1889495_+	ParB N-terminal domain-containing protein	G8DH78	Emiliania_huxleyi_virus	1.2e-29	32.5
WP_080704062.1\|1889642_1890983_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_028144224.1\|1892023_1892707_+	conjugal transfer protein TrbF	NA	NA	NA	NA
WP_038936969.1\|1892703_1893738_+	P-type conjugative transfer protein TrbG	NA	NA	NA	NA
WP_011084435.1\|1893734_1894937_+	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_011084436.1\|1894942_1895179_+	DUF2274 domain-containing protein	NA	NA	NA	NA
WP_162131539.1\|1895291_1895486_-	hypothetical protein	NA	NA	NA	NA
WP_039155691.1\|1898902_1900171_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	1.6e-93	46.2

DBSCAN-SWA_3

1914088 : 2001663

Bradyrhizobium_phage(14.29%)

transposase,integrase

attL 1897222:1897240|attR 1917260:1917278

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1897222:1897240	attL	NA	NA	NA	NA
WP_011084450.1\|1914088_1914499_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9SGU9	Bradyrhizobium_phage	1.1e-06	36.6
WP_011084451.1\|1914516_1914834_-	hypothetical protein	NA	NA	NA	NA
WP_071917746.1\|1915398_1915587_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2L1IV28	Escherichia_phage	4.5e-05	35.0
WP_038937322.1\|1916533_1916749_+	hypothetical protein	NA	NA	NA	NA
WP_014498044.1\|1918406_1918895_+	hypothetical protein	NA	NA	NA	NA
1917260:1917278	attR	NA	NA	NA	NA
WP_014498004.1\|1922542_1922884_+	type II toxin-antitoxin system PrlF family antitoxin	NA	NA	NA	NA
WP_011084500.1\|1922880_1923384_+	type II toxin-antitoxin system YhaV family toxin	NA	NA	NA	NA
WP_038937402.1\|1924131_1925487_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_014498007.1\|1925812_1926001_-	hypothetical protein	NA	NA	NA	NA
WP_011084497.1\|1926936_1927251_+	hypothetical protein	NA	NA	NA	NA
WP_011084496.1\|1927247_1927538_-	DUF2274 domain-containing protein	NA	NA	NA	NA
WP_085965515.1\|1928010_1928770_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	2.1e-08	35.5
WP_018273862.1\|1928897_1930247_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_014498011.1\|1930386_1931049_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_095426901.1\|1932219_1934082_-	hypothetical protein	NA	NA	NA	NA
WP_080586833.1\|1936741_1936951_-	hypothetical protein	NA	NA	NA	NA
WP_028160640.1\|1937506_1938007_-	hypothetical protein	NA	NA	NA	NA
WP_014498022.1\|1940597_1941362_-	TatD family hydrolase	NA	NA	NA	NA
WP_014498023.1\|1941358_1942633_-	hypothetical protein	NA	NA	NA	NA
WP_014498024.1\|1942629_1943511_-	hypothetical protein	NA	NA	NA	NA
WP_028160578.1\|1943491_1945372_-	ATPase	NA	NA	NA	NA
WP_014498028.1\|1947383_1948589_-	hypothetical protein	NA	NA	NA	NA
WP_080588800.1\|1948585_1950310_-	hypothetical protein	NA	NA	NA	NA
WP_014498031.1\|1951594_1952041_+	hypothetical protein	NA	NA	NA	NA
WP_039156367.1\|1952442_1953195_-	hypothetical protein	NA	NA	NA	NA
WP_011084471.1\|1954797_1955604_-	hypothetical protein	NA	NA	NA	NA
WP_161170739.1\|1955892_1956624_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_162473611.1\|1956683_1957100_+	hypothetical protein	NA	NA	NA	NA
WP_039156363.1\|1957968_1958172_+	hypothetical protein	NA	NA	NA	NA
WP_014498039.1\|1958886_1960425_-	DUF1521 domain-containing protein	NA	NA	NA	NA
WP_014498042.1\|1963911_1964103_+	hypothetical protein	NA	NA	NA	NA
WP_011084459.1\|1964439_1965246_-	EAL domain-containing protein	NA	NA	NA	NA
WP_035716749.1\|1965520_1966327_+	hypothetical protein	A0A023NHS3	Nitrincola_phage	1.4e-05	30.1
WP_110115952.1\|1968751_1973893_+	hypothetical protein	NA	NA	NA	NA
WP_011084508.1\|1974627_1974885_-	WGR domain-containing protein	NA	NA	NA	NA
WP_014497999.1\|1975454_1975676_+	hypothetical protein	NA	NA	NA	NA
WP_011084509.1\|1976200_1976545_-	hypothetical protein	NA	NA	NA	NA
WP_011084511.1\|1977095_1977452_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011084512.1\|1977505_1979053_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.1e-84	38.6
WP_039156390.1\|1980538_1981603_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_110115953.1\|1981650_1983447_-	recombinase family protein	NA	NA	NA	NA
WP_028144443.1\|1983866_1986119_+	hypothetical protein	NA	NA	NA	NA
WP_171463742.1\|1986391_1990717_+	hypothetical protein	NA	NA	NA	NA
WP_011084521.1\|1991174_1991753_+	hypothetical protein	NA	NA	NA	NA
WP_038968105.1\|1993833_1995102_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	5.5e-94	46.2
WP_014497989.1\|1995899_1996286_-	response regulator	NA	NA	NA	NA
WP_011084526.1\|1996370_1997054_-	response regulator transcription factor	NA	NA	NA	NA
WP_011084527.1\|1997050_1999720_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	1.9e-08	25.0
WP_011084514.1\|2000598_2001663_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

2054819 : 2128112

Mycobacterium_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038968105.1\|2054819_2056088_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	5.5e-94	46.2
WP_014497956.1\|2056144_2057254_-	molybdenum ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_161170740.1\|2059321_2059618_+	hypothetical protein	NA	NA	NA	NA
WP_011084599.1\|2062170_2062890_-	hypothetical protein	NA	NA	NA	NA
WP_011084600.1\|2062944_2063694_-	hypothetical protein	A0A1X9SH03	Bradyrhizobium_phage	4.4e-43	43.6
WP_080586761.1\|2065672_2067019_-	insulinase family protein	A0A2P1EIE5	Megavirus	1.4e-18	22.2
WP_011084606.1\|2068133_2068556_-	hypothetical protein	NA	NA	NA	NA
WP_011084608.1\|2069123_2069714_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011084609.1\|2069744_2071844_-	type III secretion system export apparatus subunit SctV	NA	NA	NA	NA
WP_011084610.1\|2071853_2072282_-	hypothetical protein	NA	NA	NA	NA
WP_011084611.1\|2072284_2072821_-	hypothetical protein	NA	NA	NA	NA
WP_011084612.1\|2072854_2073748_-	hypothetical protein	NA	NA	NA	NA
WP_014497948.1\|2073864_2074056_-	hypothetical protein	NA	NA	NA	NA
WP_011084613.1\|2074098_2074407_-	hypothetical protein	NA	NA	NA	NA
WP_014497947.1\|2074504_2075065_-	hypothetical protein	NA	NA	NA	NA
WP_014497946.1\|2075315_2076770_+	DUF1521 domain-containing protein	NA	NA	NA	NA
WP_011084549.1\|2076924_2077989_+\|transposase	IS630-like element ISRj1 family transposase	NA	NA	NA	NA
WP_011084616.1\|2078559_2078763_-	hypothetical protein	NA	NA	NA	NA
WP_161966260.1\|2079179_2079356_+	hypothetical protein	NA	NA	NA	NA
WP_085971921.1\|2079749_2080509_+\|transposase	IS5-like element ISBj2 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.6e-08	35.5
WP_171463834.1\|2080748_2081339_-	nodulation protein NolW	NA	NA	NA	NA
WP_026312858.1\|2081623_2082124_+	hypothetical protein	NA	NA	NA	NA
WP_011084621.1\|2082132_2082996_+	type III secretion inner membrane ring lipoprotein SctJ	NA	NA	NA	NA
WP_011084622.1\|2083007_2083646_+	nodulation protein	NA	NA	NA	NA
WP_011084623.1\|2083642_2084263_+	type III secretion system stator protein SctL	NA	NA	NA	NA
WP_011084624.1\|2084259_2085615_+	type III secretion system ATPase SctN	NA	NA	NA	NA
WP_011084625.1\|2085590_2086127_+	hypothetical protein	NA	NA	NA	NA
WP_011084626.1\|2086123_2087245_+	type III secretion system cytoplasmic ring protein SctQ	NA	NA	NA	NA
WP_011084627.1\|2087237_2087903_+	type III secretion system export apparatus subunit SctR	NA	NA	NA	NA
WP_011084628.1\|2087905_2088181_+	flagellar biosynthetic protein FliQ	NA	NA	NA	NA
WP_011084629.1\|2088191_2089013_+	type III secretion system export apparatus subunit SctT	NA	NA	NA	NA
WP_011084630.1\|2089009_2090047_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_011084514.1\|2094377_2095442_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011084637.1\|2096445_2096847_+	hypothetical protein	NA	NA	NA	NA
WP_011084638.1\|2097681_2097888_+	hypothetical protein	NA	NA	NA	NA
WP_041960889.1\|2098017_2099352_-\|transposase	IS5-like element ISBj2_B family transposase	K4ICS3	Acidithiobacillus_phage	2.1e-40	41.6
WP_011084760.1\|2104424_2104754_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_011084646.1\|2107515_2109831_-	hypothetical protein	NA	NA	NA	NA
WP_011084647.1\|2110026_2110689_-	hypothetical protein	NA	NA	NA	NA
WP_018647881.1\|2110699_2112154_-	type II and III secretion system protein family protein	NA	NA	NA	NA
WP_011084649.1\|2112180_2112870_-	response regulator transcription factor	NA	NA	NA	NA
WP_011084652.1\|2114883_2115951_-	hypothetical protein	NA	NA	NA	NA
WP_011084653.1\|2116549_2116984_+	VirK protein	NA	NA	NA	NA
WP_014497924.1\|2117446_2118355_-	hypothetical protein	NA	NA	NA	NA
WP_011084657.1\|2119761_2121243_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_011084658.1\|2121427_2122309_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_011084659.1\|2122859_2124101_+	cytochrome P450	NA	NA	NA	NA
WP_011084660.1\|2124527_2126771_+	hypothetical protein	NA	NA	NA	NA
WP_011084661.1\|2127101_2128112_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-126	64.8

DBSCAN-SWA_5

2234166 : 2405586

105

Paenibacillus_phage(30.77%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110115808.1\|2234166_2234925_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.6e-08	35.5
WP_028160487.1\|2235217_2235466_-	hypothetical protein	NA	NA	NA	NA
WP_100213762.1\|2235573_2236920_-	radical SAM family RiPP maturation amino acid epimerase	NA	NA	NA	NA
WP_039145712.1\|2237320_2238385_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_039145714.1\|2238375_2238663_-	Nif11 family protein	NA	NA	NA	NA
WP_080703795.1\|2242983_2244237_+	Tm-1-like ATP-binding domain-containing protein	NA	NA	NA	NA
WP_028160572.1\|2244223_2245021_+	phosphoenolpyruvate hydrolase family protein	NA	NA	NA	NA
WP_038974992.1\|2245082_2246840_+	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.2e-29	28.9
WP_038950841.1\|2247169_2247646_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_028143531.1\|2249190_2250294_+	hypothetical protein	NA	NA	NA	NA
WP_028143530.1\|2250334_2250544_+	hypothetical protein	NA	NA	NA	NA
WP_154694113.1\|2250975_2251134_+	hypothetical protein	NA	NA	NA	NA
WP_049802020.1\|2251159_2252029_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_157158435.1\|2252225_2253062_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_162130977.1\|2253097_2253247_+	hypothetical protein	NA	NA	NA	NA
WP_038974990.1\|2253243_2254023_-	KilA-N domain-containing protein	NA	NA	NA	NA
WP_028143528.1\|2254247_2254625_+	hypothetical protein	NA	NA	NA	NA
WP_131233132.1\|2254671_2255232_-	hypothetical protein	NA	NA	NA	NA
WP_028143526.1\|2255267_2255732_+	hypothetical protein	NA	NA	NA	NA
WP_080669724.1\|2255955_2256546_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_028143524.1\|2256538_2257564_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_028143523.1\|2258174_2258819_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_154694112.1\|2259680_2259857_-	hypothetical protein	NA	NA	NA	NA
WP_035711403.1\|2260083_2261658_+	hypothetical protein	NA	NA	NA	NA
WP_028143521.1\|2261640_2262063_-	hypothetical protein	NA	NA	NA	NA
WP_028143520.1\|2262059_2262302_-	hypothetical protein	NA	NA	NA	NA
WP_161966256.1\|2262600_2262894_-	hypothetical protein	NA	NA	NA	NA
WP_028143518.1\|2263131_2266449_-	HD domain-containing protein	NA	NA	NA	NA
WP_110115960.1\|2269409_2270150_-	hypothetical protein	NA	NA	NA	NA
WP_110115961.1\|2270398_2271898_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_110115962.1\|2271917_2272718_+	phosphonate metabolism transcriptional regulator PhnF	NA	NA	NA	NA
WP_110117294.1\|2272975_2273767_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_028143494.1\|2273936_2274794_-	phosphoenolpyruvate mutase	NA	NA	NA	NA
WP_028143493.1\|2275397_2275610_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_171463835.1\|2276447_2276672_-	hypothetical protein	NA	NA	NA	NA
WP_110115964.1\|2277875_2278181_+	multiubiquitin domain-containing protein	NA	NA	NA	NA
WP_110115965.1\|2278180_2278564_+	hypothetical protein	NA	NA	NA	NA
WP_162603492.1\|2278560_2279901_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_110115967.1\|2279893_2280943_+	hypothetical protein	NA	NA	NA	NA
WP_039155691.1\|2281015_2282284_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	1.6e-93	46.2
WP_162603493.1\|2282775_2283300_+	hypothetical protein	NA	NA	NA	NA
WP_110115971.1\|2288583_2290707_+	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	5.3e-41	31.1
WP_131233137.1\|2291453_2291654_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.1e-09	49.1
WP_028143484.1\|2292816_2293839_-	MFS transporter	NA	NA	NA	NA
WP_018645229.1\|2295331_2296888_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_018273862.1\|2298208_2299558_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011084514.1\|2299659_2300724_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_110115972.1\|2300752_2301512_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.7e-08	35.5
WP_018648284.1\|2306907_2307141_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_171463744.1\|2309647_2311393_+	E3 ubiquitin--protein ligase	NA	NA	NA	NA
WP_018648285.1\|2311449_2311620_+	hypothetical protein	NA	NA	NA	NA
WP_063629895.1\|2312324_2312912_-	GNAT family N-acetyltransferase	C5MKY6	Human_cytomegalovirus	8.6e-10	26.9
WP_110115973.1\|2316142_2317207_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011084715.1\|2317224_2318061_+	hypothetical protein	NA	NA	NA	NA
WP_110115808.1\|2318481_2319240_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.6e-08	35.5
WP_162603494.1\|2319204_2319978_-	hypothetical protein	NA	NA	NA	NA
WP_011084720.1\|2320100_2320805_-	hypothetical protein	NA	NA	NA	NA
WP_110115974.1\|2320916_2321348_-	hypothetical protein	NA	NA	NA	NA
WP_110115976.1\|2321948_2325734_-	AAA family ATPase	NA	NA	NA	NA
WP_110115977.1\|2325736_2326969_-	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_011084726.1\|2326977_2329086_-	DUF87 domain-containing protein	NA	NA	NA	NA
WP_011084727.1\|2329093_2330398_-	SIR2 family protein	NA	NA	NA	NA
WP_026312796.1\|2331384_2332005_-	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_110115978.1\|2332218_2332938_-	DCL family protein	NA	NA	NA	NA
WP_110115979.1\|2332938_2335449_-	AAA family ATPase	NA	NA	NA	NA
WP_131234255.1\|2335411_2335639_-	hypothetical protein	NA	NA	NA	NA
WP_110115980.1\|2335884_2337081_+	DUF932 domain-containing protein	A0A1V0DX75	Synechococcus_virus	2.8e-76	43.7
WP_028176021.1\|2337254_2339378_+	ParB N-terminal domain-containing protein	G8DH78	Emiliania_huxleyi_virus	1.8e-28	30.2
WP_028176020.1\|2339476_2339890_+	hypothetical protein	NA	NA	NA	NA
WP_110115981.1\|2344486_2345554_+	toprim domain-containing protein	NA	NA	NA	NA
WP_011084737.1\|2345884_2346811_+	DUF2493 domain-containing protein	NA	NA	NA	NA
WP_156149859.1\|2351076_2351217_+	hypothetical protein	NA	NA	NA	NA
WP_080584299.1\|2351251_2353687_-	porin family protein	NA	NA	NA	NA
WP_011084746.1\|2354488_2355046_+	hypothetical protein	NA	NA	NA	NA
WP_162603799.1\|2356211_2356418_+	cold shock domain-containing protein	A0A1W6JNX5	Morganella_phage	4.3e-09	45.8
WP_011084751.1\|2357519_2357846_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_162603495.1\|2357954_2358371_-	hypothetical protein	NA	NA	NA	NA
WP_011084755.1\|2361922_2364376_+	LPS-assembly protein LptD	NA	NA	NA	NA
WP_014497849.1\|2364393_2364585_+	hypothetical protein	NA	NA	NA	NA
WP_011084759.1\|2365683_2367441_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	7.9e-67	32.5
WP_011084760.1\|2367581_2367911_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_011084761.1\|2368045_2368642_+	hypothetical protein	NA	NA	NA	NA
WP_018647915.1\|2369454_2370246_+	hypothetical protein	NA	NA	NA	NA
WP_162130978.1\|2371223_2371394_+	hypothetical protein	NA	NA	NA	NA
WP_154694111.1\|2371510_2371651_+	hypothetical protein	NA	NA	NA	NA
WP_011084771.1\|2373435_2375754_+	S9 family peptidase	NA	NA	NA	NA
WP_011084772.1\|2375959_2376259_+\|transposase	transposase	NA	NA	NA	NA
WP_014497843.1\|2376339_2376495_+\|transposase	transposase	NA	NA	NA	NA
WP_011084776.1\|2378596_2378824_+	hypothetical protein	NA	NA	NA	NA
WP_110115808.1\|2380403_2381163_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.6e-08	35.5
WP_011084778.1\|2382652_2383045_-	hypothetical protein	NA	NA	NA	NA
WP_028143999.1\|2383091_2383559_-	hypothetical protein	NA	NA	NA	NA
WP_011084781.1\|2384275_2384641_-	Nif11 family protein	NA	NA	NA	NA
WP_110115984.1\|2386100_2387420_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_011084786.1\|2387419_2387671_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_028143997.1\|2388115_2389672_+	hypothetical protein	NA	NA	NA	NA
WP_011084789.1\|2389661_2390300_+	DUF4194 domain-containing protein	NA	NA	NA	NA
WP_110115985.1\|2390296_2393731_+	hypothetical protein	NA	NA	NA	NA
WP_028143996.1\|2393733_2394903_+	hypothetical protein	NA	NA	NA	NA
WP_011084792.1\|2395390_2395708_+	hypothetical protein	NA	NA	NA	NA
WP_028143995.1\|2396425_2397958_+	polygalacturonase	NA	NA	NA	NA
WP_011084794.1\|2398176_2399217_+	pectinesterase	NA	NA	NA	NA
WP_018647405.1\|2401401_2402346_+	hypothetical protein	NA	NA	NA	NA
WP_014497829.1\|2404562_2405198_+	hypothetical protein	NA	NA	NA	NA
WP_011084799.1\|2405205_2405586_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2499581 : 2555485

Acinetobacter_phage(12.5%)

transposase,integrase,protease,tRNA

attL 2520579:2520595|attR 2562388:2562404

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011084883.1\|2499581_2499869_+\|transposase	transposase	NA	NA	NA	NA
WP_011084884.1\|2499865_2500339_+	hypothetical protein	NA	NA	NA	NA
WP_014497769.1\|2501009_2501606_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	5.8e-46	44.5
WP_028144144.1\|2501602_2502997_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	2.2e-48	34.9
WP_011084888.1\|2503150_2503468_-	Dabb family protein	NA	NA	NA	NA
WP_011084889.1\|2503603_2504239_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011084890.1\|2504353_2505349_+	biotin synthase BioB	NA	NA	NA	NA
WP_011084891.1\|2505398_2505752_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_011084892.1\|2505828_2506983_+	8-amino-7-oxononanoate synthase	G9E4Q1	Emiliania_huxleyi_virus	1.9e-21	28.2
WP_011084893.1\|2506979_2507615_+	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_011084894.1\|2507611_2508877_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	2.9e-10	28.6
WP_028153345.1\|2510123_2511002_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	9.4e-45	36.5
WP_011084897.1\|2511005_2511857_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_011084898.1\|2511869_2512229_+	hypothetical protein	NA	NA	NA	NA
WP_014497761.1\|2512897_2513098_+	hypothetical protein	NA	NA	NA	NA
WP_014497760.1\|2513441_2513645_-	hypothetical protein	NA	NA	NA	NA
WP_011084900.1\|2514041_2514320_+	hypothetical protein	NA	NA	NA	NA
WP_011084901.1\|2515052_2515439_+	ectoine synthase	NA	NA	NA	NA
WP_162494198.1\|2515977_2525916_+	amino acid adenylation domain-containing protein	A0A2K9L3I8	Tupanvirus	2.0e-154	27.5
2520579:2520595	attL	NA	NA	NA	NA
WP_026312933.1\|2527538_2528222_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_018648598.1\|2528759_2529026_+	DUF3551 domain-containing protein	NA	NA	NA	NA
WP_011084907.1\|2529473_2529704_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011084908.1\|2530017_2530503_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011084909.1\|2530499_2530820_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_011084910.1\|2530832_2531957_+	DUF3800 domain-containing protein	U5N3F3	Enterobacteria_phage	2.0e-71	39.7
WP_085967575.1\|2532221_2533351_-\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	2.0e-18	33.7
WP_011084912.1\|2533705_2534275_+	hypothetical protein	NA	NA	NA	NA
WP_011084913.1\|2534320_2534851_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_011084914.1\|2535145_2535352_-	cold-shock protein	NA	NA	NA	NA
WP_011084916.1\|2536608_2537127_+	hypothetical protein	NA	NA	NA	NA
WP_161966513.1\|2537655_2538210_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_011084918.1\|2538206_2538989_+	hypothetical protein	NA	NA	NA	NA
WP_171463836.1\|2539898_2540807_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_011084921.1\|2541677_2541962_+	hypothetical protein	NA	NA	NA	NA
WP_162494059.1\|2542197_2542701_-	hypothetical protein	NA	NA	NA	NA
WP_162130951.1\|2542657_2542876_+	hypothetical protein	NA	NA	NA	NA
WP_014497739.1\|2543870_2544074_-	hypothetical protein	NA	NA	NA	NA
WP_038968004.1\|2544420_2545746_+	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_011084926.1\|2545742_2547047_+	MFS transporter	NA	NA	NA	NA
WP_011084927.1\|2547012_2547792_+	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_110115989.1\|2547816_2548146_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011084929.1\|2548147_2549725_+\|tRNA	class I tRNA ligase family protein	NA	NA	NA	NA
WP_011084930.1\|2549744_2550878_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_155256178.1\|2551284_2551452_+	hypothetical protein	NA	NA	NA	NA
WP_014497735.1\|2551806_2552427_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_014497734.1\|2552426_2553647_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_157158178.1\|2553857_2554229_-\|transposase	transposase	NA	NA	NA	NA
WP_011084934.1\|2554669_2555485_+\|protease	YopT-type cysteine protease domain-containing protein	NA	NA	NA	NA
2562388:2562404	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3441500 : 3451087

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011085709.1\|3441500_3442232_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.9e-12	28.6
WP_011085710.1\|3442215_3442920_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	25.2
WP_038965772.1\|3443081_3443762_-	aldolase	A0A077SK32	Escherichia_phage	4.6e-47	49.3
WP_110116024.1\|3443866_3444784_+	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.2e-66	48.3
WP_011085713.1\|3444800_3445583_+	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_011085714.1\|3445579_3446854_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	6.3e-74	42.0
WP_011085715.1\|3447024_3448716_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-12	29.8
WP_171463842.1\|3448891_3451087_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-13	39.1

DBSCAN-SWA_8

5479029 : 5489226

uncultured_Mediterranean_phage(88.89%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110116116.1\|5479029_5480430_-	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	Q8SBN9	Clostridium_phage	4.9e-19	42.7
WP_011087512.1\|5480539_5481190_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-27	50.0
WP_011087513.1\|5481431_5481803_+	response regulator	NA	NA	NA	NA
WP_028171844.1\|5481806_5482574_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.8e-36	37.6
WP_011087515.1\|5482762_5483125_-	hypothetical protein	NA	NA	NA	NA
WP_028171842.1\|5483219_5484551_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.5e-97	47.9
WP_060912318.1\|5484761_5485574_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	4.2e-55	48.4
WP_110116117.1\|5485570_5486098_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_011087519.1\|5486187_5486421_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.4e-08	63.6
WP_028171841.1\|5486587_5487340_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.0e-44	49.7
WP_011087521.1\|5487361_5488201_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.1e-31	37.1
WP_110116118.1\|5488197_5489226_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.0e-21	41.2

DBSCAN-SWA_9

5768804 : 5778047

Pseudomonas_phage(28.57%)

tail,portal,terminase,protease,capsid,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110116225.1\|5768804_5770040_+\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	9.5e-43	33.2
WP_110116226.1\|5770039_5770705_+\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	6.7e-11	30.3
WP_110117311.1\|5770707_5771028_+	gene transfer agent family protein	NA	NA	NA	NA
WP_110116227.1\|5771024_5771267_+	hypothetical protein	NA	NA	NA	NA
WP_110116228.1\|5771267_5771765_+\|head,protease	HK97 family phage prohead protease	Q8HAD3	Salmonella_phage	8.0e-17	39.0
WP_110116229.1\|5771783_5772917_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	5.1e-35	32.2
WP_110116230.1\|5772929_5773514_+	hypothetical protein	NA	NA	NA	NA
WP_110116231.1\|5773513_5773843_+	HNH endonuclease	B5WZZ4	Pseudomonas_phage	5.1e-20	58.4
WP_110116232.1\|5773847_5774288_+	hypothetical protein	NA	NA	NA	NA
WP_110116233.1\|5774305_5774593_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_171463771.1\|5774666_5775011_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_110116235.1\|5775012_5775330_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_110116236.1\|5775344_5776025_-	hypothetical protein	NA	NA	NA	NA
WP_110116237.1\|5776072_5776444_+\|terminase	phage terminase small subunit P27 family	A0A142KAM7	Gordonia_phage	5.6e-07	33.3
WP_110116238.1\|5776421_5778047_+\|terminase	terminase large subunit	D0R0D0	Streptococcus_phage	2.9e-71	33.7

DBSCAN-SWA_10

6633259 : 6640697

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028171493.1\|6633259_6633574_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	4.7e-23	57.6
WP_011087983.1\|6633622_6635245_+	chaperonin GroEL	A0A240F779	uncultured_virus	6.8e-174	59.2
WP_110117335.1\|6635447_6635792_+	hypothetical protein	NA	NA	NA	NA
WP_011087986.1\|6636384_6636843_+	Hsp20 family protein	E3SM62	Prochlorococcus_phage	1.5e-17	37.1
WP_011087987.1\|6637009_6637936_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	2.3e-33	33.8
WP_011087989.1\|6638462_6638924_+	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	3.7e-24	39.4
WP_011087990.1\|6639008_6639509_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_011087991.1\|6639581_6640697_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.9e-22	26.4

DBSCAN-SWA_11

9165499 : 9201423

Klebsiella_phage(16.67%)