CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP021458	Lactobacillus brevis strain ZLB004 plasmid p2, complete sequence	0 crisprs	NA	0	0
NZ_CP021461	Lactobacillus brevis strain ZLB004 plasmid p5, complete sequence	0 crisprs	NA	0	5
NZ_CP021457	Lactobacillus brevis strain ZLB004 plasmid p1, complete sequence	0 crisprs	cas14j	0	1
NZ_CP021459	Lactobacillus brevis strain ZLB004 plasmid p3, complete sequence	0 crisprs	NA	0	1
NZ_CP021456	Lactobacillus brevis strain ZLB004 chromosome, complete genome	6 crisprs	cas8e,cse2gr11,cas7,cas5,cas6e,cas1,DEDDh,csa3,cas3,DinG,csn2,cas2,cas9	40	2
NZ_CP021460	Lactobacillus brevis strain ZLB004 plasmid p4, complete sequence	0 crisprs	csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2214 : 52568

Lactobacillus_phage(21.05%)

holin,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140049.1\|2214_2826_+\|transposase	IS607 family transposase	Q331V0	Clostridium_botulinum_C_phage	2.2e-61	55.6
WP_191980878.1\|2803_3982_+\|transposase	transposase	Q331V1	Clostridium_botulinum_C_phage	1.1e-91	48.5
WP_110140051.1\|4221_4491_+	hypothetical protein	NA	NA	NA	NA
WP_110140052.1\|4506_4812_+	hypothetical protein	NA	NA	NA	NA
WP_110140053.1\|5065_7525_+	hypothetical protein	NA	NA	NA	NA
WP_039106868.1\|7655_7988_+	hypothetical protein	NA	NA	NA	NA
WP_162551576.1\|8038_8671_+	hypothetical protein	NA	NA	NA	NA
WP_110140055.1\|8682_10692_+	ATPase	NA	NA	NA	NA
WP_110140056.1\|10691_11894_+	peptidoglycan DD-metalloendopeptidase family protein	E9LUJ4	Lactobacillus_phage	2.1e-10	35.2
WP_162551577.1\|11982_12522_+	hypothetical protein	NA	NA	NA	NA
WP_110140058.1\|12680_13610_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.1e-22	28.7
WP_015474013.1\|13774_14566_+	capsular polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_191980879.1\|14575_15337_+	polysaccharide biosynthesis tyrosine autokinase	A0A1X9I5D6	Streptococcus_phage	1.4e-31	41.7
WP_015474011.1\|15333_16116_+	hypothetical protein	NA	NA	NA	NA
WP_110140060.1\|16115_16784_+	sugar transferase	NA	NA	NA	NA
WP_191980880.1\|16874_17906_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	1.8e-42	34.4
WP_110140062.1\|18098_19184_+	LCP family protein	A0A1X9I5X1	Streptococcus_phage	1.1e-15	32.6
WP_110140064.1\|19271_20201_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	3.9e-25	33.7
WP_003646127.1\|20912_21281_-	DUF5388 domain-containing protein	NA	NA	NA	NA
WP_010010558.1\|21283_22090_-	AAA family ATPase	F0PIG8	Enterococcus_phage	1.1e-60	46.8
WP_110140066.1\|23484_23826_+	replication protein	NA	NA	NA	NA
WP_010014534.1\|24087_24369_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_162551578.1\|24358_24865_+	hypothetical protein	NA	NA	NA	NA
WP_041816268.1\|24854_25133_-	hypothetical protein	NA	NA	NA	NA
WP_162551584.1\|25154_25382_-	hypothetical protein	NA	NA	NA	NA
WP_110140068.1\|25634_27695_+	MobA/MobL family protein	NA	NA	NA	NA
WP_110140070.1\|27878_29003_+	hypothetical protein	NA	NA	NA	NA
WP_021353390.1\|29160_29250_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_110140071.1\|29372_30293_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	7.1e-51	38.6
WP_110140073.1\|30657_31587_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	3.9e-25	33.7
WP_110140075.1\|31874_32993_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	6.6e-168	76.6
WP_110140103.1\|35377_36148_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_110140076.1\|36147_37272_+	glycosyltransferase	NA	NA	NA	NA
WP_046041046.1\|39674_40511_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_110140077.1\|40518_41730_+	hypothetical protein	NA	NA	NA	NA
WP_110140078.1\|41762_42824_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_110140079.1\|42887_43550_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_162551579.1\|43895_44894_+	Stealth CR1 domain-containing protein	NA	NA	NA	NA
WP_002816285.1\|44987_45239_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_191980881.1\|45292_45802_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	2.8e-89	98.8
WP_080595765.1\|45805_46135_+\|transposase	transposase	Q6J1X2	Lactobacillus_phage	4.0e-57	99.1
WP_110140080.1\|46329_47880_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_110140081.1\|47943_48873_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	2.0e-24	33.3
WP_014216283.1\|49254_49836_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	4.2e-33	45.1
WP_096110662.1\|50233_50866_+	recombinase family protein	E5FFF9	Burkholderia_phage	4.1e-18	34.3
WP_082040905.1\|51288_51696_-	hypothetical protein	NA	NA	NA	NA
WP_044010401.1\|51692_52568_-	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-30	34.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021459

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

33846 : 52139

Streptococcus_phage(80.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140130.1\|33846_34776_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.1e-24	34.1
WP_014216283.1\|35436_36018_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	4.2e-33	45.1
WP_110140131.1\|36415_37048_+	recombinase family protein	E5FFF9	Burkholderia_phage	4.1e-18	34.3
WP_110140135.1\|37282_38002_+	Fic family protein	NA	NA	NA	NA
WP_000420682.1\|38432_38747_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|38762_39149_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|39177_40563_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000879507.1\|40565_40718_+	hypothetical protein	NA	NA	NA	NA
WP_000398284.1\|40740_41946_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_001009056.1\|41988_42210_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000342539.1\|42326_42824_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_110140132.1\|42798_43305_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	5.5e-90	99.4
WP_000331160.1\|43288_45736_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000804748.1\|45738_47916_+	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000769868.1\|47912_48914_+	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_001224319.1\|48910_49843_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-171	100.0
WP_001791010.1\|50087_50204_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_110140133.1\|50219_52139_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP021456

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021456_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021456_1

115748-116264

TypeI-E

I-E,II-B

Consensus_repeat	Method
GTATTCCCCACATGTGTGGGGGTGATCC	CRISPRCasFinder
GTATTCCCCACATGTGTGGGGGTGATCCT	CRT

8 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,DEDDh

The CRISPR arrays of NZ_CP021456_1

>merge|NZ_CP021456|1|115748-116264|CRISPRCasFinder,CRT
GTATTCCCCACATGTGTGGGGGTGATCCCATCATGCACATCTCGCAGGTTATTAATGCCATGTATTCCCCACATGTGTGGGGGTGATCCTGGAGTCTATATTTAAAAGGCTTGACAGTCAAGGTATTCCCCACATGTGTGGGGGTGATCCCACGGTAACGGTTGCTGGTAGAAATGTTGATAAGTATTCCCCACATGTGTGGGGGTGATCCTGTACTGACCAGTTTTAGCGCCAGCCTTGGTTAGTATTCCCCACATGTGTGGGGGTGATCCTGATCGATTGATTTTTAAAAAGCGAATTAAATCGTATTCCCCACATGTGTGGGGGTGATCCTGTAATGTTTTCCGACCCCATGGTGTCCCCAGTGTATTCCCCACATGTGTGGGGGTGATCCTTAATATTTATGCTGGCAGCCCGGTCACTTGGTGTATTCCCCACATGTGTGGGGGTGATCCTGAGGTTTGTTAATTTTAAAATAATGAAAATCAGTATTCCCCACAGGTGTGGGGGTGATGAT

>NZ_CP021456|1|1|115748-116263|CRISPRCasFinder
GTATTCCCCACATGTGTGGGGGTGATCC	CATCATGCACATCTCGCAGGTTATTAATGCCAT
GTATTCCCCACATGTGTGGGGGTGATCC	TGGAGTCTATATTTAAAAGGCTTGACAGTCAAG
GTATTCCCCACATGTGTGGGGGTGATCC	CACGGTAACGGTTGCTGGTAGAAATGTTGATAA
GTATTCCCCACATGTGTGGGGGTGATCC	TGTACTGACCAGTTTTAGCGCCAGCCTTGGTTA
GTATTCCCCACATGTGTGGGGGTGATCC	TGATCGATTGATTTTTAAAAAGCGAATTAAATC
GTATTCCCCACATGTGTGGGGGTGATCC	TGTAATGTTTTCCGACCCCATGGTGTCCCCAGT
GTATTCCCCACATGTGTGGGGGTGATCC	TTAATATTTATGCTGGCAGCCCGGTCACTTGGT
GTATTCCCCACATGTGTGGGGGTGATCC	TGAGGTTTGTTAATTTTAAAATAATGAAAATCA
GTATTCCCCACAGGTGTGGGGGTGATGA

>NZ_CP021456|1|1|115748-116264|CRT
GTATTCCCCACATGTGTGGGGGTGATCCC	ATCATGCACATCTCGCAGGTTATTAATGCCAT
GTATTCCCCACATGTGTGGGGGTGATCCT	GGAGTCTATATTTAAAAGGCTTGACAGTCAAG
GTATTCCCCACATGTGTGGGGGTGATCCC	ACGGTAACGGTTGCTGGTAGAAATGTTGATAA
GTATTCCCCACATGTGTGGGGGTGATCCT	GTACTGACCAGTTTTAGCGCCAGCCTTGGTTA
GTATTCCCCACATGTGTGGGGGTGATCCT	GATCGATTGATTTTTAAAAAGCGAATTAAATC
GTATTCCCCACATGTGTGGGGGTGATCCT	GTAATGTTTTCCGACCCCATGGTGTCCCCAGT
GTATTCCCCACATGTGTGGGGGTGATCCT	TAATATTTATGCTGGCAGCCCGGTCACTTGGT
GTATTCCCCACATGTGTGGGGGTGATCCT	GAGGTTTGTTAATTTTAAAATAATGAAAATCA
GTATTCCCCACAGGTGTGGGGGTGATGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021456.1\|WP_110139243.1\|119262_120957_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP021456.1\|WP_110139247.1\|123342_124014_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NZ_CP021456.1\|WP_110139245.1\|121577_122648_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP021456.1\|WP_110139235.1\|105854_106292_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225064
NZ_CP021456.1\|WP_110139251.1\|127725_128889_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_087716449.1\|105342_105771_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP021456.1\|WP_110139237.1\|110234_111056_+\|AAC(3)-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|376807
NZ_CP021456.1\|WP_110139242.1\|116498_119270_+\|CRISPR-associated-helicase-Cas3'	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP021456.1\|WP_110139239.1\|113526_113961_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139236.1\|106375_108109_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372109
NZ_CP021456.1\|WP_110139244.1\|120973_121585_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP021456.1\|WP_110139241.1\|114301_115468_-\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|378274
NZ_CP021456.1\|WP_043023282.1\|108286_109774_-\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_CP021456.1\|WP_110139250.1\|126925_127564_+\|carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|239398
NZ_CP021456.1\|WP_043023279.1\|103765_105208_-\|NADP-dependent-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236453
NZ_CP021456.1\|WP_110139249.1\|124960_125848_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP021456.1\|WP_110139246.1\|122628_123330_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
NZ_CP021456.1\|WP_110139240.1\|113957_114161_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224393
NZ_CP021456.1\|WP_110139248.1\|124010_124964_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP021456.1\|WP_110139238.1\|111481_113419_+\|MucBP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377660

Protein	Function_ID	Function_description	E-value
NZ_CP021456.1\|WP_110139243.1\|119262_120957_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.5478e-80
NZ_CP021456.1\|WP_110139247.1\|123342_124014_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	5.44073e-69
NZ_CP021456.1\|WP_110139245.1\|121577_122648_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.96169e-151
NZ_CP021456.1\|WP_110139235.1\|105854_106292_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225064	COG2153, ElaA, Predicted acyltransferase [General function prediction only].	7.06262e-32
NZ_CP021456.1\|WP_087716449.1\|105342_105771_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	3.17517e-15
NZ_CP021456.1\|WP_110139237.1\|110234_111056_+\|AAC(3)-family-N-acetyltransferase	gnl\|CDD\|376807	pfam02522, Antibiotic_NAT, Aminoglycoside 3-N-acetyltransferase. This family consists of bacterial aminoglycoside 3-N-acetyltransferases EC:2.3.1.81, these catalyze the reaction: Acetyl-Co + a 2-deoxystreptamine antibiotic <=> CoA + N3'-acetyl-2-deoxystreptamine antibiotic. The enzyme can use a range of antibiotics with 2-deoxystreptamine rings as acceptor for its acetyltransferase activity, this inactivates and confers resistance to gentamicin, kanamycin, tobramycin, neomycin and apramycin amongst others.	1.08886e-81
NZ_CP021456.1\|WP_110139242.1\|116498_119270_+\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.0719e-80
NZ_CP021456.1\|WP_110139236.1\|106375_108109_-\|hypothetical-protein	gnl\|CDD\|372109	pfam12440, MAGE_N, Melanoma associated antigen family N terminal. This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. The family is found in association with pfam01454. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).	1.24407e-05
NZ_CP021456.1\|WP_110139244.1\|120973_121585_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.18039e-28
NZ_CP021456.1\|WP_110139241.1\|114301_115468_-\|DUF2075-domain-containing-protein	gnl\|CDD\|378274	pfam09848, DUF2075, Uncharacterized conserved protein (DUF2075). This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.	5.67874e-127
NZ_CP021456.1\|WP_043023282.1\|108286_109774_-\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_CP021456.1\|WP_110139250.1\|126925_127564_+\|carbonic-anhydrase-family-protein	gnl\|CDD\|239398	cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This sub-family includes bacterial carbonic anhydrase alpha, as well as plant enzymes such as tobacco nectarin III and yam dioscorin and, carbonic anhydrases from molluscs, such as nacrein, which are part of the organic matrix layer in shells. Other members of this family may be involved in maintaining pH balance, in facilitating transport of carbon dioxide or carbonic acid, or in sensing carbon dioxide levels in the environment. Dioscorin is the major storage protein of yam tubers and may play a role as an antioxidant. Tobacco Nectarin may play a role in the maintenace of pH and oxidative balance in nectar. Mollusc nacrein may participate in calcium carbonate crystal formation of the nacreous layer. This subfamily also includes three alpha carbonic anhydrases from Chlamydomonas reinhardtii (CAH 1-3). CAHs1-2 are localized in the periplasmic space. CAH1 faciliates the movement of carbon dioxide across the plasma membrane when the medium is alkaline. CAH3 is localized to the thylakoid lumen and provides CO2 to Rubisco.	3.12453e-47
NZ_CP021456.1\|WP_043023279.1\|103765_105208_-\|NADP-dependent-phosphogluconate-dehydrogenase	gnl\|CDD\|236453	PRK09287, PRK09287, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_CP021456.1\|WP_110139249.1\|124960_125848_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	2.65118e-40
NZ_CP021456.1\|WP_110139246.1\|122628_123330_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	2.4073e-46
NZ_CP021456.1\|WP_110139240.1\|113957_114161_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	7.10536e-22
NZ_CP021456.1\|WP_110139248.1\|124010_124964_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.88365e-128
NZ_CP021456.1\|WP_110139238.1\|111481_113419_+\|MucBP-domain-containing-protein	gnl\|CDD\|377660	pfam06458, MucBP, MucBP domain. The MucBP (MUCin-Binding Protein) domain is found in a wide variety of bacterial proteins, in several repeats. The domain is found in bacterial peptidoglycan bound proteins and is often found in conjunction with pfam00746 and pfam00560.	3.96431e-15

>NZ_CP021456.1|WP_110139241.1|114301_115468_-|DUF2075-domain-containing-protein
MNKILQEQFFVDDLSDDQKAVITDMNHYIKDSLNGQESAVAIIQGAAGTGKSVVLMELVRQYMTDKRYRTSLVVNHPELYKAYQDLAESIPNMKASAIRRPTSLINYAQKNHKQYDIIFVDEAHLLYSKSEPYAHYRGQNQLTDLMNLAKVVVVVYDFDQVFQSKMYWDQDLLYQTIGHHPHKRFDMNFQYRMVASDEQVAWMDDLAAEKPLRSFPENSDFEFKMFDTAGELFENIKKRNKEVGMSRVVATSGFPRIDGRHNVEMDSFSLPWDEWDPQRTHWAKREGSITQVGTIYTLQGFDLNYVGMIIGPSFGYDPQTDTMTIIPEKYSHKEIFKKRKDMQFSRNEYKTFIANVLNVLMKRGKYGLYLTAYDDALRARLLELENHQ
>NZ_CP021456.1|WP_110139240.1|113957_114161_-|helix-turn-helix-transcriptional-regulator
MKNTIATRRKQRKLSQAELAQLTAVTRQTINAIENNKYDPSLSLAFKLAAILETTVDALFNNGEDVK
>NZ_CP021456.1|WP_110139239.1|113526_113961_-|hypothetical-protein
MSRAKRILRFTFWVNNLVFLLLAALIIVSFSHLFYIWAPILSLMLVVTCVAMLWYMQHHLGVKSFKGLYWVDDERDRLITLKVHSTVMFSATYFLYGLLGIICLLLNWHLSSQELGQTLLAIIWLALVASNLQYYWLWLKYDQA
>NZ_CP021456.1|WP_110139238.1|111481_113419_+|MucBP-domain-containing-protein
MKKTVIKETKRLLILLGATGLLGGIGIVMNGTPITAQAATTTTQTQGILHSGDFGTSHWYISDDLTLHIGAGTFANLSNSQSAPPWTAYGDQVAKIVIEGPVTLAPNSRELFGYLGATSIEGLDQIDASHVTNFEFAFFGIQVPNLDLTSWDVHNVTDAGFMFMRAQSDVINLSGWQMPKLKLAQWMFMLAPRVHELDLAGINFRNADATRALMNMNLTVIHLGPDSLLTGTNLQPFHNDAYQDMWQDIGDGTTEAPTGKNRYTYSQLMAEFKGAAPYTYVRAKNPGQPVTVQYLDQLNQALVKADTLTGYYGDTFTAQAKTFAGYHVTSVDGEPTGTFGSSPYTVTYHYAVDEKNQQSLLGEDATITVGDPTPTSETFKAKATDKDGQALPVMVDLSQATLNQPGRYPVTLTTRDGQSKAVTLTVKAADESSSSSSIDTSHSSSTPISSSNSDDSLSSGDLISGGDTDLAVFKGQAVYATKAVRLYQRPTFKASQVRARYAKQSRTKRPMFVVIGSAHSKHHALRFKVRDVNHHSKTAGKVGYITAKKAYVTNVYYQRTYTRVTVINPQGVNGYRTRKLTGKTRHYRRGQTLRVKRLVRYHLTTRYVLTNGRYVTTNKKLVKVQQNSAQQSTQHSAAVTTRTIK
>NZ_CP021456.1|WP_110139237.1|110234_111056_+|AAC(3)-family-N-acetyltransferase
MTNWQEREITRVTTATDLYDLFDRLGLRATDSCLVHTSLSAFGYIPGGEQTLVTALKTTLSQGNIVMPAQSADYTDPREWLYPPVRQDLQAKVMAGMPAYDRTLTPCHFIGTTPEYFRTLPDTQRSGHPTCSMTAWGRNAAQICATPTLDLPFGAQGPLQKLYNLNAKVVCLGTDFETATAIHLAESTIDRPVFEEQAPISVAGKPQWRSYQMVELEPYDDFNVMGAAFCQAHPEQVTQQPLGQHHQARVIGMRALVDFAREYYREKDRREMK
>NZ_CP021456.1|WP_043023282.1|108286_109774_-|glucose-6-phosphate-dehydrogenase
MATERTALFMFFGGTGDLAYRKLYPSLFNLYRKGNLRTHFAVIGTSRQSIDDDKFRAAVKKSLADSGNRADSKEASDFISHFYYQSHDVTDTAHYSVLKELAEKLDKKYKLQGNRIFYLSMAPQFFGTIAQDLKTQGLMSTDKNAFNRLVIEKPFGRDFDSAKQLNDALSKSFEEEQIFRIDHYLGKEMIQNIEALRFGNTLVESLWNNRYIDNIQVTLSEKLGVEERASYYDNSGALRDMVQNHIMQIVSLLAMEQPVAFTDTDIRAEKVKALRSLRVYNVADAATNFVRGQYGSVNDQPDYRHEDNVPVDSTTETFVAGKLLFDNYRWSGTPFYVRTGKMLADKFTRVDVVFKRPLVDIFAFPQSQNTPLAANVLTIFVEPHAGFSLQLNAKTNDTGFQTEPIKLDYIVGAEKSKDTPEPYERLIHDVLKGDGTNFSSWPEVSYAWKFVDQIRRVWDLQEPNFPNYTPHSMGPAAAEELIQRDHREWIYRLNN
>NZ_CP021456.1|WP_110139236.1|106375_108109_-|hypothetical-protein
MTFSPLNVPILLLSTSLLTLTLANVQPVTAHATATSVSLAEKTTTSTATAQLFTSPVNQPLTLTADTYPLYNDEGQETTDTLPGKPQLTTTKILVDPLAGTTYYRVQENPDRFIKYDATTVNLKHTLTLNFSDPDGSTIKGPLMFRMTQGNDFDAIASDLKDQYAAVIDGYVFNKTTVDNTTDPYNTQFNFSYDKAGGSSTDESHTSIPASSLPSLSTLTNEKIRLTSPSDYSLYDNDGEELTTGKTTVAGSSYYSATGLYLFHQKLTNADNVFYQISPDAFIKDDDTTALTSPITFKYETSDGQSIKTDSMLDTGLVTDDDLNNLIKELQTWQPTIDGYTYQGVNPTADTLTFKYTPTSASSSSDTSSPSSDNSQSSSSTSTDSTSSSSQPSSSTSTDSTASSDTHNSVVTSASSTRPDKSIVPKGAAVTAIRKIGLYRDVQFTKQNRRHWYQRQPQTKRPQFVVTGYARTKAGTLRYQIHDVNHHSATDGQRGYITANSKFVMPTYYQTAPKRIKVTSPHGVNAYRQINLTQKKRHYRVGTTITVKAIKSYHLTTRLVLSNGTYVTANKILVAKK
>NZ_CP021456.1|WP_110139235.1|105854_106292_+|GNAT-family-N-acetyltransferase
MEWQAKLFDELSREEFFDIAYERIRTFVMAQHRPYQEIDAADKVARHILGYQAGQLVAYARVFREAGHVTFGRVLTIPEQRGTGIGRQLMVQIEAEIRRNFAGEAISIEAQIDKQHFYEKFGYAAIGAVFDFNGTPHIRMDKADL
>NZ_CP021456.1|WP_087716449.1|105342_105771_-|winged-helix-turn-helix-transcriptional-regulator
MPNAFRSIGLIARATAAMGNQLFQADDLNNNQFIFLMRIVETPGITQAELATQLHVDPSTCLRAVRKLIATQYVTRGTDAHDKKRRPLLATAKGQAIYPALEDYEQQILSVGTQGLSTGETALLEELLAKVAHNVRDYQNQH
>NZ_CP021456.1|WP_043023279.1|103765_105208_-|NADP-dependent-phosphogluconate-dehydrogenase
MADQKANIGVVGMAVMGKNLALNIESRGYTVGIYNRSANKTEQVMKDHSEKKLVPSYSVEDFVKSLETPRRILLMVKAGKPTDAVIHELLPLLDKGDVLIDGGNTNFHDTMARNAELDKSGINFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKIAAKAPQDGKPCVTYIGPNGAGHYVKMVHNGIEYGDEELIDESYNIMRNVAGISVDDMADIFKEWNKGELDSYLIEITADILTRKDDLGDDKNLPIVDAIKDRGNNKGTGKWSSEDALDVQVPQSVITESVYARYISMLKDERVKASKVLPAAEKQGKADIADKDKFVEEVRQALFFGKLMSYAQGFEQLRFASEANDWDLKFGELAQIWRGGCIIRAQFLQNITDAFDKDPKLSNLLFDDYFKDIAGKYQQSIRDVVAMAVQAGIPVPSLSAAITYYDSFRAEVLPANLLQAQRDYFGAHTYERNDREGNFHYSWYEEQ
>NZ_CP021456.1|WP_110139242.1|116498_119270_+|CRISPR-associated-helicase-Cas3'
MEVSKSVAALWAKKSSTDTQQYWLPLISHLIDARNTINWLFNHWLSDGQRQLLMGTLSEEQTQQLVKFVGFVHDLGKATPAFQMKQSYDRDADLDEQLKARLTHGGFLKLNDLCLASAKQSPHARAGEAILENFGVPASIGAIIGGHHGKPESSQPYGQLQDYTANYFQSDNQSELQQPWKQVHRELFEYGLASSGYQEVTEIPDIQQPQAVILEGLLIMADWLASSEYLDQDQTIPLFPLISLDQSWQDIDPTARFQQAINAWDLGGEWHPQQLSSADPYKERWGFSARPVQRTMTAAIQDTLDPGMVIVEAPMGLGKTEIALVAAEQLAFQTGRDGLFMGLPTQATTNAMFDRVTEWLAFLAQSQGEDFPIKLMHGKAQFNQTYRQLPNAANIYATENDIEDEKENETGAVVVNSWFSGKKSILTKFTVGTIDHLLLMGLKQKHLFLRHLGLSGKVVVIDEVHAYDAYMGQYLRKALSWLGAYHVPVVILSATLPKDKRNALIKAYLRGKYGSKFKKQLQAPTDWENAQAYPLLSIVDGCQIKQITEFPGKSDQQPMGITVQRIDSEDADLIAQVVDKISDGGVAGIIVNTVKRAQQLAQLVPHDVKLMVLHSAFLATDRARQEQALQAAIGKNGTRPERLIVIGTQVLEQSLDIDFDVLYTDIAPMDLVLQRIGRLHRHQIERPVALQTPQVFLMGIQAGHEYGDGNEAVYGKYLLMKTDAFMPNQLTLPTDISPLVQWVYDPTTDGDIDGIAAAREKSDADLEREKQKAGVFQIKNPNLRAGATIHDWLGRSLGNVDTDEQKANAAVRDIKETLEVILVQRTSAGNCLLDGRRLENVAPQEIAQQVIRLPAAITPDINQAIQDLETLTGRYFGDWQTSTWLKGALALPMDEALTTTFAGWRLAYTAKLGLSYVKDDDGG
>NZ_CP021456.1|WP_110139243.1|119262_120957_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDNRQFNLTTDPWIKVITVNDNQEQMVSLIDLFTHAQDYRQLAGDMRSQNLAILRLLLAILTTVYSRFDATGEAYSWLKTSGASPQDLEVDDDEFTKDDSTEDLLETWQQLNQAGHFTQSVIRYLEFFADRFDFFGARPFYQVTTADYDALVPKNKAIAAGKGKVAVKQLNRRISESNHTPAIFAPKTGAAKNDISLDELIRWIITYQNFTGVTDKTKIVTEESFSNAAGWLYRLNPVFAQGETLFTTLMLNLVLSDSRNDYACPKPVWEYATVSDYIAERKREILPDNLPEIYTAWSRILHIEWDENQRPTIFSAGIPMFSSDSAFIEPMTTWRFDKKTNAYRPAVKGLRSLGIAMWRNFGAYINVHRADDRQEPELVVWLRTLKEQNLLAHNHPLVLNSVALISDGNATSQAPAVEVGDDMQMQADVLFDSERRDYWPARIEEAIDFTQTVGDDYYHFAKDIAQIRNVDGRLFAGQMSAKFYERLNTPFKMWLEGLTSQDDRDEKIMAWKTQLKMLTVAAIDEELQASSPRDMRGVSGKTGPLNIFTAKSHLMYNLRLHLDL
>NZ_CP021456.1|WP_110139244.1|120973_121585_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MAYEIEQITNKIILRELYHNGHPNKAVLAGLRNAATLTSQRAQIVWPLLMPYLNDQQLSRDGTPTYAETAIYTAIRFYAIHQQGTEASVYGVAGGDKADGRQFFSALAVMRGNADTRVALDRRVQPLLATTNVASVINSLSHLVSILKANNRTQKIDYAWLAQDLYNLQLSYEQANRVRLRWGQQYFRATSTSLKKEGEKNHD
>NZ_CP021456.1|WP_110139245.1|121577_122648_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTKTNLYIDLNVLQTVPSSNINRDDTGAPKTALYGGVTRARVSSQSWKNAMRSAFKDEHVAGTRTKSAASLLATALQAHDTALDEDSALSKTAEVFKAAGIKLDKNNETGALLLISQGQINKLAEYAINNPELDKKEIKKVLKGDQSLDLALFGRMVADNPELNVEAASQVAHAVSTHEVVPEYDYYTALDDMQADDSTGAAMLGTIDFNSATLYRYANINVRELIANLNEHDAIEGIKTFIKEFLLSMPTGKQNAFANKTLPSYVMVTLRTDTPVNLVSAFEEPVTSHNGYVAPSIQRLEDEYQSTSDFVEKPTANFVLSKTASQVGEQVTNLDDLVEKVAAALTKAVQDENTND
>NZ_CP021456.1|WP_110139246.1|122628_123330_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTLTIKLTAPLQSYGNAATFERRTTNTYPSKSAVIGMIAAALGYQRTDSRIVTLNELSFAVRIDQVGRHLADFQTVEWKKNVRKVTYRDYLQDAVFVVAIGSENDPLINNIEWALRHPRFQLFLGRRANVPAGVLQLQEFADATPITVLQKMTWQAAPWYRRRHQRPVLDILADADLLAGHQSILVSDRVVSFDQRNRQYGLRAMAKTKVKLTSLDSTEDESETQHDAMKFL
>NZ_CP021456.1|WP_110139247.1|123342_124014_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDVKNRYKTKELTHLGAFHNWVEQSFPAEVAAGKRPRHLWRIDQLAGKKYLLVLSEAAPDLEQLTQYGVPKTAVTKPYDRWLESIHEGQILRFRLTANPTRSISRPGARQGRIVPHITVDQQRKWLIDRADGLGFQLVEQQVVTGDEPRLAFDIVGREWPVLRRKAGRDVRLSRVTFEGLLRVADVPEFRRALTKGIGREKAFGMGLMTVIPAGER
>NZ_CP021456.1|WP_110139248.1|124010_124964_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MTKKVGAEKPTRYELGRVRDRITFLYLEHAKLNRQNSAIQVIDQRGVVYVPAAILSVLMLGPGVDVTHRAMELIGESGLGVVWVGERGVRQYAYGRPMSHSSALLEAQAKLVSNRRSRIMVARQMYQMRFPDDDVSQLTMQELRGKEGARVRRVYLEQSQKTGVAWSRREYNPDDFEAGTPINKALTAAHQALYGLSYSVIAALGASAGLGFVHTGHDLSFVYDFADLYKAEFSIPTAFKVTAKFEHDPDIATRTRQAMRDSFVDGKLLVRMVKNLKTLLGMPAVDGEAESISLWDDRLGLQKFGVQYHEQQGDDGQ
>NZ_CP021456.1|WP_110139249.1|124960_125848_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLTNVPKSLKGDLTKWYQEIQTNVYVGNVSARIRDQLWHRIMENIGHGEATMVYNSNNELGYQFRTTRKDREVVNFDGLPLMRHLNVATGPVNHGFSDAAKFHRAKLMTRTRASRQPVAKPAMVALDLETTGLDLVKDDIISIGAVKRVPGQPEDFFDSLIKAERAIPENITTLTGLTAEMLVTQGISLSAGLQELREFVGSLPIVGYNLRFDEMFLTSGFRTINQPELTNRMIDLLPMMKKTDKFLDNYRLQTVLAKFDIVNQEPHHALADAKATFALADKLIENRVLKI
>NZ_CP021456.1|WP_110139250.1|126925_127564_+|carbonic-anhydrase-family-protein
MSILNYAEQASWSNGFGSQQSPIDLRQAKPTSVTNFVVTDPWIADREIDDQVTIQLAGHGTTRINEMTWHFVQAHIHVPAEHITTEETVAELHFVHQSVIGALCVVAVLVPIGKANPIIDRILDHFQPHATESIDCDLTGLLPNRGTVFQYLGSLTTPPLTEGVTWYVIEQTDITISSEQLKRYKQLFGPNNRQVQATNQRPVLRGSGTFTK
>NZ_CP021456.1|WP_110139251.1|127725_128889_-|hypothetical-protein
MLKTWLKAAIILALSVSSIFGLTSANAQSTYQISTVKDVTPTPYYVANYKKTLYAWDKTHTKRITVLNQLPGVSWYATQKVTIIHGHQTTTYLHIASEYGLDYGYVPAKDMRKGFDPTDDEKPAYHPTTSTTGSQIPVKRVSEKAFSKVIPSLTKNTYYQTTKKLTVKMPFSVYISGTINEPITLPVGTVVAGNRSRTEMTIASSYLSQNLLKAGYQQNLWTDNGESYTPNPMAFKAIPRPAYLPKNGSHGDLYLGGVNALRNQYNALSKQSIQLTTNGYVEVHQNNPQDRAIAYTAQPTTSVKIKRTQIKGHTRYLYLAKNLNGFKTTKVRYHGTTQYRLAFVNQQKTYSITFENDDDFVEPSYYGLMSFGGKTFYTPYGTIPNDN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021456_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021456_2

125878-126638

TypeI-E

I-B,III-A,III-B

Consensus_repeat	Method
GTATTCCCCACGTGTGTGGGGGTGATCC	PILER-CR
GTATTCCCCACGTGTGTGGGGGTGATCC	CRISPRCasFinder
GTATTCCCCACGTGTGTGGGGGTGATCCT	CRT

12 spacers

DEDDh,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of NZ_CP021456_2

>merge|NZ_CP021456|2|125878-126638|PILER-CR,CRISPRCasFinder,CRT
GTATTCCCCACGTGTGTGGGGGTGATCCTAAGCCCCACTACGTCGATTTACCGTTGACAGAGTATTCCCCACGTGTGTGGGGGTGATCCTGCCTAGTTTTTTGTTTAGAAACTCATCAACATGTATTCCCCACGTGTGTGGGGGTGATCCTATTTTGAGTATCAGTTTCTTCAGGAGAACCTTGTATTCCCCACGTGTGTGGGGGTGATCCTATTGTGCAAGTCATATACATGAAAACCAAAACGTATTCCCCACGTGTGTGGGGGTGATCCTAAATCAAGTTATGAACGAAACGCTAATCTTAAGTATTCCCCACGTGTGTGGGGGTGATCCTCTTCCGGAACCAAATCCTTCCAACTTAAGATCGTATTCCCCACGTGTGTGGGGGTGATCCTTTATGCCAACTTTCTGCCACACTTAGGGCAATGTATTCCCCACGTGTGTGGGGGTGATCCCTAATCAAGAACTACTTTGCAATGGGGCTTTACGTATTCCCCACGTGTGTGGGGGTGATCCTCACTTGCTGATTCGACCTGCCGTCGGAGGGCGGTATTCCCCACGTGTGTGGGGGTGATCCCGCCGTCACTGGTCATCATCTCCTAAATTGGTTGTATTCCCCACGTGTGTGGGGGTGATCCTCGTAAAGGGCGTAAAGAGGCCGACACGGTGCAGTATTCCCCACGTGTGTGGGGGTGATCCCTAAAATCCGATCATTTTCGGCCATCAATCACAGTATTCCCCACGTGTGTGGGGGTAATGGT

>NZ_CP021456|2|1|125878-126576|PILER-CR
GTATTCCCCACGTGTGTGGGGGTGATCC	TAAGCCCCACTACGTCGATTTACCGTTGACAGA
GTATTCCCCACGTGTGTGGGGGTGATCC	TGCCTAGTTTTTTGTTTAGAAACTCATCAACAT
GTATTCCCCACGTGTGTGGGGGTGATCC	TATTTTGAGTATCAGTTTCTTCAGGAGAACCTT
GTATTCCCCACGTGTGTGGGGGTGATCC	TATTGTGCAAGTCATATACATGAAAACCAAAAC
GTATTCCCCACGTGTGTGGGGGTGATCC	TAAATCAAGTTATGAACGAAACGCTAATCTTAA
GTATTCCCCACGTGTGTGGGGGTGATCC	TCTTCCGGAACCAAATCCTTCCAACTTAAGATC
GTATTCCCCACGTGTGTGGGGGTGATCC	TTTATGCCAACTTTCTGCCACACTTAGGGCAAT
GTATTCCCCACGTGTGTGGGGGTGATCC	CTAATCAAGAACTACTTTGCAATGGGGCTTTAC
GTATTCCCCACGTGTGTGGGGGTGATCC	TCACTTGCTGATTCGACCTGCCGTCGGAGGGCG
GTATTCCCCACGTGTGTGGGGGTGATCC	CGCCGTCACTGGTCATCATCTCCTAAATTGGTT
GTATTCCCCACGTGTGTGGGGGTGATCC	TCGTAAAGGGCGTAAAGAGGCCGACACGGTGCA
GTATTCCCCACGTGTGTGGGGGTGATCC

>NZ_CP021456|2|2|125878-126637|CRISPRCasFinder
GTATTCCCCACGTGTGTGGGGGTGATCC	TAAGCCCCACTACGTCGATTTACCGTTGACAGA
GTATTCCCCACGTGTGTGGGGGTGATCC	TGCCTAGTTTTTTGTTTAGAAACTCATCAACAT
GTATTCCCCACGTGTGTGGGGGTGATCC	TATTTTGAGTATCAGTTTCTTCAGGAGAACCTT
GTATTCCCCACGTGTGTGGGGGTGATCC	TATTGTGCAAGTCATATACATGAAAACCAAAAC
GTATTCCCCACGTGTGTGGGGGTGATCC	TAAATCAAGTTATGAACGAAACGCTAATCTTAA
GTATTCCCCACGTGTGTGGGGGTGATCC	TCTTCCGGAACCAAATCCTTCCAACTTAAGATC
GTATTCCCCACGTGTGTGGGGGTGATCC	TTTATGCCAACTTTCTGCCACACTTAGGGCAAT
GTATTCCCCACGTGTGTGGGGGTGATCC	CTAATCAAGAACTACTTTGCAATGGGGCTTTAC
GTATTCCCCACGTGTGTGGGGGTGATCC	TCACTTGCTGATTCGACCTGCCGTCGGAGGGCG
GTATTCCCCACGTGTGTGGGGGTGATCC	CGCCGTCACTGGTCATCATCTCCTAAATTGGTT
GTATTCCCCACGTGTGTGGGGGTGATCC	TCGTAAAGGGCGTAAAGAGGCCGACACGGTGCA
GTATTCCCCACGTGTGTGGGGGTGATCC	CTAAAATCCGATCATTTTCGGCCATCAATCACA
GTATTCCCCACGTGTGTGGGGGTAATGG

>NZ_CP021456|2|2|125878-126638|CRT
GTATTCCCCACGTGTGTGGGGGTGATCCT	AAGCCCCACTACGTCGATTTACCGTTGACAGA
GTATTCCCCACGTGTGTGGGGGTGATCCT	GCCTAGTTTTTTGTTTAGAAACTCATCAACAT
GTATTCCCCACGTGTGTGGGGGTGATCCT	ATTTTGAGTATCAGTTTCTTCAGGAGAACCTT
GTATTCCCCACGTGTGTGGGGGTGATCCT	ATTGTGCAAGTCATATACATGAAAACCAAAAC
GTATTCCCCACGTGTGTGGGGGTGATCCT	AAATCAAGTTATGAACGAAACGCTAATCTTAA
GTATTCCCCACGTGTGTGGGGGTGATCCT	CTTCCGGAACCAAATCCTTCCAACTTAAGATC
GTATTCCCCACGTGTGTGGGGGTGATCCT	TTATGCCAACTTTCTGCCACACTTAGGGCAAT
GTATTCCCCACGTGTGTGGGGGTGATCCC	TAATCAAGAACTACTTTGCAATGGGGCTTTAC
GTATTCCCCACGTGTGTGGGGGTGATCCT	CACTTGCTGATTCGACCTGCCGTCGGAGGGCG
GTATTCCCCACGTGTGTGGGGGTGATCCC	GCCGTCACTGGTCATCATCTCCTAAATTGGTT
GTATTCCCCACGTGTGTGGGGGTGATCCT	CGTAAAGGGCGTAAAGAGGCCGACACGGTGCA
GTATTCCCCACGTGTGTGGGGGTGATCCC	TAAAATCCGATCATTTTCGGCCATCAATCACA
GTATTCCCCACGTGTGTGGGGGTAATGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021456.1\|WP_110139252.1\|129143_130271_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139243.1\|119262_120957_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP021456.1\|WP_110139247.1\|123342_124014_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NZ_CP021456.1\|WP_110139245.1\|121577_122648_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP021456.1\|WP_110139250.1\|126925_127564_+\|carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|239398
NZ_CP021456.1\|WP_110139255.1\|136576_137818_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP021456.1\|WP_110139242.1\|116498_119270_+\|CRISPR-associated-helicase-Cas3'	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP021456.1\|WP_110139256.1\|138287_139499_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP021456.1\|WP_065200998.1\|139725_141681_+\|TetM/TetW/TetO/TetS-family-tetracycline-resistance-ribosomal-protection-protein	unknown	unknown	gnl\|CDD\|223556
NZ_CP021456.1\|WP_110139251.1\|127725_128889_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139244.1\|120973_121585_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP021456.1\|WP_110139254.1\|134431_136459_+\|right-handed-parallel-beta-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|379079
NZ_CP021456.1\|WP_110139241.1\|114301_115468_-\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|378274
NZ_CP021456.1\|WP_087716457.1\|132544_132961_-\|Zn-Finger-Containing-protein	unknown	unknown	gnl\|CDD\|370440
NZ_CP021456.1\|WP_110140029.1\|137891_138221_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139249.1\|124960_125848_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP021456.1\|WP_180932631.1\|130447_131065_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP021456.1\|WP_110139240.1\|113957_114161_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224393
NZ_CP021456.1\|WP_110139248.1\|124010_124964_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP021456.1\|WP_110139246.1\|122628_123330_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776

Protein	Function_ID	Function_description	E-value
NZ_CP021456.1\|WP_110139243.1\|119262_120957_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.5478e-80
NZ_CP021456.1\|WP_110139247.1\|123342_124014_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	5.44073e-69
NZ_CP021456.1\|WP_110139245.1\|121577_122648_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.96169e-151
NZ_CP021456.1\|WP_110139250.1\|126925_127564_+\|carbonic-anhydrase-family-protein	gnl\|CDD\|239398	cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This sub-family includes bacterial carbonic anhydrase alpha, as well as plant enzymes such as tobacco nectarin III and yam dioscorin and, carbonic anhydrases from molluscs, such as nacrein, which are part of the organic matrix layer in shells. Other members of this family may be involved in maintaining pH balance, in facilitating transport of carbon dioxide or carbonic acid, or in sensing carbon dioxide levels in the environment. Dioscorin is the major storage protein of yam tubers and may play a role as an antioxidant. Tobacco Nectarin may play a role in the maintenace of pH and oxidative balance in nectar. Mollusc nacrein may participate in calcium carbonate crystal formation of the nacreous layer. This subfamily also includes three alpha carbonic anhydrases from Chlamydomonas reinhardtii (CAH 1-3). CAHs1-2 are localized in the periplasmic space. CAH1 faciliates the movement of carbon dioxide across the plasma membrane when the medium is alkaline. CAH3 is localized to the thylakoid lumen and provides CO2 to Rubisco.	3.12453e-47
NZ_CP021456.1\|WP_110139255.1\|136576_137818_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.01931e-17
NZ_CP021456.1\|WP_110139242.1\|116498_119270_+\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.0719e-80
NZ_CP021456.1\|WP_110139256.1\|138287_139499_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	4.03421e-121
NZ_CP021456.1\|WP_110139244.1\|120973_121585_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.18039e-28
NZ_CP021456.1\|WP_110139254.1\|134431_136459_+\|right-handed-parallel-beta-helix-repeat-containing-protein	gnl\|CDD\|379079	pfam13229, Beta_helix, Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.	6.59313e-07
NZ_CP021456.1\|WP_110139241.1\|114301_115468_-\|DUF2075-domain-containing-protein	gnl\|CDD\|378274	pfam09848, DUF2075, Uncharacterized conserved protein (DUF2075). This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.	5.67874e-127
NZ_CP021456.1\|WP_087716457.1\|132544_132961_-\|Zn-Finger-Containing-protein	gnl\|CDD\|370440	pfam09332, Mcm10, Mcm10 replication factor. Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha.	0.00236381
NZ_CP021456.1\|WP_065200998.1\|139725_141681_+\|TetM/TetW/TetO/TetS-family-tetracycline-resistance-ribosomal-protection-protein	gnl\|CDD\|223556	COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis].	5.81571e-116
NZ_CP021456.1\|WP_110139249.1\|124960_125848_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	2.65118e-40
NZ_CP021456.1\|WP_180932631.1\|130447_131065_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.28724e-88
NZ_CP021456.1\|WP_110139240.1\|113957_114161_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	7.10536e-22
NZ_CP021456.1\|WP_110139248.1\|124010_124964_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.88365e-128
NZ_CP021456.1\|WP_110139246.1\|122628_123330_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	2.4073e-46

>NZ_CP021456.1|WP_110139249.1|124960_125848_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLTNVPKSLKGDLTKWYQEIQTNVYVGNVSARIRDQLWHRIMENIGHGEATMVYNSNNELGYQFRTTRKDREVVNFDGLPLMRHLNVATGPVNHGFSDAAKFHRAKLMTRTRASRQPVAKPAMVALDLETTGLDLVKDDIISIGAVKRVPGQPEDFFDSLIKAERAIPENITTLTGLTAEMLVTQGISLSAGLQELREFVGSLPIVGYNLRFDEMFLTSGFRTINQPELTNRMIDLLPMMKKTDKFLDNYRLQTVLAKFDIVNQEPHHALADAKATFALADKLIENRVLKI
>NZ_CP021456.1|WP_110139248.1|124010_124964_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MTKKVGAEKPTRYELGRVRDRITFLYLEHAKLNRQNSAIQVIDQRGVVYVPAAILSVLMLGPGVDVTHRAMELIGESGLGVVWVGERGVRQYAYGRPMSHSSALLEAQAKLVSNRRSRIMVARQMYQMRFPDDDVSQLTMQELRGKEGARVRRVYLEQSQKTGVAWSRREYNPDDFEAGTPINKALTAAHQALYGLSYSVIAALGASAGLGFVHTGHDLSFVYDFADLYKAEFSIPTAFKVTAKFEHDPDIATRTRQAMRDSFVDGKLLVRMVKNLKTLLGMPAVDGEAESISLWDDRLGLQKFGVQYHEQQGDDGQ
>NZ_CP021456.1|WP_110139247.1|123342_124014_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDVKNRYKTKELTHLGAFHNWVEQSFPAEVAAGKRPRHLWRIDQLAGKKYLLVLSEAAPDLEQLTQYGVPKTAVTKPYDRWLESIHEGQILRFRLTANPTRSISRPGARQGRIVPHITVDQQRKWLIDRADGLGFQLVEQQVVTGDEPRLAFDIVGREWPVLRRKAGRDVRLSRVTFEGLLRVADVPEFRRALTKGIGREKAFGMGLMTVIPAGER
>NZ_CP021456.1|WP_110139246.1|122628_123330_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTLTIKLTAPLQSYGNAATFERRTTNTYPSKSAVIGMIAAALGYQRTDSRIVTLNELSFAVRIDQVGRHLADFQTVEWKKNVRKVTYRDYLQDAVFVVAIGSENDPLINNIEWALRHPRFQLFLGRRANVPAGVLQLQEFADATPITVLQKMTWQAAPWYRRRHQRPVLDILADADLLAGHQSILVSDRVVSFDQRNRQYGLRAMAKTKVKLTSLDSTEDESETQHDAMKFL
>NZ_CP021456.1|WP_110139245.1|121577_122648_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTKTNLYIDLNVLQTVPSSNINRDDTGAPKTALYGGVTRARVSSQSWKNAMRSAFKDEHVAGTRTKSAASLLATALQAHDTALDEDSALSKTAEVFKAAGIKLDKNNETGALLLISQGQINKLAEYAINNPELDKKEIKKVLKGDQSLDLALFGRMVADNPELNVEAASQVAHAVSTHEVVPEYDYYTALDDMQADDSTGAAMLGTIDFNSATLYRYANINVRELIANLNEHDAIEGIKTFIKEFLLSMPTGKQNAFANKTLPSYVMVTLRTDTPVNLVSAFEEPVTSHNGYVAPSIQRLEDEYQSTSDFVEKPTANFVLSKTASQVGEQVTNLDDLVEKVAAALTKAVQDENTND
>NZ_CP021456.1|WP_110139244.1|120973_121585_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MAYEIEQITNKIILRELYHNGHPNKAVLAGLRNAATLTSQRAQIVWPLLMPYLNDQQLSRDGTPTYAETAIYTAIRFYAIHQQGTEASVYGVAGGDKADGRQFFSALAVMRGNADTRVALDRRVQPLLATTNVASVINSLSHLVSILKANNRTQKIDYAWLAQDLYNLQLSYEQANRVRLRWGQQYFRATSTSLKKEGEKNHD
>NZ_CP021456.1|WP_110139243.1|119262_120957_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDNRQFNLTTDPWIKVITVNDNQEQMVSLIDLFTHAQDYRQLAGDMRSQNLAILRLLLAILTTVYSRFDATGEAYSWLKTSGASPQDLEVDDDEFTKDDSTEDLLETWQQLNQAGHFTQSVIRYLEFFADRFDFFGARPFYQVTTADYDALVPKNKAIAAGKGKVAVKQLNRRISESNHTPAIFAPKTGAAKNDISLDELIRWIITYQNFTGVTDKTKIVTEESFSNAAGWLYRLNPVFAQGETLFTTLMLNLVLSDSRNDYACPKPVWEYATVSDYIAERKREILPDNLPEIYTAWSRILHIEWDENQRPTIFSAGIPMFSSDSAFIEPMTTWRFDKKTNAYRPAVKGLRSLGIAMWRNFGAYINVHRADDRQEPELVVWLRTLKEQNLLAHNHPLVLNSVALISDGNATSQAPAVEVGDDMQMQADVLFDSERRDYWPARIEEAIDFTQTVGDDYYHFAKDIAQIRNVDGRLFAGQMSAKFYERLNTPFKMWLEGLTSQDDRDEKIMAWKTQLKMLTVAAIDEELQASSPRDMRGVSGKTGPLNIFTAKSHLMYNLRLHLDL
>NZ_CP021456.1|WP_110139242.1|116498_119270_+|CRISPR-associated-helicase-Cas3'
MEVSKSVAALWAKKSSTDTQQYWLPLISHLIDARNTINWLFNHWLSDGQRQLLMGTLSEEQTQQLVKFVGFVHDLGKATPAFQMKQSYDRDADLDEQLKARLTHGGFLKLNDLCLASAKQSPHARAGEAILENFGVPASIGAIIGGHHGKPESSQPYGQLQDYTANYFQSDNQSELQQPWKQVHRELFEYGLASSGYQEVTEIPDIQQPQAVILEGLLIMADWLASSEYLDQDQTIPLFPLISLDQSWQDIDPTARFQQAINAWDLGGEWHPQQLSSADPYKERWGFSARPVQRTMTAAIQDTLDPGMVIVEAPMGLGKTEIALVAAEQLAFQTGRDGLFMGLPTQATTNAMFDRVTEWLAFLAQSQGEDFPIKLMHGKAQFNQTYRQLPNAANIYATENDIEDEKENETGAVVVNSWFSGKKSILTKFTVGTIDHLLLMGLKQKHLFLRHLGLSGKVVVIDEVHAYDAYMGQYLRKALSWLGAYHVPVVILSATLPKDKRNALIKAYLRGKYGSKFKKQLQAPTDWENAQAYPLLSIVDGCQIKQITEFPGKSDQQPMGITVQRIDSEDADLIAQVVDKISDGGVAGIIVNTVKRAQQLAQLVPHDVKLMVLHSAFLATDRARQEQALQAAIGKNGTRPERLIVIGTQVLEQSLDIDFDVLYTDIAPMDLVLQRIGRLHRHQIERPVALQTPQVFLMGIQAGHEYGDGNEAVYGKYLLMKTDAFMPNQLTLPTDISPLVQWVYDPTTDGDIDGIAAAREKSDADLEREKQKAGVFQIKNPNLRAGATIHDWLGRSLGNVDTDEQKANAAVRDIKETLEVILVQRTSAGNCLLDGRRLENVAPQEIAQQVIRLPAAITPDINQAIQDLETLTGRYFGDWQTSTWLKGALALPMDEALTTTFAGWRLAYTAKLGLSYVKDDDGG
>NZ_CP021456.1|WP_110139241.1|114301_115468_-|DUF2075-domain-containing-protein
MNKILQEQFFVDDLSDDQKAVITDMNHYIKDSLNGQESAVAIIQGAAGTGKSVVLMELVRQYMTDKRYRTSLVVNHPELYKAYQDLAESIPNMKASAIRRPTSLINYAQKNHKQYDIIFVDEAHLLYSKSEPYAHYRGQNQLTDLMNLAKVVVVVYDFDQVFQSKMYWDQDLLYQTIGHHPHKRFDMNFQYRMVASDEQVAWMDDLAAEKPLRSFPENSDFEFKMFDTAGELFENIKKRNKEVGMSRVVATSGFPRIDGRHNVEMDSFSLPWDEWDPQRTHWAKREGSITQVGTIYTLQGFDLNYVGMIIGPSFGYDPQTDTMTIIPEKYSHKEIFKKRKDMQFSRNEYKTFIANVLNVLMKRGKYGLYLTAYDDALRARLLELENHQ
>NZ_CP021456.1|WP_110139240.1|113957_114161_-|helix-turn-helix-transcriptional-regulator
MKNTIATRRKQRKLSQAELAQLTAVTRQTINAIENNKYDPSLSLAFKLAAILETTVDALFNNGEDVK
>NZ_CP021456.1|WP_110139250.1|126925_127564_+|carbonic-anhydrase-family-protein
MSILNYAEQASWSNGFGSQQSPIDLRQAKPTSVTNFVVTDPWIADREIDDQVTIQLAGHGTTRINEMTWHFVQAHIHVPAEHITTEETVAELHFVHQSVIGALCVVAVLVPIGKANPIIDRILDHFQPHATESIDCDLTGLLPNRGTVFQYLGSLTTPPLTEGVTWYVIEQTDITISSEQLKRYKQLFGPNNRQVQATNQRPVLRGSGTFTK
>NZ_CP021456.1|WP_110139251.1|127725_128889_-|hypothetical-protein
MLKTWLKAAIILALSVSSIFGLTSANAQSTYQISTVKDVTPTPYYVANYKKTLYAWDKTHTKRITVLNQLPGVSWYATQKVTIIHGHQTTTYLHIASEYGLDYGYVPAKDMRKGFDPTDDEKPAYHPTTSTTGSQIPVKRVSEKAFSKVIPSLTKNTYYQTTKKLTVKMPFSVYISGTINEPITLPVGTVVAGNRSRTEMTIASSYLSQNLLKAGYQQNLWTDNGESYTPNPMAFKAIPRPAYLPKNGSHGDLYLGGVNALRNQYNALSKQSIQLTTNGYVEVHQNNPQDRAIAYTAQPTTSVKIKRTQIKGHTRYLYLAKNLNGFKTTKVRYHGTTQYRLAFVNQQKTYSITFENDDDFVEPSYYGLMSFGGKTFYTPYGTIPNDN
>NZ_CP021456.1|WP_110139252.1|129143_130271_+|hypothetical-protein
MKVVRTISKVLLVGALALVGIGSLKGQAAQVKTSHALANYNVKAVKLIKNKDYFVTRPGTYATSSTYRSQGTFQATPDIYQSVRGHSAFLRTALYLPVTVHHSGDWSDPQAVVVTPNGKTAYIAYLKASNTTTGWIVRYDLAKLVQALGGYTSRMDALRRATNAYSKHKATSRDRSLLKYIKEGPTFDIGHGQSLAYNPKAKQLWFTRSNGKAGQYGSAVKVSSKTLRPTKQVAYRLVNKQGAKLAVNSTLAFDRQGYAYFSSYSGRRSLRVYRGTMNAHGVHFKLMMQGLAYRPGQTHQAIAYNPHNDRLYFVSDDAISSVPVKKLRQRQATSKDVHASVFASQREFEGLSFTAAGQGYLILNRGAELMRIDIS
>NZ_CP021456.1|WP_180932631.1|130447_131065_+|sugar-O-acetyltransferase
MGNLEKMHTGDLYLPDDPAIEKDQQHYLDRLYDYNHTRPSDSAQKQAILHELFAEIGVNCYVETPFHANFGGHHVHFGNNVYANFNLTLVDDTHIYVGDHTMIGPNVTIATAGHPITPDLRAKNYQYNMPVHIGKNCWLGAGVIVLPGITIGDNVVIGAGSIVTKDLPDNVVAVGNPCHVLRPVNEHDREFYFKDRRIDPALFKS
>NZ_CP021456.1|WP_087716457.1|132544_132961_-|Zn-Finger-Containing-protein
MKPNSKFLRRLQTWMIGRYGQNDSLNRFLTYLTFLLLILNLFIHTLWLAVAVIVIISLTYWRLFSRKIYRQVRLNRAFERVWLPITRPFRRLRYQVSQHWHYRFFHCAQCQQRIRVPRHHGRVQVTCPKCHHSFITRT
>NZ_CP021456.1|WP_110139254.1|134431_136459_+|right-handed-parallel-beta-helix-repeat-containing-protein
MKIYVDAAAVRDGSGRENAPFKHINDAAKVAQPGDEVLVAPGTYREYVNPVHRGTDTDRITYRSVQPLKAVITGAEVLKNWQPYQGQVWVSRVANSIFGDYNPYTTFVMGDWYFGPVDKHTGAVYMNDQQFYETTSLADCLEAPIYARSWERDKSIYKWYTEQDTATDETVIYANFQGQNPNQEMVEINVRRNVFMPQENGIDNITVSGFNVNKAATTWAPPASYQDGMIGPHWSKGWIIEDCDISHSRCAGISLGKYRDPVNDQYFTYKHVKSPTQMERDAVCRGQYHGWLKENIGHHIIRRCNIHHCEQDGIVGRQGGVFSLIEDNHIHDINNMQELAGAEIAGIKMHAAIDVIIRRNHINDCTMGIWTDWEAQGTRITQNLLDHNYAPTGTAERIVGAMQSQDIFVEVGHGPTLIDNNLLLSKASLRLATEGVACVHNLMLGSITSIGANTDFFVDGKNQPRYTPYHIQHRTEVAGFMTILHGDDRFYNNIFVQNWSVEKAGSETVVDRAPEDTEQVGTNGFDDYPTYAEWQAQFQALDGTIAKETDMNDLMSAHFGHLPVWAAGNVYFNGAKAWKKETDNVVNTQDQVTIELVDNEGQTSLRTNLYDFLTPHDGVITTTTLGEAFEPEQRYEMPDGSDITFDEDYFGNHRDIAPLPGPFASKTAASAMLWR
>NZ_CP021456.1|WP_110139255.1|136576_137818_+|MFS-transporter
MENEDKVTHKSQFPYRLGFGILFGLLGWLVPYLGVNSTLLPAKIQQIAPTQKVQIVALLATIAMVVATIANIIEGALSDRTVSRWGKRNPWILFGMLSTVICFYFLTRVTTITGIIINWSLFQVALNMMVAPLVAFIADKAPKKYRGSISAFYGVGMNIGTPVGTMIASRYITNVNHGIYLFMVFEVIFTLIGLALVGDGSNQGEKVEKLHGSELFEAFSFPIHGDIRDFYLAVFGKLLFVSAQFVITGYQLYIFTDYMKLSATSATQNLSVMSLILLVAGVSFAVIGGPLADKFHSLKLLVALSTVAMGIGVAIPALDPAPWTMFVYAGLSGAAMGMYNSVDQALNVTVLPNPNSAAKDLGIVNLANSLGQVFGPIVASMIIGFSGYRLMFPMAGVMCLVGAALILMIRKVH
>NZ_CP021456.1|WP_110140029.1|137891_138221_+|hypothetical-protein
MIELEGFPVIQGREAVAHEWMNFLQDHQAAVIETLPAEHMRVESLFSTTINGRLYLFWYSLQSAKGADVSTSTSWVDQQHVAYWRQCIDEGQPSLKMKLENHFESTIAH
>NZ_CP021456.1|WP_110139256.1|138287_139499_-|PLP-dependent-aminotransferase-family-protein
MNDLFAQRVNPDVSSALAGLFPQDPNPTAVTFAAGSPNEQLFPVKEVQAAFNTAIDTQGAHLFQYQSAQGNSALREKLVTRIAKWGNVTTTADNILLTVGGQQGVELVAKTLLDPGDDIIVEVPTYIGALAAFDLYQPHYHAVPLQADGLDLDVLETTLQQHPNVKLLYTVPDYHNPTGITMSVAKRQQLVALANRYHFIILEDTPYRDLGYEGAPLPAIKSFDTEGRVIFLSSFSKILMPALRTGWLIADGELRDAILKMRLASDLETTGVTHAAINAYLDANDLDAHIQRMTTHYKQQRDAMLQSLTHYFPDEALFTHPAGGFFDWVTLPQGIDTGRLMLDVISPQAHVTYVPATNFYPQRDVHNALRLSFSGVNPTQIDAGMHRLGDQLKNAVHAAYPVF
>NZ_CP021456.1|WP_065200998.1|139725_141681_+|TetM/TetW/TetO/TetS-family-tetracycline-resistance-ribosomal-protection-protein
MKSITAGIVAHVDAGKTTLSEAMLYQAGAVRQLGRVDNGDAFLDPDALEKQRGITIFSHQARLTYQDLALTLLDTPGHVDFASQTEQVLSVLDYAVLVISATDGVQGYTRTLWRLLARYHVPTLIFVNKMDAPGADQAALLTQLQTELSPGCIAFDGAQVSAAASEDIAMLDESVLADFLDSGQLSATVIRRMIDQRQVFPCYFGAALKMTGVTELLAGLQQWTTPSETTRDFGARVFKISHDQGERLTWLRVTGGDLQPKQVLLEEQKVNQLRVYNGVKYTVQPQILAGDVCAIPGLTGTYPGQGLGNVPDSAAPVMQPVLNYALDPQGQDLHACLAALRELEDEDPQLHVSWSSHLQELRVQLMGTVQLEILQQLLQDRFNLTVHFGAGRILYKETLTKAVEGVGHFEPLRHYAEVHLLMEPAPRGSGLTFAADCSLEVLGRNWQHQVLTNLRAKEQLGILTGSPLTDVKITLVTGRASIVHSVGGDFREATWRAVRQGLMMRQDDGCQLLEPWYRFRLEVGQEQVGRAMTDVQRMHGSLDAAVDPTTSRGNLTTLTGVAPVSEMQDYAQAVQAYTHGQGQLECLIDGYRPCHNAAEIIAQQQYAPVADLENTPDSVFCAHGAGYPVAWDQVPTMAHVPYVYSDTDLPQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021456_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021456_3

1238322-1238841

Orphan

I-E,II-B

Consensus_repeat	Method
GTATTCCCCACAGGTGTGGGGGTGATCCT	PILER-CR
GTATTCCCCACAGGTGTGGGGGTGATCC	CRISPRCasFinder
GTATTCCCCACAGGTGTGGGGGTGATCC	CRT
TGTATTCCCCACAGGTGTGGGGGTGATCCTAT	PILER-CR

8 spacers

csa3

The CRISPR arrays of NZ_CP021456_3

>merge|NZ_CP021456|3|1238322-1238841|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GTATTCCCCACAGGTGTGGGGGTGATCCCTAGCTGTAATTGCGCGTCCAATGTGCTTCCTTGTATTCCCCACAGGTGTGGGGGTGATCCTATCCACACCACCGTATGAACGAGAGTGTACAAGTATTCCCCACAGGTGTGGGGGTGATCCTACTTCATGATCAACAGGACCGTCCTTTTTAACGTATTCCCCACAGGTGTGGGGGTGATCCTGAGAAAAACGTTAACTCAGTCTTTTACCATGAGTATTCCCCACAGGTGTGGGGGTGATCCCGGCTGTACCTGAACCCCATTAAGCTGTTCGGTGTATTCCCCACAGGTGTGGGGGTGATCCTATAACCTCCCATAATGTATTTGTTACAACAGTGTATTCCCCACAGGTGTGGGGGTGATCCTATCTATTCCAACCTCAACGATTCCAGAAACTTGTATTCCCCACAGGTGTGGGGGTGATCCGGCTGCCATCATTTCCTTGTTTCTGACCATTTTGGTATTCCCCACAGGTGTGGGGGTGATCCTGT

>NZ_CP021456|3|2|1238322-1238533|PILER-CR
GTATTCCCCACAGGTGTGGGGGTGATCCC	TAGCTGTAATTGCGCGTCCAATGTGCTTCCTT
GTATTCCCCACAGGTGTGGGGGTGATCCT	ATCCACACCACCGTATGAACGAGAGTGTACAA
GTATTCCCCACAGGTGTGGGGGTGATCCT	ACTTCATGATCAACAGGACCGTCCTTTTTAAC
GTATTCCCCACAGGTGTGGGGGTGATCCTGAGAAAAACGTTAACTCAGTCTTTTACCATGAGTATTCCCCACAGGTGTGGGGGTGATCCCGGCTGTACCTGAACCCCATTAAGCTGTTCGGTGTATTCCCCACAGGTGTGGGGGTGATCCTAT	AACCTCCCATAATGTATTTGTTACAACAG
TGTATTCCCCACAGGTGTGGGGGTGATCCTAT	CTATTCCAACCTCAACGATTCCAGAAACT
TGTATTCCCCACAGGTGTGGGGGTGATCCGGC	TGCCATCATTTCCTTGTTTCTGACCATTTTGGT


>NZ_CP021456|3|3|1238322-1238838|CRISPRCasFinder
GTATTCCCCACAGGTGTGGGGGTGATCC	CTAGCTGTAATTGCGCGTCCAATGTGCTTCCTT
GTATTCCCCACAGGTGTGGGGGTGATCC	TATCCACACCACCGTATGAACGAGAGTGTACAA
GTATTCCCCACAGGTGTGGGGGTGATCC	TACTTCATGATCAACAGGACCGTCCTTTTTAAC
GTATTCCCCACAGGTGTGGGGGTGATCC	TGAGAAAAACGTTAACTCAGTCTTTTACCATGA
GTATTCCCCACAGGTGTGGGGGTGATCC	CGGCTGTACCTGAACCCCATTAAGCTGTTCGGT
GTATTCCCCACAGGTGTGGGGGTGATCC	TATAACCTCCCATAATGTATTTGTTACAACAGT
GTATTCCCCACAGGTGTGGGGGTGATCC	TATCTATTCCAACCTCAACGATTCCAGAAACTT
GTATTCCCCACAGGTGTGGGGGTGATCC	GGCTGCCATCATTTCCTTGTTTCTGACCATTTTG
GTATTCCCCACAGGTGTGGGGGTGATCC

>NZ_CP021456|3|3|1238322-1238838|CRT
GTATTCCCCACAGGTGTGGGGGTGATCC	CTAGCTGTAATTGCGCGTCCAATGTGCTTCCTT
GTATTCCCCACAGGTGTGGGGGTGATCC	TATCCACACCACCGTATGAACGAGAGTGTACAA
GTATTCCCCACAGGTGTGGGGGTGATCC	TACTTCATGATCAACAGGACCGTCCTTTTTAAC
GTATTCCCCACAGGTGTGGGGGTGATCC	TGAGAAAAACGTTAACTCAGTCTTTTACCATGA
GTATTCCCCACAGGTGTGGGGGTGATCC	CGGCTGTACCTGAACCCCATTAAGCTGTTCGGT
GTATTCCCCACAGGTGTGGGGGTGATCC	TATAACCTCCCATAATGTATTTGTTACAACAGT
GTATTCCCCACAGGTGTGGGGGTGATCC	TATCTATTCCAACCTCAACGATTCCAGAAACTT
GTATTCCCCACAGGTGTGGGGGTGATCC	GGCTGCCATCATTTCCTTGTTTCTGACCATTTTG
GTATTCCCCACAGGTGTGGGGGTGATCC

>NZ_CP021456|3|3|1238626-1238841|PILER-CR
	TAGCTGTAATTGCGCGTCCAATGTGCTTCCTT
GTATTCCCCACAGGTGTGGGGGTGATCCT	ATCCACACCACCGTATGAACGAGAGTGTACAA
GTATTCCCCACAGGTGTGGGGGTGATCCT	ACTTCATGATCAACAGGACCGTCCTTTTTAAC
GTATTCCCCACAGGTGTGGGGGTGATCCTGAGAAAAACGTTAACTCAGTCTTTTACCATGAGTATTCCCCACAGGTGTGGGGGTGATCCCGGCTGTACCTGAACCCCATTAAGCTGTTCGGTGTATTCCCCACAGGTGTGGGGGTGATCCTAT	AACCTCCCATAATGTATTTGTTACAACAG
TGTATTCCCCACAGGTGTGGGGGTGATCCTAT	CTATTCCAACCTCAACGATTCCAGAAACT
TGTATTCCCCACAGGTGTGGGGGTGATCCGGC	TGCCATCATTTCCTTGTTTCTGACCATTTTGGT
ATTCCCCACAGGTGTGGGGGTGATCCTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021456.1\|WP_162551553.1\|1239105_1239696_+\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153234
NZ_CP021456.1\|WP_043021893.1\|1236618_1237077_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP021456.1\|WP_110139617.1\|1233078_1234224_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP021456.1\|WP_110139623.1\|1242347_1242701_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP021456.1\|WP_087716403.1\|1232689_1233010_+\|MazG-like-family-protein	unknown	unknown	gnl\|CDD\|212133
NZ_CP021456.1\|WP_110139618.1\|1237073_1237553_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP021456.1\|WP_110139620.1\|1239708_1240062_+\|MmcQ/YjbR-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|377256
NZ_CP021456.1\|WP_085763245.1\|1245696_1246242_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP021456.1\|WP_110139267.1\|1235268_1236192_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP021456.1\|WP_043021895.1\|1234294_1234585_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP021456.1\|WP_087716404.1\|1231922_1232444_+\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|376871
NZ_CP021456.1\|WP_087716406.1\|1230349_1231108_+\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|235694
NZ_CP021456.1\|WP_087716405.1\|1231120_1231912_+\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|223417
NZ_CP021456.1\|WP_110139619.1\|1237776_1238115_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|374224
NZ_CP021456.1\|WP_110139621.1\|1240160_1241249_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NZ_CP021456.1\|WP_110139626.1\|1246446_1246869_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP021456.1\|WP_110139627.1\|1246947_1248210_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181958
NZ_CP021456.1\|WP_110139622.1\|1241367_1242264_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP021456.1\|WP_110139625.1\|1244136_1245612_+\|catalase	unknown	unknown	gnl\|CDD\|365942
NZ_CP021456.1\|WP_110139624.1\|1242812_1243820_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305

Protein	Function_ID	Function_description	E-value
NZ_CP021456.1\|WP_162551553.1\|1239105_1239696_+\|DJ-1/PfpI-family-protein	gnl\|CDD\|153234	cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	1.788e-59
NZ_CP021456.1\|WP_043021893.1\|1236618_1237077_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	3.93136e-29
NZ_CP021456.1\|WP_110139617.1\|1233078_1234224_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.70893e-52
NZ_CP021456.1\|WP_110139623.1\|1242347_1242701_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.56394e-39
NZ_CP021456.1\|WP_087716403.1\|1232689_1233010_+\|MazG-like-family-protein	gnl\|CDD\|212133	cd11523, NTP-PPase, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily. This superfamily contains enzymes that hydrolyze the alpha-beta phosphodiester bond of all canonical NTPs into monophosphate derivatives and pyrophosphate (PPi). Divalent ions, such as Mg2+ ion(s), are essential to activate a proposed water nucleophile and stabilize the charged intermediates to facilitate catalysis. These enzymes share a conserved divalent ion-binding motif EXX[E/D] in their active sites. They also share a highly conserved four-helix bundle, where one face forms the active site, while the other participates in oligomer assembly. The four-helix bundle consists of two central antiparallel alpha-helices that can be contained within a single protomer or form upon dimerization. The superfamily members include dimeric dUTP pyrophosphatases (dUTPases; EC 3.6.1.23), the nonspecific NTP-PPase MazG proteins, HisE-encoded phosphoribosyl ATP pyrophosphohydolase (PRA-PH), fungal histidine biosynthesis trifunctional proteins, and several uncharacterized protein families.	2.84068e-12
NZ_CP021456.1\|WP_110139618.1\|1237073_1237553_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	2.07918e-19
NZ_CP021456.1\|WP_110139620.1\|1239708_1240062_+\|MmcQ/YjbR-family-DNA-binding-protein	gnl\|CDD\|377256	pfam04237, YjbR, YjbR. YjbR has a CyaY-like fold.	3.75964e-19
NZ_CP021456.1\|WP_085763245.1\|1245696_1246242_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.36303e-25
NZ_CP021456.1\|WP_110139267.1\|1235268_1236192_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.38462e-76
NZ_CP021456.1\|WP_043021895.1\|1234294_1234585_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.22215e-17
NZ_CP021456.1\|WP_087716404.1\|1231922_1232444_+\|biotin-transporter-BioY	gnl\|CDD\|376871	pfam02632, BioY, BioY family. A number of bacterial genes are involved in bioconversion of pimelate into dethiobiotin. BioY is a component of the BioMNY transport system involved in biotin uptake in prokaryotes.	1.77516e-24
NZ_CP021456.1\|WP_087716406.1\|1230349_1231108_+\|enoyl-ACP-reductase-FabI	gnl\|CDD\|235694	PRK06079, PRK06079, enoyl-[acyl-carrier-protein] reductase FabI.	9.96897e-169
NZ_CP021456.1\|WP_087716405.1\|1231120_1231912_+\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|223417	COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism].	8.37082e-48
NZ_CP021456.1\|WP_110139619.1\|1237776_1238115_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	2.45636e-06
NZ_CP021456.1\|WP_110139621.1\|1240160_1241249_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP021456.1\|WP_110139626.1\|1246446_1246869_-\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	0.00260912
NZ_CP021456.1\|WP_110139627.1\|1246947_1248210_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|181958	PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed.	1.20988e-60
NZ_CP021456.1\|WP_110139622.1\|1241367_1242264_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.70679e-22
NZ_CP021456.1\|WP_110139625.1\|1244136_1245612_+\|catalase	gnl\|CDD\|365942	pfam00199, Catalase, Catalase.	0
NZ_CP021456.1\|WP_110139624.1\|1242812_1243820_+\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	7.20563e-160

>NZ_CP021456.1|WP_110139619.1|1237776_1238115_+|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MNKRCKNIMTKSSIVTYPAVFHDNEVGGYTVTFPDIEDATTSGQTLGESLVNAAIVLGQTLHHQPTALPSATTITELMHQYPMAFIQFVAVDLDQIIESAVPTNQVDLQLIQ
>NZ_CP021456.1|WP_110139618.1|1237073_1237553_-|LytTR-family-transcriptional-regulator
MLNLSERQAVPMHVTFNLKASFIPPFITINAPAETPELQHLATNISQLTNSQLITGISPRGTRELVPVDQIIRIHTDAKHVVMETKATSYTLTQRIYQLKQLLPSDLFLQLSSGELVNRQHIRHFSLTPSGLYQVLLSTGATTFVSRRCMQQIRKEFLK
>NZ_CP021456.1|WP_043021893.1|1236618_1237077_-|DUF3021-domain-containing-protein
MKRLGMLTSGAFLGLSIGFLCALFFSLTNHATTFMPSSPDFVAHFSSNTMATLAAAGLWAAIGLLFGLTSLIFFNEDWSIARQTIWHFGLSYLGFTPLAILAGWFPLNVTWLLLYTLIFIGIYLVIWTYSMLRARKTVQHLNDVLLPHKHTN
>NZ_CP021456.1|WP_110139267.1|1235268_1236192_+|IS30-family-transposase
MSTTILSFQNRVVIETLHNEGRSLRYIANYLGFSKTTIFNELHRLNSEYQAGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAYKTVYNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNYGRSIEERPHKVETRQEFGHFEADTVLSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERRTCTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQINWYLNSRPLKCLNWHTPIEIFLLNLRH
>NZ_CP021456.1|WP_043021895.1|1234294_1234585_-|winged-helix-turn-helix-transcriptional-regulator
MNIKQPSANEIRVAIFKALADEARLNIVSTLFNRQSEMSCGELGEFLNINKSTASYHFKTLREAGLTTTRKVGQTKFVSLNVAVFNDVLPGFLDTL
>NZ_CP021456.1|WP_110139617.1|1233078_1234224_-|MFS-transporter
MLDYFFLTMFLIGTDTFLISPLLPTLAHLYGISTAISGWMVSAYAIGYACFALISGPIADGHDRKQVMLWGLFAFAGSTFLCGWATSFSWMLIFRFLAGVSASFITPQVWSTIPVIIDRQNVVKVMGYATAGLSVSQLIGIPIGSYLAAWSWQTPFFIISLAALLLLGLTAWTFPHLTTSLTTAKSFITIYTNVLHNSRALVYLLAYLVFQTGSFTVMTFISTWFTADFGLRLAGVGTAMIAIGAGNLLGSLFGSRLVDWLSLPTAFLIELITLIGLYLIIAWVHTFWLAEILLAIAFVINGCLFPLFMTTLQATARHARSTISSLSNAAMYLGETVAGIAGGVLFKQFTSYRGIGLFAATMIGVALIIYVQSGLFKSRSN
>NZ_CP021456.1|WP_087716403.1|1232689_1233010_+|MazG-like-family-protein
MSISDHQQWLVDFYRQRNWYQYSPFVHLNFLTEEVGEVSRAIRAEEIGRDHPGERPTTTAEKRANLKEELADALDQVLVISSLYDIDAADLLTASEQKLTQRFKQR
>NZ_CP021456.1|WP_087716404.1|1231922_1232444_+|biotin-transporter-BioY
MQERQSIPLVGLFIAIIVIFGFFPAIPLAISPVPLVLQNMGVMVVTLLLPTRQSLAAIGLFLLLVLVGLPVLASRQAGPAVFLGPNGGYLVGWLIMPLMLQGLTYGRVLRLVAILLSAMGVDILGAVWLSTVTTMSLPQALVATLAFIPGDSLKAVGAWWLAQRLRKWAPKMI
>NZ_CP021456.1|WP_087716405.1|1231120_1231912_+|biotin--[acetyl-CoA-carboxylase]-ligase
MQPKGNQLAVDRIRTLRQTTCPIAIQLRSTVDSTNAWAKRVPAASDSPMQAFLAEQQTAGYGKRQRAFFSPAFQGVYLTVRTAVTAPVNPGRLTTAVGVMVVRCLAATYPKQTFQLKWVNDILLHQRKCGGILVENLLDRQEVLIGIGVNVTTRFSTELTNKATSIVQGNRGDRNVLVAGLLDELVMGLPHYQDAQFLADYQQLCTTLGQAVRVQVGPDWVQGVAVTLTDQGALVIQLASGERRIVASSEAIKVMTPVGDYRG
>NZ_CP021456.1|WP_087716406.1|1230349_1231108_+|enoyl-ACP-reductase-FabI
MNGILTDKVIVVMGVANQRSIAWGCVQAILAQGGTPVLTYQNERLKKSIQRFVPEDIQLVACDVVEDAAIQQAFQQIGERYGKIDGVIHAIAYADPETLKQGLVETRRTGYNLAQEISAYSFIAVARYARPWLTKPASLITLTYFGATRAIPNYNMMGVAKAALESSVRYLATDLGTDQIRVNAISAGAVKTLAVTGIKGHGDLLKMSTSLTVDQQSVTTSEIGNVAAFLLSDLSTGMTGDILYVDKGVHLM
>NZ_CP021456.1|WP_162551553.1|1239105_1239696_+|DJ-1/PfpI-family-protein
MKQAIFVMMDQYADWEGAYLSSQLNQLTDWGVKTASNQPEVTSIGGWTTRVDYQISELKPEMTLLVLIGGNAWQHDDLRLTTLIQQCLHRKVIVGSICGAVDYLARNGLLTGYRHTGNAQFLWQSFSQYQNPTDFDPQQVVVDRQLVTANGTAALAFTSAVLKASGQLTTAAKQALDLQQLGYYEYTRQYGDPFKP
>NZ_CP021456.1|WP_110139620.1|1239708_1240062_+|MmcQ/YjbR-family-DNA-binding-protein
MERAAIFQYVEDQYGIQPEYLWSKYPSYAVLRQPQNHKWFAILMDVSADKLGLLTKQSVPIMVIKLEPETVESLQADPAFLPAYHMNKSHWVSARLDKISTEESYRLLEHSYTLVSG
>NZ_CP021456.1|WP_110139621.1|1240160_1241249_-|NAD(P)-dependent-alcohol-dehydrogenase
MQIKTAFSDGTSEQLKIIDATLDEPKANEVLIKMVATGVCHTDTAGRDGLTTPLPVSLGHEGAGIVEQVGSSVMDLQPGDHVVLSFAYCGRCQHCLTGHPGMCEHFNELNFAGHNFDGSHRIHTLDGQPISTFFGQSSFSTHAVVDQHNVIKVDPTVDLRLLGPLGCGIQTGAGTVLNYLQPKFGESLVIFGTGAVGLSAIMAAKITGANHIIAIDIFDNRLALAKELGATEVINSHQADVEATLKEILPTGADYAIDTTGVSSVVMNALHALKPGGECAVVGMGRDLTFNLMDDLMAEGKKISGVIEGDAIPQLFIPKLVDYYKQGRFPFDKLIKFYDFDQINDGFAASKDGSVLKPVVTF
>NZ_CP021456.1|WP_110139622.1|1241367_1242264_+|LysR-family-transcriptional-regulator
MEERQLVLFVETAQFGSFQKTAEFNLMSQRAVSKRISALETEIGATLFDRQKNKINLTAAGKHFLTRATELLNTMRMTTYEVQQFTQQAKEQFNVGYFSPFEGVLLRMALLDLPTTTNFMIEEAGIEHLISDVLLKKIDCAVIIDNPLFNAKIDQTDLESVTLVTDHMTLGLSPDLITDQTDSPADYLAKFPVIYYSSEESTYLEEVFKSSIGQLADTFNARRVNSYEQMQLLVGMGKAISFYPTELIKYLATPYDHITYLSLDGVTTAHSEFKLIYHHGNHQPLIKQIQRYFDTHQF
>NZ_CP021456.1|WP_110139623.1|1242347_1242701_-|MerR-family-transcriptional-regulator
MKIETVAQRYHISTSAIRYYEPQGLIGPINRINGIRDFAAADLERMDFILCVKRCGMTIKQMKQFIATYEQGDSTLRERLAILQTQLSASEEQLTTLTQSISHLKQKISDIRIRLAE
>NZ_CP021456.1|WP_110139624.1|1242812_1243820_+|aldo/keto-reductase
MQYTKLGHTEIMASKICVGAMSFGQPGTMHDWTLDYSASERVIGHALSLGINFFDTANGYSAGTSETYLGRALKAQRVARDQVVLASKVYFNPGRLSAKAIHHEIDGTLKRLGTDYLDLYIIHRFDYDTPIEETMAALNELVTAGKVRAIGASAMYGYQFNNMQQVAKDRGWAQFQTMENHYNLLYREDERELIPICQQQGVSLMPYSPLAAGHLSHSAWQVDTLRSQTDRVAMGKYDRTETEDQRIVARVAELAHRYQVSMTQIALVWQWAKGVAAPIVGSTKASHLDEAATALSVKLTAADMEYLEDLYVPHAIVGALDHNPAAGTMLVDQKK
>NZ_CP021456.1|WP_110139625.1|1244136_1245612_+|catalase
MREDLKNSAGQPWGDNEHSLTAGQRGPVLIQDYNLLEKLAHFNRERIPERVVHAKGAGAEGTFRLTKDMHQYTKAKIFTEMGKSVPMRIRFSQVAGEMGSADTVRDVRGFALRFYTGDGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHERSQDMQWDFWAHSPESVHQVTILMSDRGIPASYRKMHGYGSHTFKWVNEAGEVFWVKYHFRTAQGIQNLSNDVAQRLAGENPDYLQADLYHAIEAGDFPTWKVCVQVIPEQAGLDYPADIFDVTQVVSQKDYPLIEIGEFTLNKNPDNYFEGVEEAAFSPANLVPGVEPSPDKLLQGRLFAYKDAARYRLGVNYEQLPANRPLNHPNNYERDGFMQTDNHGDQVNYKPNSQGGPQEDPAGRLTPYTVSGKAGNYAYQTDYGRAAGKLYRLLPADERQRLIETIVMNLGQVKSHDVKRLETAQFYEADHDYGLAVAQGLGLKVDEIKDYPFDTTHEIR
>NZ_CP021456.1|WP_085763245.1|1245696_1246242_-|GNAT-family-N-acetyltransferase
MENLHLTDHLALVAPISPLAADLYALIATDRANLSRWLPWANTMHEVADEAAFLTYAQGQMAAHQLWLAVITINGKPAGMIDLHDKKDGHADVGYWLGRPYRGHGYISQSLQALEKLAFNDWQLNKLQILTVPDNIASQAVAKNNHYHRDARLPKHIPTLAGDYQDAIIFSKLRQDWLAQI
>NZ_CP021456.1|WP_110139626.1|1246446_1246869_-|SRPBCC-family-protein
MTDQKLFTNTVLIPADATRVHATLTNPQNLLKWVPEITAVDPEINVFVITRTRTAINQHEVLTVTGNATTVTYTSREGRLPYQLVFTIVGQASQTLLQETLFVPHNTGLPLTLLSPIAKQALKQNLEMLAILLRRPAMPD
>NZ_CP021456.1|WP_110139627.1|1246947_1248210_-|FAD-dependent-oxidoreductase
MKLLVVGSSHGGRAAITAALAQDATIENDLIEAGPVTTVYPTQVKVHANTRAIQLLATQHQLLISHAGQKQRLSYDKLILAPGAQATIPAVLSTTSQNVLPMRTRAQINHLKAAATDATIHHVIVIGGGYIGVGAADLFSQHGKQVTVIEHGPQLLGSYLDNDFSMPIQQALQQQGVTVHVNELVTGLTGAPDVTGVTTNQTTLSADLVVVATGTTPNTDWLKGTLDCLPNGLIKTDAYLQTSATDVFAVGDAIAVTYLPQHQSRSIALASNAQRQGELAALNLQTPVLPYTGVVGTSQWQSSNLQFGVTGLTDTAAQRANISHTSVTLTQDQRQSSNPAIPTKHVQLRLTYDPQTKQLLGAQVLADGNIDELINLLALALQAQQTLADLAVADFYMSPGKNDLPHLINAAAMTAYRQEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021456_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021456_4

2273972-2274084

Orphan

Consensus_repeat	Method
AATGCAGATAAATGCAGATAAAAAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021456_4

>merge|NZ_CP021456|4|2273972-2274084|CRISPRCasFinder
AATGCAGATAAATGCAGATAAATGCAGATAAAAAACCATGCAGAATTACTAATGCTACAGCGTCCTGCCCACCTCATCTTCATTGTCAATGCAGATAAATGCGGATAAAAAAC

>NZ_CP021456|4|4|2273972-2274084|CRISPRCasFinder
AATGCAGATAAATGCAGATAAATGCA	GATAAAAAACCATGCAGAATTACTAATGCTACAGCGTCCTGCCCACCTCATCTTCATTGTC
AATGCAGATAAATGCGGATAAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021456.1\|WP_110139976.1\|2272921_2273752_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|377306
NZ_CP021456.1\|WP_110139974.1\|2270596_2271372_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP021456.1\|WP_110139970.1\|2263267_2264161_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP021456.1\|WP_180932613.1\|2283044_2283407_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP021456.1\|WP_015474463.1\|2277627_2278191_+\|M15-family-metallopeptidase	unknown	unknown	gnl\|CDD\|350617
NZ_CP021456.1\|WP_180932612.1\|2275785_2276127_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139982.1\|2280794_2282399_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP021456.1\|WP_097545673.1\|2280181_2280655_+\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|366353
NZ_CP021456.1\|WP_085762729.1\|2276258_2276711_+\|winged-helix-DNA-binding-protein	unknown	unknown	gnl\|CDD\|197670
NZ_CP021456.1\|WP_024526243.1\|2264150_2265512_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|129987
NZ_CP021456.1\|WP_110139971.1\|2265824_2266667_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_076612162.1\|2272122_2272897_-\|IS5-like-element-ISLpl3-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP021456.1\|WP_162551568.1\|2274289_2275552_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP021456.1\|WP_110139972.1\|2268019_2269312_+\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|164869
NZ_CP021456.1\|WP_110139979.1\|2276737_2277385_+\|NAD(P)H-hydrate-epimerase	unknown	unknown	gnl\|CDD\|223140
NZ_CP021456.1\|WP_110139975.1\|2271395_2272031_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225420
NZ_CP021456.1\|WP_110139981.1\|2279066_2280023_+\|linear-amide-C-N-hydrolase	unknown	unknown	gnl\|CDD\|238303
NZ_CP021456.1\|WP_110139980.1\|2278308_2278935_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139973.1\|2269605_2269692_-\|type-I-toxin-antitoxin-system-Fst-family-toxin	unknown	unknown	unknown
NZ_CP021456.1\|WP_024526242.1\|2266696_2267545_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021456.1\|WP_110139976.1\|2272921_2273752_-\|ATP-binding-protein	gnl\|CDD\|377306	pfam04326, AlbA_2, Putative DNA-binding domain. This family belongs to the AlbA clan of DNA-binding domains.	5.27738e-15
NZ_CP021456.1\|WP_110139974.1\|2270596_2271372_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	9.71608e-33
NZ_CP021456.1\|WP_110139970.1\|2263267_2264161_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	3.12946e-39
NZ_CP021456.1\|WP_015474463.1\|2277627_2278191_+\|M15-family-metallopeptidase	gnl\|CDD\|350617	cd14840, D-Ala-D-Ala_dipeptidase_Aad, D-Ala-D-Ala dipeptidase (includes Lactobacillus plantarum Aad peptidase). D-Ala-D-Ala dipeptidase (also known as D-alanyl-D-alanine dipeptidase vanX; VanX; EC 3.4.13.22) is a Zn2+-dependent enzyme that mediates resistance to the antibiotic vancomycin in Enterococci and other bacteria (both Gram-positive and Gram-negative). It is part of a gene cluster that affects cell-wall biosynthesis. The operon triggers the termination of peptidoglycan precursors by D-Ala-(R)-lactate instead of D-Ala-D-Ala dipeptides. The enzyme is stereospecific, as L-Ala-L-Ala, D-Ala-L-Ala and L-Ala-D-Ala are not substrates. This subfamily includes Lactobacillus Aad peptidase and belongs in the MEROPS peptidase family M15, subfamily D.	8.77619e-73
NZ_CP021456.1\|WP_097545673.1\|2280181_2280655_+\|C40-family-peptidase	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	5.58386e-29
NZ_CP021456.1\|WP_085762729.1\|2276258_2276711_+\|winged-helix-DNA-binding-protein	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.14181e-11
NZ_CP021456.1\|WP_024526243.1\|2264150_2265512_-\|APC-family-permease	gnl\|CDD\|129987	TIGR00909, putative_amino_acid_transporter, amino acid transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.34024e-41
NZ_CP021456.1\|WP_180932613.1\|2283044_2283407_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.15382e-19
NZ_CP021456.1\|WP_076612162.1\|2272122_2272897_-\|IS5-like-element-ISLpl3-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	1.14622e-32
NZ_CP021456.1\|WP_162551568.1\|2274289_2275552_+\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.1259e-59
NZ_CP021456.1\|WP_110139972.1\|2268019_2269312_+\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|164869	PHA01790, PHA01790, streptodornase.	2.4965e-12
NZ_CP021456.1\|WP_110139982.1\|2280794_2282399_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	3.96014e-83
NZ_CP021456.1\|WP_110139975.1\|2271395_2272031_-\|hypothetical-protein	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	4.75787e-10
NZ_CP021456.1\|WP_110139981.1\|2279066_2280023_+\|linear-amide-C-N-hydrolase	gnl\|CDD\|238303	cd00542, Ntn_PVA, Penicillin V acylase (PVA), also known as conjugated bile salt acid hydrolase (CBAH), catalyzes the hydrolysis of penicillin V to yield 6-amino penicillanic acid (6-APA), an important key intermediate of semisynthetic penicillins. PVA has an N-terminal nucleophilic cysteine, as do other members of the Ntn hydrolase family to which PVA belongs. This nucleophilic cysteine is exposed by post-translational prossessing of the PVA precursor. PVA forms a homotetramer.	2.48539e-71
NZ_CP021456.1\|WP_110139979.1\|2276737_2277385_+\|NAD(P)H-hydrate-epimerase	gnl\|CDD\|223140	COG0062, COG0062, Uncharacterized conserved protein [Function unknown].	1.83272e-50

>NZ_CP021456.1|WP_110139976.1|2272921_2273752_-|ATP-binding-protein
MDYLKQLPMENEHREYKQNRIKLTKDLWETISAFENTDGGVIVLGITEKEEREKSFEITGVQDPQQVLDDFWSTVDNIISYKTISNDDVKTIQVRNKVIIEINVNEAPDNKKPVYSNGQIYIRQGAVDSKASREQKGTLLRQSADDLDTKVLKNYNEEDLNIDDVRRYKEILGKRKQYKRYRDMDIENFLIRIGVKAKDYENDGKYGITAGGLLFFGENNAILHTFPHFQLDYFDRTNPSERWNKRISSVEDNLNIFSFFESVTRDCLKTKNSGII
>NZ_CP021456.1|WP_076612162.1|2272122_2272897_-|IS5-like-element-ISLpl3-family-transposase
MTTPKRYELEDAQWDRIKGYFPPYRTGRPSSLDNRTALNAILWLMRSGAPWRDLPERYGSWKTVYSRFRAWVSSGLFEQVFLELIDDPDMENLSLDSTIVRAHQKATGAKKNAECMVENQAIGLSRGGRTTKIHALVDGLGNPLGFRLTGGQVHDSQVASELLEGFDISQSNIIADKAYGTAKLRQYIEDKAGVYTIPPKENTKDKWTCDYHVYCERHLIENFFNQLKNFRRIATRYDKLAHVYLATVYIASICILLK
>NZ_CP021456.1|WP_110139975.1|2271395_2272031_-|hypothetical-protein
MEVALREAIINMLMHADYYGDAPIKAEANINFYNFTNPGKMKIPSQDFFTTNSTKTRNPVISKLFVQMGDGERAGQGGEKIYEAAVTSNFRLPSISTNIEQTNLKIWKVAYLGSFDGESIDDNEKGILKSIMVSGNTMLSHKEIESSTGLSRAFVTNALNSLMDKGILIKYGKARSTKYGIPSSEEQLMAQLQIMPSLFRRINSRFVKKNK
>NZ_CP021456.1|WP_110139974.1|2270596_2271372_+|IS5-family-transposase
MTTPKRYELEDAQWDRIKGYFPPYRTGRPSSLDNRTALNAILWLMRSGAPWRDLPERYGSWKTVYSRFRAWVSSGLFEQVFLELIDNPDMENLSLDSTIVRAHQKATKGKKNAECMVENQAIGLSRGGRTTKIHALVDGLGNPLGFRLTGGQVHDSQVASELLGGFDISQSNIIADKAYGTAKLRQYIEDKAGVYTIPPKENTKDKWTCDYHVYCERHLIENFFNQLKNFRRIATRYDKLAHVYLATVYIASICILLK
>NZ_CP021456.1|WP_110139973.1|2269605_2269692_-|type-I-toxin-antitoxin-system-Fst-family-toxin
MFTSFFAPLAVGLLVALFTDWLDRRRHK
>NZ_CP021456.1|WP_110139972.1|2268019_2269312_+|DNA/RNA-non-specific-endonuclease
MSSFASFIGGLSLLTAIILGVLWVVNKIGHRNTNHQGRNALIALVVAFIFIGIGGGGDSTTKTNSDKASMSNSSSDASVTATKHAATTHKSAKHPTAKHKVTPTVTTTTSRNRQVLKKLVSYTNHESAGPTQDYYWQLGKSHTTGFKHLKSGDYHFASDSQGRAGTARAVLTYGEYADSRGSRQGSPLEPSSWPTTNPKVAISYAFTGRTYHGYLYNRSHSIGDSLLGAKSYTSENNFTTGTRPQNVGADQDGGMRYAEETAEAYWASNPNTSDTIKYETTPLYYHSETIPRGSIVDIKSSDGQINTAVAVINSAEGIKINYNTGSNNAKPIKSTSHQSSQATRTTSSHSYGSSTGSASHKTNATARSTTHSGTKSGQWTVAAAGMVYVSDSHKYYSRVTNPNNYTYESESAAQSSGATRASRGNQYARP
>NZ_CP021456.1|WP_024526242.1|2266696_2267545_+|hypothetical-protein
MHLKSIIMTLGGIGIGLLLARGTTATANTHYLTGVKNHNFLITQRTLNLPKTKYKRALTIPKGTIVQAQGVSKINDKLTTHIYLNTLSYHLRHNYIGHGEGSTKNIALTTSNFKKVKVPQYVKYYSTQLTYADNIGVNYTADGNLYAGKQYPKETDLLSAKAARITVTSDGYLEYYANTKVFSTIVDPKPTTSVKITKVTGPADGKTNLYTKQPVPNTIGKRISETGTAQYVTTIKRLYRTYATVTATARDKAETDSIDISAGYQVNGKSYFMYQAIFFPEG
>NZ_CP021456.1|WP_110139971.1|2265824_2266667_+|hypothetical-protein
MNLKTHLLVLGSLVLSLGLSGGLTAAASKSYLTTVKDHSFMITQRKIILKKTPYRPSITLPKGTIVQAGGISTMHTTNILVNTLSYHLRKAYIGNGNTYTQNIPLTTTNFKKISVPAYTKYYPSQTAYPINSGRAYIGNGELYQGVKFPEQADQTKAKANLVTVTSDGYLEYTTKAPITNLRVNTRPSVSAKITKVSRPGGSGKTYLYTKAAVPSSIGKRVSKTGNTQYLTIIKRRYRAYTTLYTSGLKPQLSSIYVSAGYLVGDQQYFMVTSEYFPSAN
>NZ_CP021456.1|WP_024526243.1|2264150_2265512_-|APC-family-permease
MKESGGLERRIGTFQAITINMSQMMGAGPFITIPLVLTTMGGPQAMFGWIAGAVLALLDGQIWSELGSSLPGEGGTYNYLKAAFHDRTGNLMPFLFIWSVLLATPLTLSSGAIGLANYMTYFFPALTGLQTKLIAVAVTLLAMVLLYRRVTSVAKISLVLWLGMILTVILIVITGLLHFDPQLAFDFPQGAFAPNKFLLGLGAGMLLSIYDYLGYYTSAYMGDELREPGKTLPRSITLSIILVALIDLSMNIGIIGYVPWREAAHSTNVGSLFMTRAWGPWGGAIITILIIWTCFASVYTGLLGASRIPYNAAKDGVFFKKFAHLHPKMKFPNYSLVVIGLIMVICCFFDLTTVINALMAVQIVVQFMMQIIALSVLRRKHPHLNRPYKEWLYPIPSIIAFLGWGFVFFSSGVSAISLAVIWTIIGILVFWGRTWYVNHVKPAMTTGGQDVDN
>NZ_CP021456.1|WP_110139970.1|2263267_2264161_-|ROK-family-protein
MTTKGVLAIDIGGTKIALAAIDLAGHWLTQTKFVIAGLDGAAIVTQLLAASQQLVSQAQLTVTGIGVSTIGVVDGEHLKLVPTIKGWDHVNLKAALQRQFTQIPVWIENDVKAATYAEVLNGALKGTTAGLYLNLGTGIATGLSLGDRVIRGSHGAAGEVGYLLTSTSDAGFATGHAPFEEATGGQAIGRQLTALVGSPYSAKDMWSNSELPQVVQRFKTQLLASWAFNLANLCITWDPAVVAIGGGMEAAYDQIAPTLTAKLAQSVPFPPVLKRAYYQQNASLNGIALLAVQSVTS
>NZ_CP021456.1|WP_162551568.1|2274289_2275552_+|ISL3-family-transposase
MSQDQSTRLLLQIKDKNITHLRVSDTKRDALRVYGTLSYKLNVCPYCAQRQVVCNDHKTAYVRLPNVSERTVILILRKQRFRCKVCGKTSIAQTPVVRRQHQISENTRHAIDKSLIEDRTMKSIADQYNVSTNFVSRRILALGKQTMPAYDGLPQTLCIDEFRSTSNQMSFITIDGQKHDIITILPGRQTNEIKQFFLNHYSLKNREQVTQVVMDLNAQYQTVIRYLFPNAKLIVDNFHLVQMTLRALNQTRVQLMKRYHPDTPEYRVLKPYWRLYLMNYGALEKSQPQWFSHLRNRLTQEQLIWSGLNLSREFENTYFTAHKLVEAFRNRDYAAFTSTLDEVENVSPQLFTTIKTFIKNRKLIQNMTNSTLSNGPIEGVNRKIKQIKRTAYGYRNWKKFVFRIQIEFKIRVKKRNPVRK
>NZ_CP021456.1|WP_180932612.1|2275785_2276127_-|hypothetical-protein
MGGNTVFIQIPMDMDEVQMRQLQLKQHGEIASEDEIIRQAVLDICQNFLDQIEDGHYDSVAWQEATLTVTDINGDQMAVIKPQGSSFVADFRQNADATLQRLEQAAIQASGAR
>NZ_CP021456.1|WP_085762729.1|2276258_2276711_+|winged-helix-DNA-binding-protein
MEDSILDFTTNLAILHRQFQRAMNQLLEADKMPVNITEFYLLVLISETRQLNQRRAAWTMAVDEGLMARMVHHLVELELIQKETDPRDRRNRRLQLTPAGQELVQQAITVLHDWWQQATPNQSDFDYAVITAQLQRLSSRVLQKQQANNH
>NZ_CP021456.1|WP_110139979.1|2276737_2277385_+|NAD(P)H-hydrate-epimerase
MSKAITIAEAQCYDTHATNVIGIPAMVLMERAALATFNNLLNDDFDLDRVVVVAATGNNGGDGIAVARLLKIRGIDVTIYLLGDPENATPQTSQQLKIANYYNIPVTADLNQIVNATLIVDAIFGVGLTRDVTGKFADAINAINAADAKTVAIDVPSGINADTGAVMGVAVVADSTTTMAYNKIGLLTTIGKQHAGTIHVADIGIYAQDRVEHAR
>NZ_CP021456.1|WP_015474463.1|2277627_2278191_+|M15-family-metallopeptidase
MSELETGFTNVQALDPGILVDLRYATTNNFTHQVVYDFTTAIARTGTAKKLAVASAALRQQGYRLKIWDAYRPVTAQRRLFDVYPDPSFVAEPDPNFSHQKGVTFDLTLCDLDGNELEMQTAFDDFTAAAHRDAPRTAIQERHYQILDQAMRAAGFVGYENEWWDYRDSQMDAYGPATANPDDYALP
>NZ_CP021456.1|WP_110139980.1|2278308_2278935_-|hypothetical-protein
MKSTWNLVGMALWVLVLVTLIWMVHDMRVRRIRLIVKEHHSFSWRNLTISTIELVVWLLFFGGMSYTTFFQNVNELGDRVTQTTRYEPLVINTGSGSGSAYYVTVDNSTGKQPVQTYTYLTEGEKYAVSSTDSTVSDGKKAINLPASAYKWDAKKVAKYDQRHQKAWVGVVETTYKKTFVNGIGLHAGRLASRFTLIRIPDHSFMLRK
>NZ_CP021456.1|WP_110139981.1|2279066_2280023_+|linear-amide-C-N-hydrolase
MCTSLTYTSATGHHFFARTMDFPTTTPWRPVFLPRHYRWETALHTTRTTQYAILGGGRIAADFSAYLLADGFNENGISCAELYLPGVVDYAPAPVAGQLNLTPQDFINWALGEHATLAAIVTELPRVTLVNQPWGTDRYVYPFHWILSDRSGQTLVIEPTGGPLTAQLNPAGVLTNTPILATHLQNLNDFLAVDAPDFSPATVAAAQSYLASGQPLPSGPVPTNRFIHTAIRRWGNPPAATTTAAVTHLFQWLAEVQLPYQPERRHDRNHNYTHYRGICDLDTQSYLFIPRTTGRLQQITLTPEMATSRHFPHAFPAN
>NZ_CP021456.1|WP_097545673.1|2280181_2280655_+|C40-family-peptidase
MKKTLTDIILTLVATVAFAIAGFAITEPVDANAATMSYDKIHKVAKAQLGKPYGWGSTGPSRFDCSGFTSYVYKKGASKKIPRTAQAQYNKYKHVSYKNIKKGDLVFFGGSKHSISHVGLYVGGGKMIDSQNRGVVTEAVHAPWWHAVGYARVGSVK
>NZ_CP021456.1|WP_110139982.1|2280794_2282399_-|polysaccharide-biosynthesis-protein
MDKKIISGSFWLSFGSLFSRVLGVVYLIPWLAMIGSPQHQTVAQALFNTAYTPYALFIALGTAGFPSAIARRVAFFNGEGSFLNSKRIALTGFGFMAVSGVICGVLLYGLAPILAANSPVSSVANATIAIRCLVPAIVILPSMSILRGWFQGNGDLKPFGISQLWEQFIRIIVILAGTYWIIERSQQSYVLAVFVSVAAAFVGAVASYAYLLSHLWRQRHTYRQLAAASETSKQHAGRDLLKMVGVESIPFVIVGSGITLSQLVDQLFFKQIMQGILHQTATMTQYVFTIFSANPNKITTVLVSLAMAVAETSLPLLAGQLADLKANRQRITALLTNNFQLLTFVLLPLVVLVSLLAYPAYGIFFNFDSAGATYLIANGWQSLILGLALDLLTTLQALRMSKKATTYLLGGLGIKLALQLPLVYLWQGYGALLTTSVAFGWIIWRSWHTIRQSYALRLQLLWPIVKLNLWFAIILTGLIDGTQWWLGPLFFTGKFLAMVYVSVWGLLAIGLYIWLANRFGVAQLIFKRPLTVRR
>NZ_CP021456.1|WP_180932613.1|2283044_2283407_-|helix-turn-helix-domain-containing-protein
MENKFNTQLSQLRRQAGLSQEQLASQVFVTRQSVSKWEQGETTPDLDTLIRLATVLGVSLDELVSGRSTATHQTETEATFDQPEPAGATTGHPMNFWEFLANYWWALVALAGVIGVFFGH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021456_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021456_5

2319237-2319998

TypeII

Consensus_repeat	Method
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CRISPRCasFinder
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CRT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	PILER-CR

11 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP021456_5

>merge|NZ_CP021456|5|2319237-2319998|CRISPRCasFinder,CRT,PILER-CR
ATTCTTGATCCTATTGATTTACCAAGATTCTAAATCGAAGGCAATAAGCTGGAAGCCATTGTACCAGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCCGAAGTCTATTGGCAAGTTCCGAAGAAAAAGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCCCAAGGGCAGTACAATCTACGGTAAGGCCGGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCGACCAACTTTACGTAGTCCTTGTTAGCTGAGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCCCACGGCATAAGCTTAGTTGGTTCTCCTGTGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCGTTCTGCTGTCTTCTGTAGTATCCGTTGCCGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCTAGGCGTTGCCTTGGTAACCTTACCTGAAAGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCGGATACGCTACAATACGCCAATTACGTCCAGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCCAATGGCCGCCCGGATTGCCTTATTCTCATGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCTTAGGCCAAGACACTTTTGCGCATGCAAAGGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGCATCCTAAACCAAAAGTAAACAGTGTCTTAAGTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC

>NZ_CP021456|5|5|2319237-2319998|CRISPRCasFinder
ATTCTTGATCCTATTGATTTACCAAGATTCTAAATC	GAAGGCAATAAGCTGGAAGCCATTGTACCA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CGAAGTCTATTGGCAAGTTCCGAAGAAAAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CCAAGGGCAGTACAATCTACGGTAAGGCCG
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GACCAACTTTACGTAGTCCTTGTTAGCTGA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CCACGGCATAAGCTTAGTTGGTTCTCCTGT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GTTCTGCTGTCTTCTGTAGTATCCGTTGCC
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	TAGGCGTTGCCTTGGTAACCTTACCTGAAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GGATACGCTACAATACGCCAATTACGTCCA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CAATGGCCGCCCGGATTGCCTTATTCTCAT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	TTAGGCCAAGACACTTTTGCGCATGCAAAG
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	ATCCTAAACCAAAAGTAAACAGTGTCTTAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC

>NZ_CP021456|5|4|2319237-2319998|CRT
ATTCTTGATCCTATTGATTTACCAAGATTCTAAATC	GAAGGCAATAAGCTGGAAGCCATTGTACCA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CGAAGTCTATTGGCAAGTTCCGAAGAAAAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CCAAGGGCAGTACAATCTACGGTAAGGCCG
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GACCAACTTTACGTAGTCCTTGTTAGCTGA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CCACGGCATAAGCTTAGTTGGTTCTCCTGT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GTTCTGCTGTCTTCTGTAGTATCCGTTGCC
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	TAGGCGTTGCCTTGGTAACCTTACCTGAAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GGATACGCTACAATACGCCAATTACGTCCA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CAATGGCCGCCCGGATTGCCTTATTCTCAT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	TTAGGCCAAGACACTTTTGCGCATGCAAAG
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	ATCCTAAACCAAAAGTAAACAGTGTCTTAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC

>NZ_CP021456|5|4|2319303-2319998|PILER-CR
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CGAAGTCTATTGGCAAGTTCCGAAGAAAAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CCAAGGGCAGTACAATCTACGGTAAGGCCG
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GACCAACTTTACGTAGTCCTTGTTAGCTGA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CCACGGCATAAGCTTAGTTGGTTCTCCTGT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GTTCTGCTGTCTTCTGTAGTATCCGTTGCC
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	TAGGCGTTGCCTTGGTAACCTTACCTGAAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	GGATACGCTACAATACGCCAATTACGTCCA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	CAATGGCCGCCCGGATTGCCTTATTCTCAT
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	TTAGGCCAAGACACTTTTGCGCATGCAAAG
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC	ATCCTAAACCAAAAGTAAACAGTGTCTTAA
GTTCTTAACCCTATTGATTTACCAAGATTCTAAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021456.1\|WP_065200952.1\|2320694_2321000_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP021456.1\|WP_110139993.1\|2310963_2311494_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP021456.1\|WP_087716494.1\|2329798_2330797_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP021456.1\|WP_087716495.1\|2329075_2329564_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_110139994.1\|2312661_2313231_-\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NZ_CP021456.1\|WP_087716497.1\|2320032_2320698_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP021456.1\|WP_085762710.1\|2320977_2321883_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP021456.1\|WP_021741248.1\|2310644_2310959_+\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP021456.1\|WP_087716493.1\|2332394_2334068_+\|alpha-glucosidase	unknown	unknown	gnl\|CDD\|200472
NZ_CP021456.1\|WP_110139996.1\|2322094_2326201_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP021456.1\|WP_024526176.1\|2309655_2310078_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_011668743.1\|2311567_2312401_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP021456.1\|WP_043022283.1\|2310316_2310643_+\|multidrug-resistance-protein-SMR	unknown	unknown	gnl\|CDD\|224987
NZ_CP021456.1\|WP_043022289.1\|2317201_2318581_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340890
NZ_CP021456.1\|WP_110139997.1\|2326725_2328369_+\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP021456.1\|WP_024526177.1\|2308421_2309297_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|366120
NZ_CP021456.1\|WP_043022288.1\|2316086_2317139_-\|alpha/beta-hydrolase-fold-domain-containing-protein	unknown	unknown	gnl\|CDD\|369561
NZ_CP021456.1\|WP_035464753.1\|2330991_2332374_+\|SLC45-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340871
NZ_CP021456.1\|WP_110139995.1\|2313843_2316081_-\|glycoside-hydrolase-family-65-protein	unknown	unknown	gnl\|CDD\|224471
NZ_CP021456.1\|WP_087609241.1\|2328558_2329089_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021456.1\|WP_065200952.1\|2320694_2321000_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.90838e-22
NZ_CP021456.1\|WP_110139993.1\|2310963_2311494_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.28394e-19
NZ_CP021456.1\|WP_087716494.1\|2329798_2330797_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.03216e-88
NZ_CP021456.1\|WP_087716493.1\|2332394_2334068_+\|alpha-glucosidase	gnl\|CDD\|200472	cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins. The sucrose isomerases (SIs) Isomaltulose synthase (EC 5.4.99.11) and Trehalose synthase (EC 5.4.99.16) catalyze the isomerization of sucrose and maltose to produce isomaltulose and trehalulose, respectively. Oligo-1,6-glucosidase (EC 3.2.1.10) hydrolyzes the alpha-1,6-glucosidic linkage of isomaltooligosaccharides, pannose, and dextran. Unlike alpha-1,4-glucosidases (EC 3.2.1.20), it fails to hydrolyze the alpha-1,4-glucosidic bonds of maltosaccharides. Dextran glucosidase (DGase, EC 3.2.1.70) hydrolyzes alpha-1,6-glucosidic linkages at the non-reducing end of panose, isomaltooligosaccharides and dextran to produce alpha-glucose.The common reaction chemistry of the alpha-amylase family enzymes is based on a two-step acid catalytic mechanism that requires two critical carboxylates: one acting as a general acid/base (Glu) and the other as a nucleophile (Asp). Both hydrolysis and transglycosylation proceed via the nucleophilic substitution reaction between the anomeric carbon, C1 and a nucleophile. Both enzymes contain the three catalytic residues (Asp, Glu and Asp) common to the alpha-amylase family as well as two histidine residues which are predicted to be critical to binding the glucose residue adjacent to the scissile bond in the substrates. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP021456.1\|WP_110139994.1\|2312661_2313231_-\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	5.83539e-07
NZ_CP021456.1\|WP_087716497.1\|2320032_2320698_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	3.00029e-62
NZ_CP021456.1\|WP_085762710.1\|2320977_2321883_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	5.91715e-92
NZ_CP021456.1\|WP_021741248.1\|2310644_2310959_+\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	4.18465e-25
NZ_CP021456.1\|WP_110139996.1\|2322094_2326201_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	7.10893e-132
NZ_CP021456.1\|WP_011668743.1\|2311567_2312401_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	9.78691e-35
NZ_CP021456.1\|WP_043022283.1\|2310316_2310643_+\|multidrug-resistance-protein-SMR	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	1.56343e-21
NZ_CP021456.1\|WP_043022289.1\|2317201_2318581_-\|MFS-transporter	gnl\|CDD\|340890	cd17332, MFS_MelB_like, Salmonella enterica Na+/melibiose symporter MelB and similar transporters of the Major Facilitator Superfamily. This family is composed of Salmonella enterica Na+/melibiose symporter MelB, Major Facilitator Superfamily domain-containing proteins, MFSD2 and MFSD12, and other sugar transporters. MelB catalyzes the electrogenic symport of galactosides with Na+, Li+ or H+. The MFSD2 subfamily is composed of two vertebrate members, MFSD2A and MFSD2B. MFSD2A is more commonly called sodium-dependent lysophosphatidylcholine symporter 1 (NLS1). It is an LPC symporter that plays an essential role for blood-brain barrier formation and function. Inactivating mutations in MFSD2A cause a lethal microcephaly syndrome. MFSD2B is a potential risk or protect factor in the prognosis of lung adenocarcinoma. MelB-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.86927e-107
NZ_CP021456.1\|WP_110139997.1\|2326725_2328369_+\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021456.1\|WP_024526177.1\|2308421_2309297_-\|ROK-family-protein	gnl\|CDD\|366120	pfam00480, ROK, ROK family.	1.47909e-75
NZ_CP021456.1\|WP_043022288.1\|2316086_2317139_-\|alpha/beta-hydrolase-fold-domain-containing-protein	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.10768e-33
NZ_CP021456.1\|WP_110139995.1\|2313843_2316081_-\|glycoside-hydrolase-family-65-protein	gnl\|CDD\|224471	COG1554, ATH1, Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism].	7.72311e-149
NZ_CP021456.1\|WP_035464753.1\|2330991_2332374_+\|SLC45-family-MFS-transporter	gnl\|CDD\|340871	cd17313, MFS_SLC45_SUC, Solute carrier family 45 and similar sugar transporters of the Major Facilitator Superfamily of transporters. This group includes the solute carrier 45 (SLC45) family as well as plant sucrose transporters (SUCs or SUTs) and similar proteins such as Schizosaccharomyces pombe general alpha-glucoside permease. the SLC45 family is composed of four (A1-A4) vertebrate proteins as well as related insect proteins such as Drosophila sucrose transporter SCRT or Slc45-1. Members of this group transport sucrose and other sugars like maltose into the cell, with the concomitant uptake of protons (symport system). Plant sucrose transporters are crucial to carbon partitioning, playing a key role in phloem loading/unloading. They play a key role in loading and unloading of sucrose into the phloem and as a result, they control sucrose distribution throughout the whole plant and drive the osmotic flow system in the phloem. They also play a role in the exchange of sucrose between beneficial symbionts (mycorrhiza and Rhizobium) as well as pathogens such as nematodes and parasitic fungi. There are nine sucrose transporter genes in Arabidopsis and five in rice. Vertebrate SLC45 family proteins have been implicated in the regulation of glucose homoeostasis in the brain (SLC45A1), with skin and hair pigmentation (SLC45A2), and with prostate cancer and myelination (SLC45A3). Mutations in SLC45A2, also called MATP (membrane-associated transporter protein) or melanoma antigen AIM1, cause oculocutaneous albinism type 4 (OCA4), an autosomal recessive disorder of melanin biosynthesis that results in congenital hypopigmentation of ocular and cutaneous tissues. The SLC45 family and related sugar transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.21066e-118

>NZ_CP021456.1|WP_043022289.1|2317201_2318581_-|MFS-transporter
MSKMQLWKQRFFYGATDMAGNLIWQIVGLYLLFYYTTVMGISPAFAGTLFFVVRIIDAFDGVVYGFLIDHTHSKFGKARPYFLWFGIPLGILTMLLFFNPSFGGNKVIQLAWVSVVYTLFSLVYSGANTPITAILPSLTKDPDERTNLASARMVMTNIGTAVIGAITLPMVAQLGGKNAEKGWLIWGVIIGIAIIALFLGAFANLREKDDIVAETEDAPEIKGHLSVKDSLKGAAKNKPWLILSASFILLQTFWMMRLQTAVYYLTYVSHQPALVGAFNGLVIVAVIGNISVPFLSKFMKHRNVMILAMVTFAFGELLMAFKNIPLLFIGNVIALVAMGAAFSIAFVMIADTVEYSRSELHIDEPGILSAVPMVGAKLGMGLAGLISGWLLSWGGFNAAAKVQGAKAVTAIATNFIWVPVVLALVIGGILYLWYQLDESKIASAKAAKEAEKKLSEEDA
>NZ_CP021456.1|WP_043022288.1|2316086_2317139_-|alpha/beta-hydrolase-fold-domain-containing-protein
MLNDTTTKQSLGYSDELRRLQGIGVTDIADGVTSWVKERDPLHTFEPLVWETVAGIEANPQLPTDLFSLRQGTETSGQRDLTTTAMKVEMQQIVAMNRRVRVIRIAREDHLNADKAYIYFHGGAYYGGTPEDVLLALKFVAEQANCVVYNVDYALAPEQPYPAGILDGLAVVAAMTAEYAHISLGGDSAGASIALGVSQLCKSMGICEIASHVLFYPTVIQGSKLTGPLWDDSQITIVPEQRAALHRSYQLFEQLDAIMSGYYVADQAVDLTAPLLSPLLADPTIFHNVTLLVGEYDPFRLQGEAFIKRVGHANGDANYFRYGGISHAFLNFTGNVPAVEDALMTAAKFI
>NZ_CP021456.1|WP_110139995.1|2313843_2316081_-|glycoside-hydrolase-family-65-protein
MQIRQLGEIMLTLQDYHLTLHDVANHQPAYLETVFSLANGHFGVRANDPITGNPIAGTLINGFYETAPITYGEAGVGYAKAHQTILNLPDFRHINVATTTGHSFTSSERTKVDLDLATGELTEHYTLQTRQGETIAMSVQSVIGQTQTAFWAINYGFLAGNYAGGLVVNKTIAVPAEAESLPSADPRKTRLAGLPICETTFMAKDLQQYHVKTRQTKQSVTIYLGMLTTPGSLLRQPVDLGDHTTHHLSYEVYVGEMGQQNTIDPALPFPATALTALMTDSRDFWQDVWQRSEVTVGGNDELDLAIHYNLFQLNQAAGRDGRTNIAAKGLSGSGYEGHYFWDTEMYMLPYFIYTNQPMARQLLVYRYQTLPQARQRARALGVDQGALFAWRTINGEEASAYFPAGTAQYHIDADIAYAVGKYYEITRDIDFIKQCGFEMVLETAHFWEAFGSWHQVGTSQRFEFHTVTGPDEYTALVNNNYYTNRLAKHNFELVTYLAQEILKVDPNGLTKFGIDATDIDAFQNLAEHVYLPYSAEQQINAQDDSFLSKPRWPVAQSTPENFPLLLHYHPLTIYRYQVAKQADTLLADYLFPEDLSPEQLQREYHYYEGVTTHDSSLSRSIFSILAARMGDVEKGYRYFMDTAQMDLVNLQKNTADGLHLANLGGSWLALVAGFSGFYVQDEVVHFTNHLPSELTQLTYRMKIAESVLEIKLTATETTVVVISGPIPTYGVSVNGQLISLAKKVR
>NZ_CP021456.1|WP_110139994.1|2312661_2313231_-|SdpI-family-protein
MLLPDVALSKERVILLVNSVILALAWVRYLFLPKTRPSFGVLGAFTLVYAALLLIQIMVNRRHRGLKISLDLNVVFGSYCLILVLLPLAYANTAIVGHLTGVGIIVSLIGVPMSYVPQNRLLYGIRIPASKNSPAVWQKTNHLAARICFGFGGLSFLLGLLGQAAFVLTMAVGAVVLAVSTSLYARKLS
>NZ_CP021456.1|WP_011668743.1|2311567_2312401_-|histidine-phosphatase-family-protein
MKLTKVVSLLAVTAGALALVAVPSNAQAKTKKKAAVKPVTIYLTRHGETTGNVMGRVQGWSDFPLTSNGIAVANNLGRGLKGKTFKVAYAGNLTRQQVTAKQALKYSGNKKVKVNVSKYLREGGYGSFEGDSIAADNALIAGVYGFKSGDEMMAKQGKDYWNLLQDAYYKLDQENSQKTNLVASDRAESSKQVQKRMAKELLTIAKATQKRGGGNALVVSSGMSINEYLSTMAGSKYTGAPLKNAAVTKLVYKHGKLAVSGPIGSMTYVDKGAKLAK
>NZ_CP021456.1|WP_110139993.1|2310963_2311494_-|GNAT-family-N-acetyltransferase
MAVRLKPLAIEEVAAFWQLAFRDPQAAWTQWNGPYFHDHVPTYAEFVTGPGHEAYVDQPWRQVIWVDGQMVGMVSAYYDDAPLNRWLDVGIIIYDQHRWQRGIGRTALSQWIDWLWTQTPLPHIGLTTWSGNQRMCHLAESLGLREEARVRQVRYWQGRYWDSVKYGVLREEWHKR
>NZ_CP021456.1|WP_021741248.1|2310644_2310959_+|multidrug-efflux-SMR-transporter
MAWLFLIGAGLSEMLGVTFMNWALHRKTWWLWVLMILAFTLSFGGLELALKTLPMGTAYAIWTGIGAAGGVLTGMLFFGESKDWRKLVWVAVILSATLGLKLIS
>NZ_CP021456.1|WP_043022283.1|2310316_2310643_+|multidrug-resistance-protein-SMR
MWRHWLTVVLGAVFEVSWVVGFKHATTLWAWLITGVAVYLSFYFLIRASRSIPAGTAYAVFVGLGTLGTTSVGMFVFGEPISWLKIALILLLLAGIGGLQWTTTKEAN
>NZ_CP021456.1|WP_024526176.1|2309655_2310078_+|hypothetical-protein
MQRKYRDYFAYLKTINPDPNASFIAVSPANVQKTDPDKFATLTARAGRRWGVILFHALYGNKTTKKTNVPYAVVHEDSFARDWDGIDRAEFDEDVAILVQCQMLQVKEVQGLTRLIMRYPEPLASLADLRIKGIDQINPG
>NZ_CP021456.1|WP_024526177.1|2308421_2309297_-|ROK-family-protein
MQLGSIEAGGTKFVCAIGNEDYRTQDKVRIPTTTPEETLSQTIAYFKQFPDLKAIAISSFGPIELRHNSPKYGYITNTPKVGWANTDFVGRLKQELDVPMYWTSDVNGSAYGEYVMSTLFNENINSLVYFTIGTGVGAGAIIDGHFVGSLGHPEMGHVRLKRHPDDLDFPGICPFHGDCLEGLVSGPTFDARLGKPGKDVPLTDHVWDILAYYVAQAALQVTLMMRPDKIVFGGGVVSEAFLDKVRHEFDQLLNHYVDVGKLTDYIVMPAVKDNGSATLGDFALALNEYNK
>NZ_CP021456.1|WP_087716497.1|2320032_2320698_-|type-II-A-CRISPR-associated-protein-Csn2
MNLTYYGFRPFKITPGKVVVLATGSPHIYQEIILGLQDRTDTVKLSDDNFTTVTVGKGAQWYGDPLLNVDLNALFQRKLQTRLLKVLADDQTVGLVDGLQSLLSQLLADSYLMDVPLELPETPELAKLIKFSGIQLVPDLRDDVYGILETLVKTLIELNDHRMVVLTNVGHYLQVSQLQSLVRFMANIDLPILLIEFSSTKQSDYFRNCDYHYIDSDFVLW
>NZ_CP021456.1|WP_065200952.1|2320694_2321000_-|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPMETSQDRRHYRHFRKALLQEGFFMMQYSVYVRVCPNSAGAAAIEKRIAALAPANGLVQSVMLTEKQYQAMHFIAGQPNQDLLNSAERTVMI
>NZ_CP021456.1|WP_085762710.1|2320977_2321883_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRTLLISQHAKISLTSGNLVIQTDSDRYHTPVRDINVLLIQSLQVVITTAAVAALAEAHAKIIFTGRDGQPICETAECYPHARTAALVRQQVGWSEGRIENLWTRVVAAKIQNQIAVGNLLEVSTMDLSGELEKLELNDATNREAVVARQYFPLIFGKDFSRSDLVPINAALNYGYSILLSLVNRIIVSRGYLTCFGIHHDNAGNAFNLASDLMEPFRPIIDYWVAQQNILDLTPDVKFGLARLFELEMRYNGKQEVLSNVVEKVIVQCLKYLSEETETIRIEVDVPDEVSNYAINDYV
>NZ_CP021456.1|WP_110139996.1|2322094_2326201_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MTSGVEERLIKLGGVIAVDKEPYGIGLDIGTSSIGWSVVDMNGRIKRVKGQTGLGVRLFEEGQAAAERRGYRTTRRRLSRRRWRLRLLREIFDEPISAIDASFFARQKASNVSPKDTKLVTTYRLFSDQSDGEFYEKYPTIYHLRQALMTEHRQFDLREIYLAIHHIVKYRGNFLRSGNPQKFQPGKLDFNERFTRINQAWLGVFDELAPQLPEEDLEDVTAIILDTTRSRLDRQRDLVKQLMKMTGNQKSWKPILTAFCKAILGLKAQVYLVLGLDVAKEDQKSLTFSLADIEDHRDDLAALMDEKQTALLEKLVDLQAAIQLTEIMPDGKGFSESMVQSYVNHKEHLCWLKEYATVQTDEQRRTKVLLAYDHYIDGNDKGKAETTGDFYNELRRLLKGDTSELAQKMMNAIELEKFMPKQRTKGNGVIPYQVHQQELDAIIENQKDYYPFLAAPNPVVEDQREQPYKLDELVHFRVPYYVGPMITAEEQAKTAAGQFAWMVRKESGDITVWNFDKKVDRVASATNFIARMKTTDTYLIGEDVLPLQSLIYQRFMVLNELNGIRVNGERLRRDQKQRLYNQVFKTRRTVSIKAIQENLVNHGDVDKRQVIEGLADPKNFNSSLSTYQDLKAILSTAVDDPKRQVDIEKIINWSTVFEDQRIFKDKLQEIGWLTDTQRNRLSAKRYRGWGRLSARLLTEIQDAQGQSIMDQLWQTQHTFMQIVHEPDYAAAITAINAAGFKDRTLETTIDELYTSPQNKKALRQIVAVVRDIQAARHGQVPSRIFIEAARGAMDNPQRTRRRQKQLTDLFADRAKEIVSQTVTEELKDQIAGKAKFTDRLLLYFLQNGRDMYTGEKLNIDRLSQYDIDHILPQSLIKDDSLDNRVLVQQRINRDKNDSFAADLYASKMQGTWELWRSAGLVSARKLRHLLMRADEINKYATGFVNRQLVETRQVIKLTTDVLSSLYDPEKTQLISVKAALSHQLRTELKLPKLRELNDYHHALDAYLAARIGTYLLKRYPKLERFFVYGQYKVAPQLDLRRFNFIHDLVLDKQVIDPDTGELLWDREADIKYLEHLNGLKHLLVTHEVFEDHGALFDQTIYPARKAQNKKLIPTKQGRDTAIYGGYSGQNTAYLAIVKVHDKVDYLKVMAVPIRVVSEVNQQRKLGLAAEKAYLKKLFLPQFTKKSGTIDFEVVRPHVYLQQRIEDEVYGEVHQFALRSSTYYRNLQQLWLPLSSQQVLLKKDAKDGELTRVFDQICEQAQRYFSLYERNNFRQALQNSRSQFVALPTTNVIDDHGKLVQVGKREIISRLMRGLHANAERKDLKVIGIKTSFGLLQEGNGIRLGLAAKMIMESPTGLFKREVRIDPES
>NZ_CP021456.1|WP_110139997.1|2326725_2328369_+|peptide-ABC-transporter-substrate-binding-protein
MQRKGTILTVAALSLLTLAGCGSQSTSSNNSGKYAAKQVLNWTESSELATTDLAQATDTLSFNVLQNTQEGLYRLNSKGTPAKALATSTKVTNGGKTYTFNLRHGVKWSNGDPVTAKDFVYSWQRTVSPKTASQDAFYLYQVKNAEAINKGKKSLSALGIKATGKYTLTVNLTKPVSYFKKLLAWPLFYPVNQNAVNKYGKKYGTSSSTTVYNGPYRLTKWNGTSKSWTLAKNKTYWDKKAVHLTKINEQVTESTTTSYNLYNAKKVDETLLSGQQIKNNKNSKDFVKRLPTGSQRLDLNEKKVSAFKNVNIRKALSLAINRTQLVNDVLQDGSVASKGFVPAGMGNNPKTGEAFNQEASVKSAVSYNLKQAKTLLAKGLKQTGDKKLNVTLSVSDTDSSKQTAEFIQSSLEKLPNVTVTIKTVPYVQLITQQNNGNYELTLAGWQSVFADPINFLDVFEADSSYNTTGWKNSTYDKLLDEAENVYGNQPEKRWEKLVAAEQVLMKNQGTIPLYQAAKSQLLRSNVKSVVYNPAGVPYDWKTTYIAK
>NZ_CP021456.1|WP_087609241.1|2328558_2329089_-|hypothetical-protein
MSYIKRSGDTMKKGLKGIVLAVASLGVFAMVSSTTANAASKTTLPKSYRGTWYIYGGSDTEDKVTAYAVAKLNLTNKKMGYKVYTTTKKQLTSLKWQLSAAFPTIYSKKVNNKKKVTYRVKARIDDSVTLMTLGKTKVNVKVLGKKVTALRLRADGTNVYAFRKPLRTHALSDITY
>NZ_CP021456.1|WP_087716495.1|2329075_2329564_-|hypothetical-protein
MRKQLLVGVITGLAAFTLAGMGHETAQAATLPADYQGDWVAYIGKTKHHHVNYYYTARLTLADTSLATQLNVTKNANLSDLTTQVTLQSAVTYQLKTTKKHQVSYKVRTATDNASLGKFSLTKVKVKGQKTTALAFDDGEDDVVYAFRSLNKTHAWGDDVLY
>NZ_CP021456.1|WP_087716494.1|2329798_2330797_-|LacI-family-DNA-binding-transcriptional-regulator
MAATIKDIAKLAGVSPATVSRVLANKTAFFSADTAAKVQTAATTLGYQKNTAAAELVTQQSHVIAAIVNSTKTNFANHIIEGIQDAAYRQGLNVIILYAGDADPEQQRRALTTVIERPVRGILLLSVDLSADNLTYLQAAQIPYCFLSISFEEDQLPFITSDDWQVGYQGTQALLAQGHRQIGLAAVDSVHAHTGKLRLAGYTQALTEAGITPDPAWIQPGDYSYVAGQAAMRAYGQAPQVTAVLAGSDMAAIGVLNQARDFGLTVPHDLSIMAIDGTELCELVQPQLSSVSQSFYDMGVAGVEQLTTAQQQPPKITPITVVTRESVRFIEN
>NZ_CP021456.1|WP_035464753.1|2330991_2332374_+|SLC45-family-MFS-transporter
MAQTTPIESTDATPAATSHNALPKISLKTIFAMTFGFFGVNMAFSLQSSQMGRIFQTIGADPTKLGFFFLLPPLAGMIVQPLVGKYSDMTWNRFGRRMPYLLIGAPIAALVMILLPNAGSFGFGYASLAALWFGAVAILFMDLSSNVCMQPFKMIIGDMVNEDQKDLAWSWQQSFSNLGGVLATIFPFVLTWFGVSNVAPKGTVPMSVRLAFYIGAGILLLTSLYTIISVKEYDPETYNRYHHVKTQAKQKTASLWHLVKTAPRAFWEVSFVQLFDWFAFQYLWTYGTGAIAANVWHTADASSAGYQAAGNWFGILSCIQALAAVVWGFAVLSRTKPAQRKLWFRISLIMGGAGFIWIFFIHSQYLLILPFCLIGICYLTMQTQALSLFTESLNGENEGAYLGLFNCGICLPQIIASLLSFAIFPAIGQSMPGMLVIAGVALLLGAVAVSVIHPKLSANL
>NZ_CP021456.1|WP_087716493.1|2332394_2334068_+|alpha-glucosidase
MTKKWWQNAVVYQVYPRSYQDSNGDGIGDLAGLTQRLPYIKRLGADVIWLNPIYKSPDKDNGYDISDYQSIQPAYGTMVDFDHLLDSAHQQGLKLLMDLVVNHTSDQHDWFQQSRQSKDNPYADYYIWRDPVDGHEPNNWGSYFSGSAWTFEPKRNQYYLHLFAPGQPDLNWENPQVRQEVWNLMRFWLDKGVDGFRMDVINLISKPAGLPDAPQAPGAAYGDSQPIVSDGPKLNDYLREMNDEVLSHYDVMTVGEMPGSTPEDAITYTGLNANELNMVFQFEHVGLSPNPDARLGKWNAVPVKLTELKDSLSRWQTALDGKGWNSLYWNNHDQPRAVSRFGNDTPEFRERSAKMLATTLHMMQGTPYVYEGEELGMTNVHYTQLDQYEDLESLNAYHELVDDQHIVDQPTMLKYLSHISRDNARTPMHWDDSTNAGFTTGQPWFALNPNYPTINAADQLNQDDSVFNYYRRLITLRHSSDLIVLGSYEELDPEDDQVFAYKRHYQGQTLLVMSNFTDQTVTRDYGQAEASERLIGNYADDQGTTLRPYETKVYVLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021456_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021456_6

2386270-2386542

Orphan

I-E,II-B

Consensus_repeat	Method
AGGATCACCCCCACACCTGTGGGGAATAC	CRISPRCasFinder
GGATCACCCCCACACCTGTGGGGAATAC	CRT
GTATTCCCCACAGGTGTGGGGGTGATCCT	PILER-CR

4 spacers

The CRISPR arrays of NZ_CP021456_6

>merge|NZ_CP021456|6|2386270-2386542|CRISPRCasFinder,CRT,PILER-CR
GGAAATGCCCCCACAGGCGTGGGGAATACTGGCTGAAAAGCGTGTGGGTGTAGGCACGGCCAGGATCACCCCCACACCTGTGGGGAATACTAATCCCATCTTCTTCACCCAAGCCAGAAAGTAGGATCACCCCCACACCTGTGGGGAATACGGCGTTCAGCGCTGTTAACAAAGCGGCTACTAAGGATCACCCCCACACCTGTGGGGAATACAGCAGATTATAAGCCCAGCAGGTAATACGGCTGGGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP021456|6|6|2386270-2386542|CRISPRCasFinder
GGAAATGCCCCCACAGGCGTGGGGAATAC	TGGCTGAAAAGCGTGTGGGTGTAGGCACGGCC
AGGATCACCCCCACACCTGTGGGGAATAC	TAATCCCATCTTCTTCACCCAAGCCAGAAAGT
AGGATCACCCCCACACCTGTGGGGAATAC	GGCGTTCAGCGCTGTTAACAAAGCGGCTACTA
AGGATCACCCCCACACCTGTGGGGAATAC	AGCAGATTATAAGCCCAGCAGGTAATACGGCT
GGGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP021456|6|5|2386271-2386542|CRT
GAAATGCCCCCACAGGCGTGGGGAATAC	TGGCTGAAAAGCGTGTGGGTGTAGGCACGGCCA
GGATCACCCCCACACCTGTGGGGAATAC	TAATCCCATCTTCTTCACCCAAGCCAGAAAGTA
GGATCACCCCCACACCTGTGGGGAATAC	GGCGTTCAGCGCTGTTAACAAAGCGGCTACTAA
GGATCACCCCCACACCTGTGGGGAATAC	AGCAGATTATAAGCCCAGCAGGTAATACGGCTG
GGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP021456|6|5|2386331-2386542|PILER-CR
AGGATCACCCCCACACCTGTGGGGAATAC	TAATCCCATCTTCTTCACCCAAGCCAGAAAGT
AGGATCACCCCCACACCTGTGGGGAATAC	GGCGTTCAGCGCTGTTAACAAAGCGGCTACTA
AGGATCACCCCCACACCTGTGGGGAATAC	AGCAGATTATAAGCCCAGCAGGTAATACGGCT
GGGATCACCCCCACACCTGTGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021456.1\|WP_110140008.1\|2385637_2386039_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_097546472.1\|2388308_2389085_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|272861
NZ_CP021456.1\|WP_043022877.1\|2390201_2390930_+\|DUF554-domain-containing-protein	unknown	unknown	gnl\|CDD\|377371
NZ_CP021456.1\|WP_110140014.1\|2398529_2398982_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021456.1\|WP_011668945.1\|2395433_2395955_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_CP021456.1\|WP_110140012.1\|2392056_2395173_-\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|370572
NZ_CP021456.1\|WP_110140009.1\|2387358_2388294_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|130256
NZ_CP021456.1\|WP_162551570.1\|2396685_2398470_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|380090
NZ_CP021456.1\|WP_110140005.1\|2379602_2379854_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP021456.1\|WP_021741690.1\|2386681_2387212_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP021456.1\|WP_110140010.1\|2389192_2390086_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP021456.1\|WP_110140004.1\|2376220_2378917_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|227268
NZ_CP021456.1\|WP_110140047.1\|2385081_2385414_+\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	unknown	unknown	unknown
NZ_CP021456.1\|WP_085763679.1\|2381725_2382709_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381309
NZ_CP021456.1\|WP_110140011.1\|2391040_2391955_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|260125
NZ_CP021456.1\|WP_110140006.1\|2382985_2384296_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NZ_CP021456.1\|WP_162551569.1\|2384768_2385059_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|273625
NZ_CP021456.1\|WP_110139267.1\|2380704_2381628_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP021456.1\|WP_043022616.1\|2379322_2379589_-\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|283241
NZ_CP021456.1\|WP_097545718.1\|2380065_2380482_-\|YjdF-family-protein	unknown	unknown	gnl\|CDD\|378596

Protein	Function_ID	Function_description	E-value
NZ_CP021456.1\|WP_011668945.1\|2395433_2395955_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	2.03886e-36
NZ_CP021456.1\|WP_097546472.1\|2388308_2389085_+\|ABC-transporter-permease	gnl\|CDD\|272861	TIGR00025, Mtu_efflux, ABC transporter efflux protein, DrrB family. The seed members for this model are a paralogous family of Mycobacterium tuberculosis. Nearly all proteins scoring above the noise cutoff are from high-GC Gram-positive organisms. The members of this paralogous family of efflux proteins are all found in operons with ATP-binding chain partners. They are related to a putative daunorubicin resistance efflux protein of Streptomyces peucetius. This model represents a branch of a larger superfamily that also includes NodJ, a part of the NodIJ pair of nodulation-triggering signal efflux proteins. The members of this branch may all act in antibiotic resistance.	1.90506e-17
NZ_CP021456.1\|WP_043022877.1\|2390201_2390930_+\|DUF554-domain-containing-protein	gnl\|CDD\|377371	pfam04474, DUF554, Protein of unknown function (DUF554). Family of uncharacterized prokaryotic proteins. Multiple predicted transmembrane regions suggest that the region is membrane associated.	1.45715e-63
NZ_CP021456.1\|WP_110140012.1\|2392056_2395173_-\|YfhO-family-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	1.17399e-72
NZ_CP021456.1\|WP_162551570.1\|2396685_2398470_+\|SH3-domain-containing-protein	gnl\|CDD\|380090	pfam18013, Phage_lysozyme2, Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.	4.05661e-35
NZ_CP021456.1\|WP_110140005.1\|2379602_2379854_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	7.36614e-11
NZ_CP021456.1\|WP_021741690.1\|2386681_2387212_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.04899e-15
NZ_CP021456.1\|WP_110140010.1\|2389192_2390086_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.21823e-33
NZ_CP021456.1\|WP_110140004.1\|2376220_2378917_-\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	1.84641e-31
NZ_CP021456.1\|WP_162551569.1\|2384768_2385059_+\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|273625	TIGR01439, Uncharacterized_protein_Mb2626, looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609. [Regulatory functions, DNA interactions].	5.26875e-08
NZ_CP021456.1\|WP_085763679.1\|2381725_2382709_+\|aldo/keto-reductase	gnl\|CDD\|381309	cd19083, AKR_AKR11A1_11D1, AKR11A and AKR11D families of aldo-keto reductase (AKR). Bacillus subtilis aldo-keto reductase IolS, also called vegetative protein 147 (VEG147), is a founding member of aldo-keto reductase family 11 member A1 (AKR11A1). It is able to reduce the standard aldo-keto reductase (AKR) substrates DL-glyceraldehyde, D-erythrose, and methylglyoxal in the presence of NADPH, albeit with poor efficiency in vitro. Bacillus aryabhattai aldo keto reductase is a founding member of aldo-keto reductase family 11 member D1 (AKR11D1).	1.57194e-167
NZ_CP021456.1\|WP_110140011.1\|2391040_2391955_-\|prenyltransferase	gnl\|CDD\|260125	cd13962, PT_UbiA_UBIAD1, 1,4-Dihydroxy-2-naphthoate octaprenyltransferase. Human UBIAD1 is an enzyme involved in the synthesis of MK-4. Menaquinones (MKs, also called bacterial forms) are one of the two forms of natural vitamin K, the other being the plant form, phylloquinone (PK). All forms of vitamin K have a 2-methyl-1,4-naphthoquinone (menadione; K3) ring structure in common. At the 3-position of the ring, PK has a phytyl side chain while MKs have several repeating prenyl units. Prenyltransferases (PTs) catalyze the regioselective transfer of prenyl moieties onto a wide variety of substrates and play an important role in many biosynthetic pathways.	1.87085e-57
NZ_CP021456.1\|WP_110140006.1\|2382985_2384296_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	1.91598e-143
NZ_CP021456.1\|WP_110140009.1\|2387358_2388294_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	1.44304e-107
NZ_CP021456.1\|WP_097545718.1\|2380065_2380482_-\|YjdF-family-protein	gnl\|CDD\|378596	pfam11208, DUF2992, Protein of unknown function (DUF2992). This bacterial family of proteins has no known function. However, the cis-regulatory yjdF motif, just upstream from the gene encoding the proteins for this family, is a small non-coding RNA, Rfam:RF01764. The yjdF motif is found in many Firmicutes, including Bacillus subtilis. In most cases, it resides in potential 5' UTRs of homologs of the yjdF gene whose function is unknown. However, in Streptococcus thermophilus, a yjdF RNA motif is associated with an operon whose protein products synthesize nicotinamide adenine dinucleotide (NAD+). Also, the S. thermophilus yjdF RNA lacks typical yjdF motif consensus features downstream of and including the P4 stem. Thus, if yjdF RNAs are riboswitch aptamers, the S. thermophilus RNAs might sense a distinct compound that structurally resembles the ligand bound by other yjdF RNAs. On the ohter hand, perhaps these RNAs have an alternative solution forming a similar binding site, as is observed with some SAM riboswitches.	1.67626e-37
NZ_CP021456.1\|WP_043022616.1\|2379322_2379589_-\|CsbD-family-protein	gnl\|CDD\|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	0.000376951
NZ_CP021456.1\|WP_110139267.1\|2380704_2381628_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.38462e-76

>NZ_CP021456.1|WP_110140008.1|2385637_2386039_+|hypothetical-protein
MIAIKQQLSSMKPIQLADINALVTDSSALTTLAEAIHYSKADEYTDIKDGYTYRTAIETEGIYVLDHFVADDQHYWTVDYGDTNSGGLNLTNVNPFDPVNIIKHQILAEIYPIYYRIVQCELDCRKSSNLTHL
>NZ_CP021456.1|WP_110140047.1|2385081_2385414_+|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin
MDIAIADVPYDDGKTFKTRPALLVSIDGQQATVFKITTKYEEKSEAIKKFYYPIEFWREAGLDKASFVDTHMTYTLATEFMLKNPPIGVLTDTDVIKLFNFIKANQKDSV
>NZ_CP021456.1|WP_162551569.1|2384768_2385059_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MMEKKRAQKVFNVKLSTKGQIVIPAEIRKMINISGGNTLQVTLDETNAIKIQKKPTALDWSNLIAGIPNEVVTFNENGTVNTSKSPNFAKWMNEDE
>NZ_CP021456.1|WP_110140006.1|2382985_2384296_+|NCS2-family-permease
MQRIANFFHFEELGTNYKTEMLAGLTTFVSMAYILFVNPQVLGASGISQGAVFTATAFASAFGCMLMGILANYPIAISASLGINAFFAYSVVIGMKVPWQTALAGVFVASILFMILTAFKLREKVVDAIPRDLKMAISAGIGLFIAFIGLSQGGLVVADKSTIVSLGSLQVGSTWLTIFGLLVTVLLMSARVPGAIFIGMVANSILGLVTGLIPMPSHIVAAVPSISSTFMVGLTHVGSINSLQMIVVVLTFLLVTFFDTTGTLVGLAEQAGLVKNNKLPRIGKALMADSSTMVVGSLLGTSPMGAFVESSAGIAVGGRTGFTAIVTGVLFIFGAFFSPLLAVVTDQVTAPALIIVGVLMAQSLKNIHWEKFEVAAPAFLIVLGMPLTYSISDGIALGFITYPLTMLAAKRGKEVGAMMYGLAVVFVLFLWILNAA
>NZ_CP021456.1|WP_085763679.1|2381725_2382709_+|aldo/keto-reductase
MTHELVTIGKTDVRTTPLGLGTNAVGGYNLFPNLKDDDGLNLVKAGLNHGIQLLDTAFVYGLGHSEELVGQAMHDFDRHSFTLATKGAQDFSSGEQVINNDPAFLTAQVDASLKRLNTDYLDIYYIHFPDKQTPKAEAVGALQRLREQGKIRAIGLSNFSLAQIKEANADGYVDVVEDEFSLLHRDHEADLMPYLADHQISFVPYFPLASGLLTGKYDQSVQFPADDIRSQISDFQEPRYSQALTAIDQVRPIAQAHQATVAQTVLAWYMQNPLVSVVIPGAKRAAQVEANAQALEVTLTAAEYQTIDTAFAGFKTTANGKSLADPD
>NZ_CP021456.1|WP_110139267.1|2380704_2381628_+|IS30-family-transposase
MSTTILSFQNRVVIETLHNEGRSLRYIANYLGFSKTTIFNELHRLNSEYQAGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAYKTVYNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNYGRSIEERPHKVETRQEFGHFEADTVLSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERRTCTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQINWYLNSRPLKCLNWHTPIEIFLLNLRH
>NZ_CP021456.1|WP_097545718.1|2380065_2380482_-|YjdF-family-protein
MVIHSKLTVFFDQAFYRGVFERWTPTGYQVARVTFGTQPPSAPQLQQVIWQRWPTLQWTAPTRVVVSETHHRVKQRQRAAQRELKQHGARQRATVLLKTEHRQNLQLKKQRQRQARVQHAAVVRQKQQAKRLAKRRGH
>NZ_CP021456.1|WP_110140005.1|2379602_2379854_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MFGWLWSLIVGAIIGAIAGAITNRGASMGWIANILAGLIGSWLGQSLLGSWGPSLAGIALVPSILGAIILVLIVSAVVGSRHK
>NZ_CP021456.1|WP_043022616.1|2379322_2379589_-|CsbD-family-protein
MKNLVLGISLATNVALAYLLMQDKDQLKELQSRADNAADKVVGKAEQIKGAITGDTGDKLKGNWDEGKGEAKDLVDDVRKDFETGSED
>NZ_CP021456.1|WP_110140004.1|2376220_2378917_-|LPXTG-cell-wall-anchor-domain-containing-protein
MRLNNLRTWLMGTAAVLTFFVANETADAATTTTSTTASETTRTSSSSIAAKRVALRQTTSSVEESSANAQASSAAQSASGDVSMAKTTSSEPATSSASSTTAGHATSVADATKTVSADTTAKSQGTTATDQITSQSSSVRAKNEQAQTQNKQQMTRMYSGVITSQKGSSAAAITVNKAAVLPAKMLLNLSRASLVKESTSVEGLNAADTTVTDDQGVTYNATDELSLYANYNATYHWTIADGVKVAAGSTATVTLPDNVAFTTGTRIDLKKADGTVVGTVTAEAGSHTGTLTFNDYFANNDSQNRQGDLTFYVTGTSATVGHNTSSINKVGWADSDSLDAGIPTKMFWQVVANINSAKWQQVKIVDQLGLYQTHEGTMTLETGYYTDGAFVKDAALGTYDFATQQFTYAEGVSDPQVTVKVEGQQMTITIDHLETAVNLFYEVGLTVGHTYANNASVTYTTPGTGSADPDPGDGSSTDEPKTEQSNTAVKFGGSGTASDEVKSYSLLVTKTDDAGQPVAGATYQLETGGGVILRTDLVTDESGQLRIGNLSAGSYVLVETKAPNGYQLDSTRHEFDVSSATTNIVTDSVVDHRISQTALTVNKVWAGVPTGVQTPSVEVTLQRNGQDYRTLQLTAANGYTGTFDQLDVTDVNGQPYTYTVVETALAGYTSSQTTSGQTVTITNTYQTGQLTVVKMDASGKNYLAGAVFTIENATGEIVAKLTTDATGRAQLTGLAQGTYKVTEVQAPVGYLINPQAQTVTLDATTHYQGQIVFADENEPSEPSEPSEPSEPNEPSEPSEPNEPSEPSDSKVKVPTPAVPTQADKVNDLTGGATVEIGNGQPTAAQTGKSAVELNKHANSTGAKSTQLPQTSEQPANWPAILGWLILGLTVVVYRRRAD
>NZ_CP021456.1|WP_021741690.1|2386681_2387212_-|MarR-family-transcriptional-regulator
MSDLFKQETTASKLIEFGMLRHVADDIADRDDDHPERQMIFQGQGKILLALMQEDHLAQKELAERLNLTAQSTAEFVRKLEKKGFVTRMKSPTDQRVTVVSITDAGRKETTKNVQQIPPFLTILDDTELDQLSHILDKINQHMYEEVNAANPTWFNKFHQVIMNRMLSQLHSGEDR
>NZ_CP021456.1|WP_110140009.1|2387358_2388294_+|ATP-binding-cassette-domain-containing-protein
MQTSTAITVSHLTKTFGAKTVVDDLSFAVKPGEVFGLLGPNGAGKTTTLRMITTLLKATSGTVTIFGHDVRQESRLARAMFGLTGQYASVDEDISARENLMIFSRLNGLSRTAAKQRTTELLEEFSLTASADKALSGFSGGMRRRLDLAVSLITRPALLFLDEPTTGLDPRTRSQMWTTIRQLVAHGSTIVLTTQYLDEADALADRVAVIDHGKLIKLGTPTALKQQIGGATLTLSLAKATQGPLAQHLLAQALHAQPTLHGAQLTTHLENPNQITDLLVQLQAADISLANIAVQEPTLDDVFFALTTGKN
>NZ_CP021456.1|WP_097546472.1|2388308_2389085_+|ABC-transporter-permease
MEIQTQPGNLIGNTLTMAYRNLLKTLHNPDRFMDVIIQPVMFMLLFGYLFGGAIAGGVQAYLPTIVPGILIQTLLSAASGSGAQIREDLDSGVFDRFKSLPMAHIAPLAGQLFADILRLLVATVVSLLTGYAMGWRPAVNFGWIIVIAALAIFIGWAISWIFALFGLLAKSSSMVQSVSMMVMMLLSFLSNAFIPLKTLPHFMRVIADANPITYVITAIRQILAQGTWNTNAWIVLIFGIGIVALFAPLTVWAYNHNN
>NZ_CP021456.1|WP_110140010.1|2389192_2390086_-|LysR-family-transcriptional-regulator
MDTRKLAVFVDLAETRNYSWSAERLFLAQSTISKDIMALEKAWQVKLFIRAHRQVRLTRVGELLLPKVKAVLQREAELNQAITDQSWLGERPLVIQGLPSLPQYQAFHIMSRFAKRYPNVKLKFSEAGVDKLAHALDQKNVDIVFTRIFTTTFPNYDVLTNEQDQFVVLVPKQNPLARQPAISLEMLQSQSILLLRNTISKTNPLFKPFQAMKLHPHMTYDGQRVELLLEMLNQGTGVSVVMARSFDLAGFDNIRVVPLIPKVTSQLAFMKRRDNPSALVELFWQFATAETATLMSK
>NZ_CP021456.1|WP_043022877.1|2390201_2390930_+|DUF554-domain-containing-protein
MPIGIITNVGAIFLGGIVGALSGEHMSDEFKTGLNMAFSICSICMGIYAIAPLKNLAAVIFAVIIGTSLGILLHLGQAINRGAQGMQHFISRFITGPSHLDQKLFETTLVTIIVLFCASGTGIYGTLTEGISGDATILISKSILDFFCAIIFGANLGAVVSLIAVPQFVILMIIFLLAQFIVPLTTPDMIRDFKAAGGVLMLASGFRITKIEMFPTADMIPIMLVIMPISWLWTTVIMPIIH
>NZ_CP021456.1|WP_110140011.1|2391040_2391955_-|prenyltransferase
MPKWLNWSVFYELTEIYTAPLNVMWFILGAAIAQYHVHTVDWINVGLCLAVVFIFDLAVNVADNYYDYLHAHDREDYAQKTNPIGRLHLPAKGVFWLAWVLYAVAAIPGIVLVMRTGWSVAVFGVVGYLIGIFYTAGPHPINATPVSAAVVALAIAFWIQLTCVYVSIYGQQPLSWSIVGTTFLLCMPLTLIFFTVQLANDTSDRDEDIANHRYTLAVYLGKRRSVRLIQLFLVIGTLWTLVNVGLGLAPLVTALAVILLPVMWRGMRPFFAIQDKRKTFMAMVKSASLFFIAYPVLFALGTWL
>NZ_CP021456.1|WP_110140012.1|2392056_2395173_-|YfhO-family-protein
MRIAHHRWPLWVLYTLAFAVIAAISFGIFGVANRTLIWNMDGITQHYPLIREFHQLLMKSGLAGVTGWSWTFGLGADKLTTLAYYVLGDPFAYVLALLPTRLLEVGYGGAIVLRLYAAGLAFLVLAKRYAFKPGSQLVGAVTYAFTGYSLMVGVHHPFFLLPMIWLPLLFVGIDRILQGKGWGFLAAVTGITILSNFYFAYILGLGSLIYALIRYFSCRERGQLAVSWLVATARFLAAAVTGLMISGVLLLPSLLMMLKSTRTVSIFANGLWLYPLNYYLTLSNTILTTGNTLNYWAVLGITGFGFLGCVYTLVHWRQHRWLAITLLAVIVGLLFPAVAAFFNVLSTPSNRWILLAAVPFGLALMTLMDHLTALSLPDRWWLLGSSLGLLVVIYLSNGFTFSNPARDLLTYGLLLATTLLVVVALPRRWTFGGIGILIGLNLINNAWGYYDPNLSNQATQQLRVSDATRYIQDYFDGAQSAVQSDHAFSRVSATRNYNLFRTVGNNMTMSRGLHGIMSYFSVQNGYVGQFSRDLGNAEYAMNAPMGQADGRTTLTQLLGVKYLFARTDQVTNHAALPYGYRAAKKIYPEQPVYGLSNGVGTQVLTTNLAFPLVYTQPQVLTTKAWHRLSLVDRERSLTQAAVMSQPVAGVKAAHYQSPKRTLAYTVTPDTIPVIDSTNKVIQYRLKQAAAGQKTGLNDKQLATYGTTIQTPQLTVDKNGLLSKQEVQQYGPMVQLTRNQAALQRVLTHNQQIIQRTTQANQTGLHQLTSDAQGQPIKYTVTLKHPQQAQGTELYLELDGISSQQLTTKDQLQTADNTSVLGNTPRSNLTKLNAWRTAISNPDLGDYWVTAKTRNATKTFSQFGLDNLSDYEPKHQVLLNLGYSQQLRKTIDVTFNATKQLNIKSAKLIAVPFGARYDQQVHAVQRRGLQHAQIRDNAVTGELTTPQASVMTTSIPYSSGWRLTVDGRPTATTVVNEGFVGARLAAGTHRIRLTYRTPGLIGGLILTIVGLVVWLGEMSWWHWRHPQAKTHAAKSKSDA
>NZ_CP021456.1|WP_011668945.1|2395433_2395955_+|QueT-transporter-family-protein
MNSKKRVSGVSDTRSMVLAALIAALYVVLTTVLSALSFGPFQIRLSEMFNHLVVFNKRYIAAVTLGVFIANIIASPFGFLDIATGTIQTLLALLVMYWLSKFVHNRIAQMAINTVVAVFFMCMIAWEIAIVSKTAFWPTFWANWLSIGWGELVSMIFGGVVIYLLSLKIDFTK
>NZ_CP021456.1|WP_162551570.1|2396685_2398470_+|SH3-domain-containing-protein
MSTEVADISSYQDDSLAFMQSLAVYAKSIIVKITQGSATGDAYVNPKAKAQVANGLKVFKTVGAYHYFKGNSQKYGDSDPINEAKWFDKNLQAVGLDKSTVCAIDVEDAVVMQSATHDINLFLQYMSQQGYKHLVVYASASWFTSGRINKTQLFNGTPIWVAAYNNVEPGVDNASAWQYTDNGHGLHVDFSYDFDGTLLGEVTSTGTGAGTTTPVQPTDALHQHAAQVYNYFHAKGLSDAAICGILGNFQHESAINPAQWQLGMPHTWSMSSSTGYGIAQFTPAGKIKAYADKLGKSVSNMTVQLDYIWGQVTTNGFYGGDKTFKQFARDTNPQTAAVDFLRGYEMHTMISDALAAREKYAANWWTIYNKGNAGTFGVNTRKMNTATAQATPDGYSIDISGAFTFDTSCAVRNTPKMSDAGVATYTDGDTVNYDKKLKTDDHFWLSYVSASGVRRYVPYANTTTGVYFGSDTNPKDPISTDSETGSAGTTTGTTTAGGTAETTPEMYTISATGAFTFNTNCRVRNTPVMSDTGVATYTTGMTVNYDTKLKNDNHFWLSYLSASGVRRYVPYGNISKGTYFGTDTNPKDPIKPAE
>NZ_CP021456.1|WP_110140014.1|2398529_2398982_+|hypothetical-protein
MPNPLYNSVDYTATIKKTREFLADYHMWHVEAAHFSSWVKSPSNFGTPSYHSTENTVENRVVDQANAQFECELRTKTLEQLATVDNESALLSDLLLFRWINNWSVKKTCTELAEKYQRGFIAERTYANYLKKALWEFAVICPRDLFVQKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021456_1	1.2\|115837\|33\|NZ_CP021456\|CRISPRCasFinder	115837-115869	33	NZ_KJ868092	UNVERIFIED: Lactobacillus pentosus strain F03 plasmid pF03-5, complete sequence	684-716	0	1.0
NZ_CP021456_1	1.10\|115838\|32\|NZ_CP021456\|CRT	115838-115869	32	NZ_KJ868092	UNVERIFIED: Lactobacillus pentosus strain F03 plasmid pF03-5, complete sequence	684-715	0	1.0
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	KJ868088	Lactobacillus pentosus strain F03 plasmid pF03-1, complete sequence	3081-3113	0	1.0
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	KJ868088	Lactobacillus pentosus strain F03 plasmid pF03-1, complete sequence	3081-3112	0	1.0
NZ_CP021456_3	3.9\|1238655\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238655-1238687	33	NZ_CP018797	Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence	3217-3249	0	1.0
NZ_CP021456_3	3.9\|1238655\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238655-1238687	33	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	12780-12812	0	1.0
NZ_CP021456_3	3.9\|1238655\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238655-1238687	33	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	35456-35488	0	1.0
NZ_CP021456_3	3.9\|1238655\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238655-1238687	33	CP002036	Lactobacillus salivarius CECT 5713 plasmid pHN2, complete sequence	12785-12817	0	1.0
NZ_CP021456_3	3.9\|1238655\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238655-1238687	33	NZ_AP014681	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-1, complete sequence	54127-54159	0	1.0
NZ_CP021456_3	3.9\|1238655\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238655-1238687	33	NZ_LN898145	Lactobacillus oligofermentans DSM 15707 = LMG 22743 isolate LACOL plasmid II, complete sequence	33201-33233	0	1.0
NZ_CP021456_3	3.12\|1238658\|29\|NZ_CP021456\|PILER-CR	1238658-1238686	29	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	12781-12809	0	1.0
NZ_CP021456_3	3.12\|1238658\|29\|NZ_CP021456\|PILER-CR	1238658-1238686	29	CP002036	Lactobacillus salivarius CECT 5713 plasmid pHN2, complete sequence	12786-12814	0	1.0
NZ_CP021456_3	3.12\|1238658\|29\|NZ_CP021456\|PILER-CR	1238658-1238686	29	NZ_CP018797	Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence	3220-3248	0	1.0
NZ_CP021456_3	3.12\|1238658\|29\|NZ_CP021456\|PILER-CR	1238658-1238686	29	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	35459-35487	0	1.0
NZ_CP021456_3	3.12\|1238658\|29\|NZ_CP021456\|PILER-CR	1238658-1238686	29	NZ_AP014681	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-1, complete sequence	54130-54158	0	1.0
NZ_CP021456_3	3.12\|1238658\|29\|NZ_CP021456\|PILER-CR	1238658-1238686	29	NZ_LN898145	Lactobacillus oligofermentans DSM 15707 = LMG 22743 isolate LACOL plasmid II, complete sequence	33204-33232	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	43138-43167	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP025208	Lactobacillus sakei strain WiKim0074 plasmid pLSW74_2, complete sequence	6880-6909	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP032650	Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence	17393-17422	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP028232	Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence	38291-38320	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_AP017932	Lactobacillus sakei strain LK-145 plasmid pLs145-a, complete sequence	11133-11162	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP022710	Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence	49388-49417	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP015967	Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence	4678-4707	0	1.0
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP025416	Lactobacillus plantarum strain X7021 plasmid unnamed4, complete sequence	27567-27596	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_018222	Enterococcus faecalis D32 plasmid EFD32pA, complete sequence	6321-6350	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP011284	Enterococcus faecium strain E39 plasmid p4, complete sequence	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	82622-82651	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX810026	Enterococcus faecium strain Efm0038 plasmid pJEG043, complete sequence	21534-21563	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX579977	Enterococcus faecalis strain EF123 plasmid pEF123, complete sequence	2588-2617	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX579977	Enterococcus faecalis strain EF123 plasmid pEF123, complete sequence	76570-76599	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX810025	Enterococcus faecium strain Efm008 plasmid pJEG040, complete sequence	32616-32645	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX574671	Enterococcus faecium strain V24 plasmid pHvH-V24, complete sequence	23290-23319	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	44612-44641	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX274135	Staphylococcus arlettae strain SA-01 plasmid pSA-01, complete sequence	52735-52764	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK798157	Enterococcus hirae strain fas4 plasmid pfas4-1, complete sequence	4669-4698	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KJ645709	Enterococcus faecium strain P26 plasmid pXD5, complete sequence	25216-25245	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KJ645709	Enterococcus faecium strain P26 plasmid pXD5, complete sequence	31378-31407	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KP842560	Enterococcus faecium strain 17i48 ST17 plasmid pRUM-like, complete sequence	21378-21407	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KR066794	Enterococcus faecium strain Efm0123 plasmid pJEG050, complete sequence	7361-7390	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041740	Enterococcus faecalis EnGen0107 strain B594 plasmid p2, complete sequence	43619-43648	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	HF570055	Lactobacillus reuteri 1063 plasmid pLUL631, complete sequence	3498-3527	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LT603681	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 4	23964-23993	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP022486	Enterococcus faecalis ARO1/DG plasmid pARO1.3, complete sequence	8375-8404	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028725	Enterococcus faecalis strain CVM N60443F plasmid pN60443F-2, complete sequence	12730-12759	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028726	Enterococcus faecalis strain CVM N60443F plasmid pN60443F-1, complete sequence	11825-11854	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_004669	Enterococcus faecalis V583 plasmid pTEF1, complete sequence	6820-6849	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_003528	Lactobacillus reuteri plasmid pTE44, complete sequence	734-763	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018831	Enterococcus faecium strain ISMMS_VRE_9 plasmid p2_ISMMS_VRE9, complete sequence	3841-3870	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP026081	Staphylococcus aureus strain FDAARGOS_12 plasmid unnamed	14672-14701	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_021170	Enterococcus faecium plasmid pF856, complete sequence	26114-26143	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	28356-28385	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK784777	Enterococcus faecalis strain E211 plasmid pE211-2, complete sequence	63696-63725	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK784777	Enterococcus faecalis strain E211 plasmid pE211-2, complete sequence	80509-80538	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK784777	Enterococcus faecalis strain E211 plasmid pE211-2, complete sequence	87268-87297	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	40671-40700	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP025078	Enterococcus faecium strain LS170308 plasmid unnamed, complete sequence	19563-19592	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041269	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R4, complete sequence	15023-15052	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_014726	Enterococcus faecalis plasmid pTW9, complete sequence	50213-50242	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_014726	Enterococcus faecalis plasmid pTW9, complete sequence	57489-57518	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP013996	Enterococcus faecium strain 6E6 plasmid unnamed2, complete sequence	40067-40096	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP014452	Enterococcus faecium strain ATCC 700221 plasmid unnamed3, complete sequence	11324-11353	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018072	Enterococcus faecium strain VRE001 plasmid unnamed2, complete sequence	20510-20539	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027519	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence	46009-46038	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027500	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed3, complete sequence	22511-22540	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027509	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed3, complete sequence	33289-33318	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027510	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed4, complete sequence	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027505	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed4, complete sequence	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135300	Enterococcus faecium isolate E7429 plasmid 4	18939-18968	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135289	Enterococcus faecium isolate E7199 plasmid 3	44743-44772	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135290	Enterococcus faecium isolate E7199 plasmid 4	3719-3748	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135335	Enterococcus faecium isolate E7471 plasmid 5	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135342	Enterococcus faecium isolate E7356 plasmid 4	20069-20098	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC377536	Staphylococcus aureus plasmid pNTUH_9448 NTUH_9448 DNA, complete sequence	17944-17973	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC377537	Staphylococcus aureus plasmid pNTUH_1027 NTUH_1027 DNA, complete sequence	26667-26696	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC377538	Staphylococcus aureus plasmid pNTUH_3874 NTUH_3874 DNA, complete sequence	32940-32969	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC377539	Staphylococcus aureus plasmid pNTUH_6457 NTUH_6457 DNA, complete sequence	12787-12816	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC377540	Staphylococcus aureus plasmid pNTUH_5066148 NTUH_5066148 DNA, complete sequence	29784-29813	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_012628	Lactobacillus plantarum plasmid pLFE1, complete sequence	1112-1141	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP046078	Enterococcus faecium strain VRE plasmid p4_03A17012, complete sequence	25394-25423	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	39125-39154	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	41409-41438	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	6707-6736	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	55332-55361	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	116375-116404	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	134570-134599	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP025755	Enterococcus faecium strain AALTL plasmid pEFA-790c, complete sequence	5520-5549	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027516	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed4, complete sequence	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_015213	Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence	1567-1596	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135247	Enterococcus faecium isolate E6988 plasmid 5	40748-40777	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135281	Enterococcus faecium isolate E6975 plasmid 4	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135283	Enterococcus faecium isolate E6975 plasmid 6	4177-4206	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	83364-83393	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	126917-126946	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	9057-9086	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135239	Enterococcus faecium isolate E7067 plasmid 5	20316-20345	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135200	Enterococcus faecium isolate E6055 plasmid 4	28470-28499	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135260	Enterococcus faecium isolate E4457 plasmid 3	29900-29929	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP034168	Enterococcus avium strain 352 plasmid unnamed, complete sequence	81511-81540	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_011996	Macrococcus caseolyticus JCSC5402 plasmid pMCCL2, complete sequence	46712-46741	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	83424-83453	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_004532	Lactobacillus reuteri endogenous plasmid, complete sequence	894-923	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	29832-29861	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP019210	Enterococcus faecium strain 2014-VREF-41 plasmid p41-2, complete sequence	2043-2072	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP015818	Staphylococcus aureus strain FORC_039 plasmid unnamed, complete sequence	9421-9450	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_005000	Enterococcus faecium U37 plasmid pRUM, complete sequence	13159-13188	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_013319	Staphylococcus aureus plasmid pI258, complete sequence	19518-19547	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018764	Pediococcus acidilactici strain BCC1 plasmid pbcp1, complete sequence	5238-5267	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	184004-184033	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135430	Enterococcus faecium isolate E8927 plasmid 3	2237-2266	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135437	Enterococcus faecium isolate E8691 plasmid 3	3494-3523	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	138496-138525	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135484	Enterococcus faecium isolate E4456 plasmid 3	42998-43027	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135477	Enterococcus faecium isolate E8423 plasmid 3	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	86999-87028	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	58398-58427	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135230	Enterococcus faecium isolate E7025 plasmid 5	589-618	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP022823	Enterococcus saigonensis strain VE80 plasmid pVE80-1, complete sequence	12262-12291	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	980-1009	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135366	Enterococcus faecium isolate E8195 plasmid 3	28526-28555	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135403	Enterococcus faecium isolate E8377 plasmid 3	52177-52206	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135396	Enterococcus faecium isolate E8290 plasmid 3	33490-33519	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP024844	Streptococcus iniae strain FP5228 plasmid unnamed1, complete sequence	10923-10952	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	50081-50110	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_021988	Enterococcus faecium Aus0085 plasmid p3, complete sequence	7361-7390	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135346	Enterococcus faecium isolate E8202 plasmid 3	39984-40013	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135327	Enterococcus faecium isolate E7654 plasmid 4	26956-26985	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	182255-182284	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135387	Enterococcus faecium isolate E7933 plasmid 4	6576-6605	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135320	Enterococcus faecium isolate E7663 plasmid 4	15553-15582	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	68920-68949	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP036247	Enterococcus faecalis R712 plasmid pR712_01, complete sequence	55552-55581	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	2946-2975	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	30474-30503	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP011830	Enterococcus faecium strain UW8175 plasmid unnamed2, complete sequence	7414-7443	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	57854-57883	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP019396	Enterococcus faecium strain QU 50 plasmid pQS50, complete sequence	7237-7266	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LN999989	Enterococcus faecium isolate EFE11651 plasmid III, complete sequence	24805-24834	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP049776	Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence	75038-75067	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP049776	Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence	82260-82289	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	10987-11016	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	180494-180523	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028836	Enterococcus faecalis strain FC plasmid unnamed1, complete sequence	37839-37868	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028836	Enterococcus faecalis strain FC plasmid unnamed1, complete sequence	41965-41994	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028836	Enterococcus faecalis strain FC plasmid unnamed1, complete sequence	48530-48559	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_019687	Clostridium perfringens plasmid pCpb2-CP1, complete sequence	63616-63645	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_020237	Staphylococcus hyicus plasmid pSTE1 complete sequence	4563-4592	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_006978	S.pyogenes plasmid pMD101 DNA	8365-8394	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_002136	Streptococcus agalactiae plasmid pGB3634, complete sequence	4950-4979	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP023426	Enterococcus faecium strain K60-39 plasmid pTT39_p3, complete sequence	22093-22122	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	55714-55743	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	155337-155366	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_014959	Enterococcus faecium plasmid pS177, complete sequence	34009-34038	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC102479	Staphylococcus aureus plasmid pNTUH_3874 DNA, complete sequence, strain: NTUH_3874	7139-7168	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041279	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S4	15066-15095	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP044494	Streptococcus mutans strain MD plasmid unnamed1, complete sequence	892-921	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP044494	Streptococcus mutans strain MD plasmid unnamed1, complete sequence	9961-9990	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040708	Enterococcus faecium strain HOU503 plasmid p2	29310-29339	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_013963	Bacillus sp. BS-01 plasmid pBS-01, complete sequence	13944-13973	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	488-517	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP044276	Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence	36733-36762	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP017795	Enterococcus faecium strain E240 plasmid unnamed3, complete sequence	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP019995	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-3	33064-33093	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	213850-213879	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	213724-213753	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_004566	Lactobacillus fermentum plasmid pLME300	10988-11017	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	13475-13504	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028286	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed1, complete sequence	68558-68587	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_017962	Enterococcus faecium DO plasmid 2, complete sequence	46654-46683	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP020355	Staphylococcus aureus strain FORC59 plasmid pFORC59, complete sequence	3893-3922	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	13497-13526	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP042214	Enterococcus faecalis strain L15 plasmid pL15, complete sequence	58660-58689	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP042217	Enterococcus faecalis strain L8 plasmid pL8, complete sequence	16399-16428	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP019972	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-2 sequence	119429-119458	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	101853-101882	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP037957	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_2, complete sequence	15980-16009	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	23206-23235	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135310	Enterococcus faecium isolate E7240 plasmid 4	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135311	Enterococcus faecium isolate E7240 plasmid 5	27059-27088	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	153990-154019	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	158480-158509	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	46189-46218	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	159713-159742	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP033211	Enterococcus faecium strain RBWH1 plasmid pRBWH1.5, complete sequence	488-517	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018539	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence	51140-51169	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018539	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence	74163-74192	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	10187-10216	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	58004-58033	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018131	Enterococcus faecium strain A_020709_82 plasmid unnamed3, complete sequence	6680-6709	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP019410	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20S, complete sequence	36872-36901	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP016166	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence	470-499	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018825	Enterococcus faecium strain ISMMS_VRE_12 plasmid p2_ISMMS_VRE12, complete sequence	3841-3870	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_010540	Lactococcus garvieae plasmid pKL0018 DNA, complete sequence	5903-5932	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_010540	Lactococcus garvieae plasmid pKL0018 DNA, complete sequence	18674-18703	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	161772-161801	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP038162	Enterococcus faecium strain GZ8 plasmid pGZ8, complete sequence	20219-20248	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP038176	Enterococcus faecium strain HN11 plasmid pHN11, complete sequence	10109-10138	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_013514	Enterococcus faecalis plasmid pAMbeta1, complete sequence	6898-6927	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MH277333	UNVERIFIED: Listeria monocytogenes strain nh1 plasmid, complete sequence	54641-54670	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP012464	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p4, complete sequence	32927-32956	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP012431	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p2, complete sequence	32622-32651	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH784601	Enterococcus faecium strain 25 plasmid pC25-1, complete sequence	22352-22381	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH784602	Enterococcus faecium strain 27 plasmid pC27-2, complete sequence	22361-22390	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MK140641	Enterococcus faecalis strain E035 plasmid pE035, complete sequence	4756-4785	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MK140641	Enterococcus faecalis strain E035 plasmid pE035, complete sequence	20255-20284	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MK140641	Enterococcus faecalis strain E035 plasmid pE035, complete sequence	27678-27707	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041081	Bacillus tropicus strain LM1212-W3 plasmid p8, complete sequence	1309-1338	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP014240	Selenomonas sp. oral taxon 136 plasmid unnamed1, complete sequence	15280-15309	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP023796	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.2, complete sequence	3178-3207	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028728	Enterococcus faecium strain FSIS1608820 plasmid pFSIS1608820, complete sequence	8723-8752	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP028728	Enterococcus faecium strain FSIS1608820 plasmid pFSIS1608820, complete sequence	27864-27893	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MF477836	Macrococcus canis strain KM0218 plasmid pKM0218, complete sequence	70912-70941	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH431899	Staphylococcus chromogenes strain Sch-734Lar plasmid pSch-734Lar, complete sequence	3924-3953	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH465666	Staphylococcus aureus strain Sau-392Lar plasmid pSau-392Lar, complete sequence	7241-7270	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MG957432	Enterococcus faecium strain 37BA plasmid pEf37BA, complete sequence	823-852	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH785229	Staphylococcus aureus strain pa3 plasmid pPA3, complete sequence	4884-4913	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH785233	Staphylococcus aureus strain ph2 plasmid pPH2, complete sequence	8077-8106	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK465703	Enterococcus faecium strain E505 plasmid pE505-1, complete sequence	18923-18952	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK465703	Enterococcus faecium strain E505 plasmid pE505-1, complete sequence	35360-35389	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK465703	Enterococcus faecium strain E505 plasmid pE505-1, complete sequence	42596-42625	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK465704	Enterococcus faecium strain E211 plasmid pE211-2, complete sequence	8369-8398	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK465704	Enterococcus faecium strain E211 plasmid pE211-2, complete sequence	15128-15157	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK465704	Enterococcus faecium strain E211 plasmid pE211-2, complete sequence	79340-79369	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK784778	Enterococcus faecalis strain E508 plasmid pE508-2, complete sequence	32217-32246	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK784778	Enterococcus faecalis strain E508 plasmid pE508-2, complete sequence	39453-39482	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK784778	Enterococcus faecalis strain E508 plasmid pE508-2, complete sequence	55890-55919	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LT598667	Enterococcus faecium isolate Ef_aus00233 plasmid 5	13301-13330	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN270279	Streptococcus phage phi-SsuZKB4_rum, complete genome	107837-107866	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN270276	Streptococcus phage phi-SsuSSJ28_rum, complete genome	2721-2750	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	FN997652	Streptococcus phage phi-SsUD.1 complete sequence	61052-61081	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	KT336321	Streptococcus phage phiSC070807, complete genome	57122-57151	0	1.0
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN270273	Streptococcus phage phi-SsuSC05017_rum, complete genome	57075-57104	0	1.0
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	17637-17668	0	1.0
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	16092-16123	0	1.0
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	17637-17669	0	1.0
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	16092-16124	0	1.0
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_025160	Lactobacillus paraplantarum plasmid pC7, complete sequence	157-189	1	0.97
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_014164	Lactobacillus acidipiscis cryptic plasmid pLAC1, complete sequence, strain ACA-DC 1533	3207-3239	1	0.97
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_025160	Lactobacillus paraplantarum plasmid pC7, complete sequence	157-188	1	0.969
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_014164	Lactobacillus acidipiscis cryptic plasmid pLAC1, complete sequence, strain ACA-DC 1533	3207-3238	1	0.969
NZ_CP021456_5	5.3\|2319405\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319405-2319434	30	NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	2450-2479	1	0.967
NZ_CP021456_5	5.5\|2319537\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319537-2319566	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	13827-13856	1	0.967
NZ_CP021456_5	5.5\|2319537\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319537-2319566	30	NZ_CP014925	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-1, complete sequence	17324-17353	1	0.967
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP046038	Lactobacillus sakei strain CBA3614 plasmid unnamed1, complete sequence	25884-25913	1	0.967
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_LT907984	Lactobacillus sakei subsp. sakei 23K plasmid pJ23A1, complete sequence	13145-13174	1	0.967
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_LT907987	Lactobacillus sakei strain T332 plasmid p332A2, complete sequence	12863-12892	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_004992	Leuconostoc lactis plasmid pCI411, complete sequence	1000-1029	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP031007	Lactobacillus curvatus strain TMW 1.1928 plasmid p-1.1928_4, complete sequence	2482-2511	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	2077-2106	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	6501-6530	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	10929-10958	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	15356-15385	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP013170	Lactobacillus plantarum strain MF1298 plasmid pMF1298-14, complete sequence	2011-2040	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	2566-2595	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	4830-4859	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	7099-7128	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	9370-9399	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	11639-11668	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	13905-13934	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP015445	Lactobacillus helveticus strain FAM8627 plasmid pFAM8627, complete sequence	8085-8114	1	0.967
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	AP018704	Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid5 DNA, complete genome	275-304	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX518744	Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence	46133-46162	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MF679144	Escherichia coli plasmid pBJ114-78, complete sequence	47356-47385	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR213453	Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 plasmid 2	5212-5241	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX785323	Streptococcus suis strain 3372 plasmid unnamed2, complete sequence	5111-5140	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KU130396	Escherichia coli strain S68 plasmid pS68, complete sequence	69142-69171	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT818627	Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence	26339-26368	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT725788	Klebsiella pneumoniae strain ST147 plasmid pCC1410-1, complete sequence	73992-74021	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KR091911	Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence	183821-183850	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KR936172	Enterococcus faecium strain Y13 plasmid pY13, complete sequence	9170-9199	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KR936172	Enterococcus faecium strain Y13 plasmid pY13, complete sequence	20267-20296	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448818	Enterococcus faecalis strain 12-7 plasmid p12-7, complete sequence	9171-9200	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448818	Enterococcus faecalis strain 12-7 plasmid p12-7, complete sequence	20269-20298	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448821	Enterococcus faecalis strain E15 plasmid pE15, complete sequence	9170-9199	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448821	Enterococcus faecalis strain E15 plasmid pE15, complete sequence	20267-20296	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448817	Enterococcus faecalis strain 11-27 plasmid p11-27, complete sequence	9170-9199	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448817	Enterococcus faecalis strain 11-27 plasmid p11-27, complete sequence	20267-20296	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448820	Enterococcus faecalis strain D12-2 plasmid pD12-2, complete sequence	9170-9199	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448820	Enterococcus faecalis strain D12-2 plasmid pD12-2, complete sequence	20268-20297	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448819	Enterococcus faecalis strain 14-1 plasmid p14-1, complete sequence	9171-9200	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KT448819	Enterococcus faecalis strain 14-1 plasmid p14-1, complete sequence	20269-20298	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	CP022460	Shigella sonnei strain 2015C-3807 plasmid unnamed1, complete sequence	29733-29762	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX646543	Shigella boydii strain 2246 plasmid p2246-CTXM, complete sequence	14699-14728	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP017618	Escherichia coli strain MRY15-117 plasmid pMRY15-117_1, complete sequence	99941-99970	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	KY130431	Klebsiella pneumoniae plasmid pABC143C-NDM, complete sequence	95742-95771	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP010174	Escherichia coli strain H8 plasmid B, complete sequence	38716-38745	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP027679	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence	176406-176435	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP029575	Escherichia coli strain DA33133 plasmid pDA33133-157, complete sequence	1620-1649	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP029734	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed6, complete sequence	35533-35562	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP034964	Escherichia coli strain WCHEC020032 plasmid pCTXM3_020032, complete sequence	5994-6023	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MT077885	Escherichia coli plasmid p37, complete sequence	6868-6897	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP024475	Shigella flexneri 7b strain 94-3007 plasmid unnamed2, complete sequence	16732-16761	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR213457	Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 plasmid 3	3800-3829	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP044156	Shigella flexneri strain AR-0424 plasmid pAR-0424-1, complete sequence	18740-18769	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP020517	Escherichia coli strain 222 plasmid unnamed3, complete sequence	33942-33971	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP036329	Klebsiella pneumoniae strain BA28434 plasmid pIncFIA	7455-7484	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN915010	Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence	112931-112960	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN915012	Escherichia coli strain GD-33 plasmid pNDM33-2, complete sequence	2595-2624	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN915013	Escherichia coli strain TD-33 plasmid pNDM-TD33, complete sequence	40381-40410	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP031549	Escherichia coli strain cq9 plasmid unnamed3, complete sequence	119858-119887	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP012139	Shigella flexneri 2a strain 981 plasmid 981p2, complete sequence	9949-9978	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC549806	Escherichia coli VNCEc57 plasmid pVNCEc57 DNA, complete sequence	15912-15941	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LC549808	Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence	87333-87362	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040922	Escherichia coli strain FC853_EC plasmid p853EC3, complete sequence	65524-65553	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP029580	Escherichia coli strain DA33137 plasmid pDA33137-178, complete sequence	96523-96552	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP037911	Escherichia coli strain YSP8-1 plasmid pYSP8-1, complete sequence	81424-81453	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041102	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed3, complete sequence	25574-25603	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	CP053755	Shigella sonnei strain 506 plasmid pMHMC-004, complete sequence	49949-49978	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	AP014876	Escherichia coli plasmid pV021-b DNA, complete sequence, strain: V021	5992-6021	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP024831	Escherichia coli strain CREC-532 plasmid pCREC-532_1, complete sequence	49805-49834	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	KY463220	Escherichia coli plasmid pNDM5-IBAC, complete sequence	72461-72490	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP034932	Shigella flexneri strain 2013C-3749 plasmid p2013C-3749-1, complete sequence	18644-18673	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP021684	Escherichia coli strain AR_0162 plasmid tig00008015, complete sequence	18067-18096	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP024836	Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_2, complete sequence	63694-63723	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP026201	Escherichia coli strain ECONIH6 plasmid pNDM-d2e9, complete sequence	37291-37320	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP031804	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed4, complete sequence	8772-8801	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP021203	Escherichia coli strain Z1002 plasmid p1002-1, complete sequence	9092-9121	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_010864	Pediococcus acidilactici plasmid pEOC01, complete sequence	8482-8511	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP031615	Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C2, complete sequence	94531-94560	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018147	Escherichia coli strain M217 isolate M217 plasmid pM217_FII, complete sequence	7456-7485	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR135491	Enterococcus faecium isolate E8414 plasmid 4	35238-35267	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP048372	Escherichia coli strain 164 plasmid pC-F-163_A, complete sequence	80546-80575	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP051690	Escherichia coli strain SCU-387 plasmid pSCU-387-2, complete sequence	29574-29603	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP024816	Escherichia coli strain CREC-629 plasmid pCREC-629_1, complete sequence	38609-38638	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP033948	Klebsiella pneumoniae subsp. pneumoniae strain ARLG-3135 plasmid p2, complete sequence	7456-7485	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP036181	Escherichia coli strain WCHEC025970 plasmid p2_025970, complete sequence	15601-15630	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP009860	Escherichia coli strain ECONIH1 plasmid pECO-824, complete sequence	61202-61231	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR134110	Enterococcus faecium isolate E6043 plasmid 6	211-240	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP024840	Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_2, complete sequence	84393-84422	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP017621	Escherichia coli strain MRY15-131 plasmid pMRY15-131_1, complete sequence	99941-99970	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_KX008967	Shigella sonnei strain 183660 plasmid p183660, complete sequence	32917-32946	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP048311	Escherichia coli strain 32-4 plasmid p32-4_A, complete sequence	8468-8497	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041111	Escherichia coli strain ECCTRSRTH03 plasmid unnamed1, complete sequence	19797-19826	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP050372	Klebsiella pneumoniae strain 50595 plasmid p50595_ERM, complete sequence	40257-40286	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP050367	Klebsiella pneumoniae strain 47733 plasmid p47733_NDM_5, complete sequence	64356-64385	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	283458-283487	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP018960	Escherichia coli strain Ecol_422 plasmid pEC422_2, complete sequence	39478-39507	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP033094	Escherichia coli strain CP53 plasmid pCP53-mcr, complete sequence	63588-63617	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP019028	Escherichia coli strain Ecol_881 plasmid pEC881_1, complete sequence	65377-65406	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP023918	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed	72822-72851	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	CP045934	Shigella sonnei strain AUSMDU00010534 plasmid pAUSMDU00010534_02, complete sequence	20654-20683	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP025708	Escherichia coli strain YDC107 plasmid pYDC107_184, complete sequence	46824-46853	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP040070	Escherichia coli strain A1_181 plasmid p_unnamed3, complete sequence	12849-12878	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP046044	Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence	98489-98518	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP043949	Escherichia coli strain AR202.2 plasmid pMPCMY-2, complete sequence	2199-2228	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP012197	Escherichia coli strain ECwhn14 plasmid pECwhn14, complete sequence	102282-102311	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	AP023220	Escherichia coli M505 plasmid pM505-NDM5 DNA, complete genome	50189-50218	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	AP023228	Escherichia coli YJ3 plasmid pYJ3-a DNA, complete genome	11280-11309	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	AP023236	Escherichia coli YJ6 plasmid pYJ6-NDM5 DNA, complete genome	9030-9059	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	LT174531	Shigella sonnei plasmid pEG430-2, strain EG0430	9341-9370	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	AP018353	Escherichia coli plasmid pVE769 DNA, complete genome, strain: E769	18814-18843	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP029974	Escherichia coli strain 51008369SK1 plasmid p51008369SK1_A, complete sequence	27225-27254	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP015836	Escherichia coli strain MS6198 plasmid pMS6198B, complete sequence	89779-89808	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP043229	Escherichia coli strain Ec-050 plasmid pEc-050-CMY-2, complete sequence	57101-57130	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP043945	Escherichia coli strain AR216.2b plasmid pMPCMY-2, complete sequence	6508-6537	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_014615	Escherichia coli plasmid pETN48, complete sequence	87752-87781	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP033847	Escherichia coli strain FDAARGOS_497 plasmid unnamed1, complete sequence	57162-57191	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MK649824	Klebsiella pneumoniae strain BA6201 plasmid pBA6201_1, complete sequence	140871-140900	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018136	Escherichia coli strain M105 isolate M105 plasmid pM105_FII, complete sequence	8471-8500	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018138	Escherichia coli strain M107 isolate M107 plasmid pM107_FII, complete sequence	8471-8500	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018144	Escherichia coli strain M214 isolate M214 plasmid pM214_FII, complete sequence	8471-8500	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LR213461	Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 plasmid 4	5212-5241	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP050740	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence	57754-57783	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP041441	Escherichia coli strain YPE12 plasmid pYPE12-122k, complete sequence	34872-34901	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LT985267	Escherichia coli strain 637 plasmid RCS61_p, complete sequence	7872-7901	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LT985267	Escherichia coli strain 637 plasmid RCS61_p, complete sequence	13132-13161	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LT985277	Escherichia coli strain 522 plasmid RCS65_p, complete sequence	25133-25162	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MH674341	Escherichia coli strain EC07 plasmid pUR-EC07, complete sequence	15942-15971	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MN241905	Salmonella enterica subsp. enterica serovar Typhimurium strain STM3224 plasmid pUY_STM96, complete sequence	80996-81025	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_AP018939	Escherichia coli strain JSWP006 plasmid pJSWP006_1, complete sequence	90565-90594	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP044043	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed1, complete sequence	66045-66074	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP045943	Shigella flexneri 2a strain AUSMDU00010535 plasmid pAUSMDU00010535_02, complete sequence	24639-24668	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MN218686	Escherichia coli strain 5M plasmid pISV_IncFII_NDM-5, complete sequence	131944-131973	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MF156697	Escherichia coli strain BTR plasmid pBTR-CTXM, complete sequence	19234-19263	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MG825377	Escherichia coli strain 1108 plasmid p1108-emrB, complete sequence	17195-17224	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MG764548	Escherichia coli strain 11011 plasmid p11011-fosA, complete sequence	32423-32452	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_MF344576	Escherichia coli strain 15061806 plasmid p61806-CTXM, complete sequence	15900-15929	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LC506717	Klebsiella pneumoniae strain JUNP054 plasmid pJUNP054, complete sequence	12106-12135	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LC506718	Klebsiella pneumoniae strain JUNP055 plasmid pJUNP055, complete sequence	12106-12135	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_LC506720	Klebsiella pneumoniae strain JUNP268 plasmid pJUNP268, complete sequence	12106-12135	1	0.967
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	MN548042	Klebsiella pneumoniae strain QD23 plasmid pQD23-1, complete sequence	15946-15975	1	0.967
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NZ_CP031172	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence	17279-17310	1	0.969
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NZ_CP014917	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence	13696-13727	1	0.969
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	3401-3432	1	0.969
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	44431-44462	1	0.969
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NZ_CP031172	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence	17279-17311	1	0.97
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NZ_CP014917	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence	13696-13728	1	0.97
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	3401-3433	1	0.97
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	44431-44463	1	0.97
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_014627	Lactobacillus plantarum plasmid pLPI8, complete sequence	92-124	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_KJ868089	Lactobacillus pentosus strain F03 plasmid pF03-2, complete sequence	1348-1380	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_003893	Lactobacillus plantarum plasmid pLP2000, complete sequence	33-65	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_012220	Lactobacillus plantarum plasmid pLD1, complete sequence	1792-1824	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_001370	Lactobacillus plantarum plasmid pC30il, complete sequence	1931-1963	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP046660	Lactobacillus plantarum strain 123-17 plasmid p123-18.4, complete sequence	1644-1676	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_019321	Lactobacillus plantarum plasmid pR18, complete sequence	1093-1125	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_011497	Lactobacillus plantarum plasmid pLP2111, complete sequence	1791-1823	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	402-434	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	2654-2686	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	4918-4950	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	7187-7219	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	9458-9490	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	11727-11759	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	13993-14025	2	0.939
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP004408	Lactobacillus plantarum DOMLa plasmid unnamed200, complete sequence	1734-1766	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP014880	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence	450-482	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP014880	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence	3990-4022	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NC_025165	Lactobacillus hilgardii plasmid pLAB1000 or pHL1 sequence	3007-3039	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP014906	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence	450-482	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP014906	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence	3990-4022	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_KF559315	Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence	2830-2862	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP031207	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence	932-964	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NC_014135	Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence	860-892	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NC_019900	Lactobacillus plantarum strain BFE 5092 plasmid pMRI 5.2, complete sequence	3522-3554	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_MK167463	Lactobacillus plantarum strain PC518 plasmid pLP325, complete sequence	1024-1056	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP037439	Lactobacillus plantarum strain EM plasmid pEM10, complete sequence	2607-2639	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP037439	Lactobacillus plantarum strain EM plasmid pEM10, complete sequence	11068-11100	2	0.939
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP037439	Lactobacillus plantarum strain EM plasmid pEM10, complete sequence	19530-19562	2	0.939
NZ_CP021456_2	2.12\|126577\|33\|NZ_CP021456\|CRISPRCasFinder	126577-126609	33	MN830254	Lactobacillus phage JNU_P2, complete genome	18216-18248	2	0.939
NZ_CP021456_2	2.12\|126577\|33\|NZ_CP021456\|CRISPRCasFinder	126577-126609	33	MN830255	Lactobacillus phage JNU_P4, complete genome	4739-4771	2	0.939
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_014627	Lactobacillus plantarum plasmid pLPI8, complete sequence	92-123	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_KJ868089	Lactobacillus pentosus strain F03 plasmid pF03-2, complete sequence	1348-1379	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_003893	Lactobacillus plantarum plasmid pLP2000, complete sequence	33-64	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_012220	Lactobacillus plantarum plasmid pLD1, complete sequence	1792-1823	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	403-434	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	2655-2686	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	4919-4950	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	7188-7219	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	9459-9490	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	11728-11759	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	13994-14025	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP004408	Lactobacillus plantarum DOMLa plasmid unnamed200, complete sequence	1735-1766	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_001370	Lactobacillus plantarum plasmid pC30il, complete sequence	1931-1962	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP046660	Lactobacillus plantarum strain 123-17 plasmid p123-18.4, complete sequence	1644-1675	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_019321	Lactobacillus plantarum plasmid pR18, complete sequence	1093-1124	2	0.938
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_011497	Lactobacillus plantarum plasmid pLP2111, complete sequence	1791-1822	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KF559315	Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence	2830-2861	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP014880	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence	451-482	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP014880	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence	3991-4022	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP031207	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence	932-963	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_014135	Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence	860-891	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_025165	Lactobacillus hilgardii plasmid pLAB1000 or pHL1 sequence	3008-3039	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_019900	Lactobacillus plantarum strain BFE 5092 plasmid pMRI 5.2, complete sequence	3522-3553	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP014906	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence	451-482	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP014906	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence	3991-4022	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK167463	Lactobacillus plantarum strain PC518 plasmid pLP325, complete sequence	1024-1055	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP037439	Lactobacillus plantarum strain EM plasmid pEM10, complete sequence	2607-2638	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP037439	Lactobacillus plantarum strain EM plasmid pEM10, complete sequence	11068-11099	2	0.938
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP037439	Lactobacillus plantarum strain EM plasmid pEM10, complete sequence	19530-19561	2	0.938
NZ_CP021456_2	2.24\|126578\|32\|NZ_CP021456\|CRT	126578-126609	32	MN830254	Lactobacillus phage JNU_P2, complete genome	18216-18247	2	0.938
NZ_CP021456_2	2.24\|126578\|32\|NZ_CP021456\|CRT	126578-126609	32	MN830255	Lactobacillus phage JNU_P4, complete genome	4739-4770	2	0.938
NZ_CP021456_3	3.3\|1238473\|32\|NZ_CP021456\|PILER-CR	1238473-1238504	32	NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	8621-8652	2	0.938
NZ_CP021456_3	3.3\|1238473\|32\|NZ_CP021456\|PILER-CR	1238473-1238504	32	NZ_CP019747	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence	7293-7324	2	0.938
NZ_CP021456_3	3.6\|1238472\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238472-1238504	33	NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	8620-8652	2	0.939
NZ_CP021456_3	3.6\|1238472\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238472-1238504	33	NZ_CP019747	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence	7293-7325	2	0.939
NZ_CP021456_5	5.3\|2319405\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319405-2319434	30	NZ_CP031171	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_B, complete sequence	13071-13100	2	0.933
NZ_CP021456_5	5.3\|2319405\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319405-2319434	30	NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	20627-20656	2	0.933
NZ_CP021456_5	5.3\|2319405\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319405-2319434	30	NZ_CP019747	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence	49538-49567	2	0.933
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	15537-15566	2	0.933
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	2869-2898	2	0.933
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	43898-43927	2	0.933
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	13678-13707	2	0.933
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	16716-16745	2	0.933
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	2591-2620	2	0.933
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NC_005952	Lactobacillus brevis plasmid pRH45II, complete sequence	22296-22325	2	0.933
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP021472	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-2, complete sequence	23495-23524	2	0.933
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP029967	Lactobacillus curvatus strain ZJUNIT8 plasmid pnunamed1, complete sequence	48219-48248	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_011798	Lactobacillus farciminis KCTC 3681 plasmid pLF24, complete sequence	2126-2155	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_024985	Lactobacillus plantarum subsp. plantarum strain Zhang-11 plasmid pZL2, complete sequence	2786-2815	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_021574	Lactobacillus paracasei plasmid pLP5403, complete sequence	426-455	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_016034	Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-2, complete sequence	2338-2367	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	MN730093	Lactobacillus plantarum strain PC518 plasmid pLP224, complete sequence	1045-1074	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_007593	Pediococcus damnosus plasmid pF8801, complete sequence	3434-3463	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP012892	Lactobacillus gallinarum strain HFD4 plasmid pMKG02, complete sequence	6422-6451	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP012892	Lactobacillus gallinarum strain HFD4 plasmid pMKG02, complete sequence	14823-14852	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_009666	Lactobacillus plantarum M4 plasmid pM4, complete sequence	3227-3256	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_012548	Lactobacillus brevis plasmid pLB925A01, complete sequence	410-439	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_012549	Lactobacillus brevis plasmid pLB925A02, complete sequence	1282-1311	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_MG944248	Lactobacillus plantarum strain LP27 plasmid pLP27, complete sequence	1659-1688	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_016635	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-1, complete sequence	1199-1228	2	0.933
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP013167	Lactobacillus plantarum strain MF1298 plasmid pMF1298-12, complete sequence	2994-3023	2	0.933
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_014475	Enterococcus faecalis plasmid pWZ1668, complete sequence	19043-19072	2	0.933
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_019284	Enterococcus faecalis plasmid pWZ7140, complete sequence	18447-18476	2	0.933
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NC_019213	Enterococcus faecalis plasmid pWZ909, complete sequence	13772-13801	2	0.933
NZ_CP021456_6	6.2\|2386360\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386360-2386391	32	NC_047983	Lactobacillus phage Lb, complete genome	40164-40195	2	0.938
NZ_CP021456_6	6.3\|2386421\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386421-2386452	32	MN830254	Lactobacillus phage JNU_P2, complete genome	25827-25858	2	0.938
NZ_CP021456_6	6.3\|2386421\|32\|NZ_CP021456\|CRISPRCasFinder,PILER-CR	2386421-2386452	32	MN830255	Lactobacillus phage JNU_P4, complete genome	12350-12381	2	0.938
NZ_CP021456_6	6.6\|2386360\|33\|NZ_CP021456\|CRT	2386360-2386392	33	NC_047983	Lactobacillus phage Lb, complete genome	40164-40196	2	0.939
NZ_CP021456_6	6.7\|2386421\|33\|NZ_CP021456\|CRT	2386421-2386453	33	MN830254	Lactobacillus phage JNU_P2, complete genome	25827-25859	2	0.939
NZ_CP021456_6	6.7\|2386421\|33\|NZ_CP021456\|CRT	2386421-2386453	33	MN830255	Lactobacillus phage JNU_P4, complete genome	12350-12382	2	0.939
NZ_CP021456_1	1.6\|116081\|33\|NZ_CP021456\|CRISPRCasFinder	116081-116113	33	MN830254	Lactobacillus phage JNU_P2, complete genome	21776-21808	3	0.909
NZ_CP021456_1	1.6\|116081\|33\|NZ_CP021456\|CRISPRCasFinder	116081-116113	33	MN830255	Lactobacillus phage JNU_P4, complete genome	8299-8331	3	0.909
NZ_CP021456_1	1.14\|116082\|32\|NZ_CP021456\|CRT	116082-116113	32	MN830254	Lactobacillus phage JNU_P2, complete genome	21776-21807	3	0.906
NZ_CP021456_1	1.14\|116082\|32\|NZ_CP021456\|CRT	116082-116113	32	MN830255	Lactobacillus phage JNU_P4, complete genome	8299-8330	3	0.906
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_LM651913	Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence	1677-1709	3	0.909
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NC_006399	Lactobacillus plantarum BIFI-38 plasmid pPB1, complete sequence	2635-2667	3	0.909
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NC_019353	Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence	2570-2602	3	0.909
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_LM651913	Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence	1678-1709	3	0.906
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_006399	Lactobacillus plantarum BIFI-38 plasmid pPB1, complete sequence	2635-2666	3	0.906
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_019353	Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence	2570-2601	3	0.906
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	12941-12970	3	0.9
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	2373-2402	3	0.9
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP014925	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-1, complete sequence	18210-18239	3	0.9
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP031171	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_B, complete sequence	12930-12959	3	0.9
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	13463-13492	3	0.9
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	20486-20515	3	0.9
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	3077-3106	3	0.9
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	44106-44135	3	0.9
NZ_CP021456_5	5.7\|2319669\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319669-2319698	30	NZ_CP019747	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence	49679-49708	3	0.9
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	26669-26698	3	0.9
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	10062-10091	3	0.9
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP021476	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5	314-343	3	0.9
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP019714	Lactobacillus plantarum strain Q7 plasmid unnamed2, complete sequence	1515-1544	3	0.9
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_013789	Lactobacillus plantarum plasmid pXY3, complete sequence	29-58	3	0.9
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP035270	Weissella cibaria strain SRCM103448 plasmid unnamed3, complete sequence	2917-2946	3	0.9
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_KJ868090	Lactobacillus pentosus strain F03 plasmid pF03-3, complete sequence	164-195	4	0.875
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP019714	Lactobacillus plantarum strain Q7 plasmid unnamed2, complete sequence	1444-1475	4	0.875
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP019715	Lactobacillus plantarum strain Q7 plasmid unnamed3, complete sequence	247-278	4	0.875
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_013789	Lactobacillus plantarum plasmid pXY3, complete sequence	2926-2957	4	0.875
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_012722	Lactobacillus pentosus p1-4 plasmid complete sequence, strain F121-1	404-435	4	0.875
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NZ_CP019714	Lactobacillus plantarum strain Q7 plasmid unnamed2, complete sequence	1444-1476	5	0.848
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_013789	Lactobacillus plantarum plasmid pXY3, complete sequence	2926-2958	5	0.848
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NZ_CP031207	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence	1164-1195	5	0.844
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_006399	Lactobacillus plantarum BIFI-38 plasmid pPB1, complete sequence	2865-2896	5	0.844
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_016606	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-2, complete sequence	1504-1535	5	0.844
NZ_CP021456_2	2.7\|126272\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	126272-126304	33	MH809530	Lactobacillus phage Dionysus, complete genome	118131-118163	6	0.818
NZ_CP021456_2	2.7\|126272\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	126272-126304	33	NC_048084	Lactobacillus phage Iacchus, complete genome	114760-114792	6	0.818
NZ_CP021456_2	2.7\|126272\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	126272-126304	33	MH809531	Lactobacillus phage Bromius, complete genome	116989-117021	6	0.818
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	MH809530	Lactobacillus phage Dionysus, complete genome	118132-118163	6	0.812
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	NC_048084	Lactobacillus phage Iacchus, complete genome	114761-114792	6	0.812
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	MH809531	Lactobacillus phage Bromius, complete genome	116990-117021	6	0.812
NZ_CP021456_3	3.10\|1238716\|33\|NZ_CP021456\|CRISPRCasFinder,CRT	1238716-1238748	33	MN694520	Marine virus AFVG_250M712, complete genome	5775-5807	6	0.818
NZ_CP021456_3	3.13\|1238719\|29\|NZ_CP021456\|PILER-CR	1238719-1238747	29	MN694520	Marine virus AFVG_250M712, complete genome	5776-5804	6	0.793
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP025475	Lactobacillus curvatus strain IRG2 plasmid pIRG201, complete sequence	3472-3501	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP016356	Lactobacillus paracasei subsp. paracasei strain TMW 1.1434 plasmid pL11434-1, complete sequence	76603-76632	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NC_021227	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp5, complete sequence	6232-6261	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP022131	Lactobacillus pentosus strain SLC13 plasmid pSLC13, complete sequence	18458-18487	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP015859	Lactobacillus plantarum strain LZ227 plasmid LZ227p4, complete sequence	83720-83749	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP053339	Lactobacillus paraplantarum strain CK401 plasmid pCK401B, complete sequence	4016-4045	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	28204-28233	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	38940-38969	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP028981	Lactobacillus plantarum strain LQ80 plasmid pLQ804, complete sequence	2042-2071	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP017068	Lactobacillus plantarum strain LP3 plasmid pLB302, complete sequence	8354-8383	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP032758	Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence	8077-8106	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	37404-37433	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP021998	Lactobacillus plantarum strain LPL-1 plasmid pPLP-1, complete sequence	7472-7501	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP035017	Lactobacillus plantarum strain 12_3 plasmid pldE, complete sequence	103-132	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP035025	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pE	14522-14551	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP022476	Lactobacillus curvatus strain KG6 plasmid pKG6_1 sequence	438-467	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP022476	Lactobacillus curvatus strain KG6 plasmid pKG6_1 sequence	12784-12813	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP027192	Lactobacillus sp. CBA3605 plasmid pCBA3605-2, complete sequence	1341-1370	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_LT960786	Lactobacillus sakei isolate MFPB19 plasmid 3, complete sequence	9602-9631	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP027197	Lactobacillus sp. CBA3606 plasmid pCBA3606-3, complete sequence	11197-11226	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NC_021903	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ101, complete sequence	5470-5499	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_LT960792	Lactobacillus sakei strain J54 plasmid 3, complete sequence	10792-10821	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_LT960779	Lactobacillus sakei strain FLEC01 plasmid 3, complete sequence	10252-10281	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP020461	Lactobacillus sakei strain FAM18311 plasmid pFAM18311_2	23192-23221	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP032660	Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence	67012-67041	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP031004	Lactobacillus curvatus strain TMW 1.1928 plasmid p-1.1928_1, complete sequence	20887-20916	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	50269-50298	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	60096-60125	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP022293	Lactobacillus plantarum strain DSR_M2 plasmid pDSRM202, complete sequence	4847-4876	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	26146-26175	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_MF383377	Lactobacillus curvatus strain CRL 705 plasmid pRC12, complete sequence	7533-7562	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	AP018702	Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid3 DNA, complete genome	9247-9276	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP028338	Lactobacillus plantarum strain SRCM101167 plasmid unnamed4, complete sequence	109-138	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP012191	Lactobacillus paracasei strain CAUH35 plasmid unnamed4, complete sequence	4862-4891	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP032655	Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence	44738-44767	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP013154	Lactobacillus plantarum strain MF1298 plasmid pMF1298-7, complete sequence	3800-3829	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NC_047925	Lactobacillus phage Nyseid, complete genome	64693-64722	6	0.8
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	KU052488	Lactobacillus phage SA-C12, complete genome	21362-21391	6	0.8
NZ_CP021456_5	5.2\|2319339\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319339-2319368	30	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	59334-59363	6	0.8
NZ_CP021456_5	5.2\|2319339\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319339-2319368	30	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	28259-28288	6	0.8
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP035173	Lactobacillus plantarum strain SRCM103418 plasmid unnamed5	11625-11654	6	0.8
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	KJ868088	Lactobacillus pentosus strain F03 plasmid pF03-1, complete sequence	510-539	6	0.8
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP031207	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence	1249-1278	6	0.8
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_014135	Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence	1174-1203	6	0.8
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_019353	Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence	2884-2913	6	0.8
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_LM651913	Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence	1366-1395	6	0.8
NZ_CP021456_2	2.1\|125906\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125906-125938	33	NC_007593	Pediococcus damnosus plasmid pF8801, complete sequence	1882-1914	7	0.788
NZ_CP021456_2	2.13\|125907\|32\|NZ_CP021456\|CRT	125907-125938	32	NC_007593	Pediococcus damnosus plasmid pF8801, complete sequence	1882-1913	7	0.781
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX683284	Escherichia coli strain EcU443 plasmid pECSEV_02, complete sequence	872-903	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694646	Marine virus AFVG_250M1067, complete genome	26952-26983	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN693911	Marine virus AFVG_250M1064, complete genome	12335-12366	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694813	Marine virus AFVG_250M1071, complete genome	25737-25768	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694441	Marine virus AFVG_250M1066, complete genome	13058-13089	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694492	Marine virus AFVG_250M1068, complete genome	26296-26327	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694093	Marine virus AFVG_250M872, complete genome	27347-27378	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN693639	Marine virus AFVG_250M1070, complete genome	13086-13117	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694318	Marine virus AFVG_250M1065, complete genome	25501-25532	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN694328	Marine virus AFVG_250M871, complete genome	27214-27245	7	0.781
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	MN693657	Marine virus AFVG_250M1069, complete genome	26044-26075	7	0.781
NZ_CP021456_2	2.16\|126090\|32\|NZ_CP021456\|CRT	126090-126121	32	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	551405-551436	7	0.781
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	NC_047926	Lactobacillus phage Semele, complete genome	117087-117118	7	0.781
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	MG557979	Lactobacillus phage Lpa804, complete genome	86205-86236	7	0.781
NZ_CP021456_5	5.2\|2319339\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319339-2319368	30	NZ_MH491967	Proteus mirabilis strain HFK418 plasmid pHFK418-NDM, complete sequence	89186-89215	7	0.767
NZ_CP021456_5	5.9\|2319801\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319801-2319830	30	NZ_CP020699	Sulfitobacter sp. D7 plasmid p5SUD7, complete sequence	63882-63911	7	0.767
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_KF559315	Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence	92-121	7	0.767
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP014880	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence	3679-3708	7	0.767
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NZ_CP014906	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence	3679-3708	7	0.767
NZ_CP021456_5	5.11\|2319933\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319933-2319962	30	NZ_CP037912	Escherichia coli strain YSP8-1 plasmid pYSP8-1-CTX-M-14, complete sequence	125621-125650	7	0.767
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	MN693436	Marine virus AFVG_25M57, complete genome	37478-37510	8	0.758
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	MN693320	Marine virus AFVG_25M58, complete genome	37727-37759	8	0.758
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024320	Borrelia miyamotoi strain Yekat-6 plasmid pYkt6-lp41, complete sequence	6399-6430	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024393	Borrelia miyamotoi strain Izh-4 plasmid pIzh4-lp41, complete sequence	25770-25801	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024208	Borrelia miyamotoi strain Izh-5 plasmid pIzh5-lp41, complete sequence	25808-25839	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024336	Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp41, complete sequence	25955-25986	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024354	Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-1, complete sequence	18047-18078	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024355	Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-2, complete sequence	25808-25839	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP024374	Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp41, complete sequence	22230-22261	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	MN693436	Marine virus AFVG_25M57, complete genome	37478-37509	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	MN693320	Marine virus AFVG_25M58, complete genome	37727-37758	8	0.75
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP016541	Planococcus versutus strain L10.15 plasmid pPS15-1, complete sequence	9606-9637	8	0.75
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP047439	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence	36994-37026	8	0.758
NZ_CP021456_2	2.2\|125967\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	125967-125999	33	NZ_CP047440	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence	62155-62187	8	0.758
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP047439	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence	36994-37025	8	0.75
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP047440	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence	62155-62186	8	0.75
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	AY682195	Lactobacillus plantarum bacteriophage LP65, complete genome	125460-125491	8	0.75
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	NC_006565	Lactobacillus phage LP65, complete genome	125460-125491	8	0.75
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	MG765277	Lactobacillus phage Bacchae, complete genome	117755-117786	8	0.75
NZ_CP021456_2	2.24\|126578\|32\|NZ_CP021456\|CRT	126578-126609	32	MH617513	Microviridae sp. isolate ctdc874, complete genome	3561-3592	8	0.75
NZ_CP021456_5	5.1\|2319273\|30\|NZ_CP021456\|CRISPRCasFinder,CRT	2319273-2319302	30	NZ_CP025615	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed3, complete sequence	78164-78193	8	0.733
NZ_CP021456_5	5.2\|2319339\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319339-2319368	30	KX534340	Phage Wrath, partial genome	813-842	8	0.733
NZ_CP021456_5	5.10\|2319867\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319867-2319896	30	NC_015063	Rahnella sp. Y9602 plasmid pRAHAQ02, complete sequence	65248-65277	8	0.733
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024393	Borrelia miyamotoi strain Izh-4 plasmid pIzh4-lp41, complete sequence	25769-25801	9	0.727
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024208	Borrelia miyamotoi strain Izh-5 plasmid pIzh5-lp41, complete sequence	25807-25839	9	0.727
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024336	Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp41, complete sequence	25954-25986	9	0.727
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024355	Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-2, complete sequence	25807-25839	9	0.727
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024320	Borrelia miyamotoi strain Yekat-6 plasmid pYkt6-lp41, complete sequence	6399-6431	9	0.727
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024354	Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-1, complete sequence	18047-18079	9	0.727
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP024374	Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp41, complete sequence	22230-22262	9	0.727
NZ_CP021456_1	1.9\|115777\|32\|NZ_CP021456\|CRT	115777-115808	32	KT997864	Uncultured Mediterranean phage uvDeep-CGR2-KM21-C345, complete genome	24820-24851	9	0.719
NZ_CP021456_1	1.12\|115960\|32\|NZ_CP021456\|CRT	115960-115991	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1333610-1333641	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_KY075650	Escherichia coli strain GD17 plasmid pGD17-2, complete sequence	46242-46273	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	CP031286	Escherichia fergusonii strain 40A plasmid p80_40A, complete sequence	3495-3526	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP040808	Escherichia fergusonii strain EFCF056 plasmid pEF03, complete sequence	5666-5697	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP014283	Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence	363516-363547	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP032614	Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence	52652-52683	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP014003	Synechococcus sp. PCC 73109 plasmid unnamed5, complete sequence	85542-85573	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP016489	Synechococcus sp. PCC 8807 plasmid unnamed6, complete sequence	123016-123047	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_CP016482	Synechococcus sp. PCC 7117 plasmid unnamed5, complete sequence	85379-85410	9	0.719
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	MN693868	Marine virus AFVG_250M1130, complete genome	17967-17998	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MK088486	Klebsiella pneumoniae plasmid pHNHZ604-1, complete sequence	22740-22771	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041048	Citrobacter sp. CF971 plasmid pBM527-2, complete sequence	8011-8042	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP052170	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-3, complete sequence	8011-8042	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP025948	Escherichia coli strain SCEC020023 plasmid pNDM21_020023, complete sequence	5376-5407	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX470734	Escherichia coli strain Ecoli14-55 plasmid pEC55-NDM4, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX618696	Escherichia coli strain NRS18 plasmid pEC-NRS18, complete sequence	26093-26124	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX674681	Escherichia coli strain AS-01 plasmid pNDM5_AS, complete sequence	9039-9070	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX618698	Escherichia coli strain 243 plasmid pEC-243, complete sequence	26083-26114	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX470735	Escherichia coli strain Ecoli15-50 plasmid pEC50-NDM7, complete sequence	27523-27554	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX618697	Escherichia coli strain 393 plasmid pEC-393, complete sequence	26220-26251	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX618702	Escherichia coli strain 147 plasmid pEC-147, complete sequence	26083-26114	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX683284	Escherichia coli strain EcU443 plasmid pECSEV_02, complete sequence	46044-46075	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX618701	Escherichia coli strain 170 plasmid pEC-170, complete sequence	26083-26114	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX833071	Escherichia coli strain AD-19R plasmid pAD-19R clone ST48, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY296103	Enterobacter cloacae strain 13E169 plasmid pHN84NDM, complete sequence	17655-17686	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY499797	Klebsiella pneumoniae strain TH02-34 plasmid pTH02-34, complete sequence	24151-24182	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY659388	Citrobacter freundii strain 145 plasmid pCr-145, complete sequence	28183-28214	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY659387	Citrobacter freundii strain 30 plasmid pCfr-30, complete sequence	28183-28214	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY978629	Cronobacter sakazakii strain 505108 plasmid p505108-NDM, complete sequence	28724-28755	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF072961	Citrobacter freundii strain P10159 plasmid pP10159-1, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY435936	Escherichia coli strain WCHEC005215 plasmid pNDM5_WCHEC0215, complete sequence	20701-20732	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF150120	Klebsiella pneumoniae strain A64477 plasmid pKP64477d, complete sequence	36375-36406	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MG228426	Escherichia coli strain BO15V plasmid pKP_BO_OXA-181, complete sequence	43796-43827	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MF679147	Escherichia coli plasmid pBJ114T-190, complete sequence	67420-67451	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KU934011	Serratia marcescens strain 427862 plasmid IncX-3, complete sequence	26616-26647	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX523903	Klebsiella pneumoniae strain Kpn-29144/15 plasmid pOXA-181_29144, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX756453	Klebsiella pneumoniae strain 1194/11 plasmid pKP1194a, complete sequence	38744-38775	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KU647721	Escherichia coli strain CQ02-121 plasmid pCQ02-121, complete sequence	23279-23310	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX960110	Escherichia coli strain CREC-TJ2 plasmid pCREC-TJ2-NDM, complete sequence	91587-91618	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KU167609	Escherichia coli strain QD29 plasmid pNDM-QD29, complete sequence	19503-19534	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX960109	Escherichia coli strain CREC-A6 plasmid pCREC-A6-NDM, complete sequence	19523-19554	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY041843	Escherichia coli strain ZHDC40 plasmid pZHDC40, complete sequence	13576-13607	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KU963389	Escherichia coli strain ECO37 plasmid ECO37P1, complete sequence	18843-18874	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KU314941	Klebsiella pneumoniae isolate KP04 plasmid pKP04NDM, complete sequence	28925-28956	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX094555	Escherichia coli strain ZHDC33 plasmid pZHDC33, complete sequence	9074-9105	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX214669	Escherichia coli strain KW53T plasmid pKW53T-NDM, complete sequence	7743-7774	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX348144	Klebsiella pneumoniae strain Kp01 plasmid pKPC_Kp01, complete sequence	21740-21771	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KX447767	Escherichia coli strain MCR1_NJ plasmid pNDM5-NJ-IncX3, complete sequence	14411-14442	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KM400601	Klebsiella pneumoniae strain Kp0003 plasmid pJEG027, complete sequence	19449-19480	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KT005457	Klebsiella variicola strain KS22 plasmid pKS22, complete sequence	19982-20013	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KT362706	Klebsiella pneumoniae strain ST512 plasmid p45-IncX3, complete sequence	28183-28214	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KP765744	Enterobacter cloacae strain ECN49 plasmid pNDM-ECN49, complete sequence	35451-35482	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KP987216	Citrobacter freundii strain 112298 plasmid p112298-NDM, complete sequence	28380-28411	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KT824791	Escherichia coli strain 1929 plasmid pEc1929, complete sequence	19504-19535	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KP776609	Escherichia coli strain OM26 plasmid pOM26-1, complete sequence	7743-7774	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KU167608	Escherichia coli strain QD28 plasmid pNDM-QD28, complete sequence	19503-19534	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP043333	Proteus mirabilis strain CRPM10 plasmid pNDM-5, complete sequence	15613-15644	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP018435	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_2, complete sequence	10428-10459	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP042339	Escherichia coli strain GZ04-0086 plasmid pNDM5-GZ04_A, complete sequence	32076-32107	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP023194	Escherichia coli strain TUM18530 plasmid pMTY18530-4_lncX3, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP040399	Escherichia coli strain BA22372 plasmid pOXA181_22372, complete sequence	4004-4035	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP043050	Klebsiella pneumoniae strain KLP268 plasmid pKLP268-1, complete sequence	18965-18996	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP014006	Klebsiella pneumoniae subsp. pneumoniae strain NUHL24835 plasmid unnamed2, complete sequence	398-429	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034284	Klebsiella pneumoniae strain I72 plasmid p72_OXA181_X3, complete sequence	26229-26260	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MK088485	Escherichia coli plasmid pHN4109c, complete sequence	24719-24750	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041033	Escherichia coli strain PT109 plasmid pLB_OXA-181_PT109, complete sequence	13288-13319	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048332	Escherichia coli strain 10 plasmid p010_B-OXA181, complete sequence	30093-30124	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034957	Escherichia coli strain SCEC020026 plasmid pNDM5_020026, complete sequence	1708-1739	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP049352	Escherichia coli strain 3R plasmid p3R-4, complete sequence	15776-15807	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP049602	Klebsiella aerogenes strain 18-2341 plasmid pSECR18-2341_NDM, complete sequence	290-321	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP012995	Klebsiella pneumoniae strain KpN06 plasmid pKpN06-NDM7, complete sequence	36324-36355	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041931	Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374D, complete sequence	35907-35938	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP010395	Klebsiella pneumoniae strain 34618 plasmid p34618-43.380kb, complete sequence	37657-37688	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP020512	Escherichia coli strain 165 plasmid unnamed3, complete sequence	36765-36796	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP029735	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed7, complete sequence	42351-42382	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034965	Escherichia coli strain WCHEC020032 plasmid pNDM5_020032, complete sequence	25447-25478	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP053726	Escherichia coli strain CP66-6_Sichuan plasmid pCP66-6-IncX3, complete sequence	40686-40717	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034744	Escherichia coli strain L65 plasmid pL65-9, complete sequence	31467-31498	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	KX023261	Escherichia coli plasmid pSCE516-2, complete sequence	19450-19481	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP051221	Escherichia coli strain SFE8 plasmid pSCZP2, complete sequence	7306-7337	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP026727	Escherichia coli strain 266917_2 plasmid p266917_2_04, complete sequence	20534-20565	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP014069	Citrobacter amalonaticus strain FDAARGOS_165 plasmid unnamed	41252-41283	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP029245	Escherichia coli strain ECCRA-119 plasmid pTB203, complete sequence	43764-43795	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP025041	Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_4, complete sequence	60447-60478	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP052768	Salmonella enterica subsp. enterica strain LHST_2018 plasmid pLHST2018_IncX3, complete sequence	30700-30731	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP011987	Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-74.026kb, complete sequence	48917-48948	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN061454	Enterobacter cloacae strain EC-14-60 plasmid pECL-14-60-NDM-1, complete sequence	1244-1275	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN175389	Klebsiella pneumoniae strain KP-13-8 plasmid pKP-13-8-NDM-5, complete sequence	22890-22921	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN092230	Escherichia coli plasmid pJN11NDM5, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN017707	Escherichia coli plasmid pCNUH-11, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_025130	Raoultella planticola strain RJA274 plasmid NDM-1, complete sequence	32835-32866	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041956	Escherichia coli strain EC2 plasmid pEC2_1, complete sequence	49836-49867	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041947	Klebsiella pneumoniae strain KP2 plasmid pKP2_1, complete sequence	22874-22905	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP020839	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-2, complete sequence	7516-7547	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP020839	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-2, complete sequence	50894-50925	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP011992	Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-43.380kb, complete sequence	18271-18302	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN200942	Escherichia coli strain E648 plasmid pE648NDM-5, complete sequence	20499-20530	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_019157	Klebsiella pneumoniae plasmid pIncX-SHV, complete sequence	31519-31550	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_019162	Klebsiella pneumoniae strain CRE380 plasmid pNDM-HN380, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP018423	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_2, complete sequence	10428-10459	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP012990	Klebsiella pneumoniae strain KpN01 plasmid pKpN01-NDM7, complete sequence	27523-27554	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP033057	Morganella morganii strain L241 plasmid pNDM5-L241, complete sequence	39297-39328	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP037965	Klebsiella pneumoniae strain SCKP020135 plasmid pNDM1_020135, complete sequence	16983-17014	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021836	Klebsiella pneumoniae strain AR_0120 plasmid tig00000583_pilon, complete sequence	18219-18250	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP022694	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_03, complete sequence	26092-26123	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP010881	Escherichia coli strain MNCRE44 plasmid pMNCRE44_5, complete sequence	41191-41222	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034323	Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-NDM, complete sequence	28035-28066	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP026758	Klebsiella aerogenes strain AR_0062 plasmid tig00000058_pilon, complete sequence	20000-20031	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP025215	Klebsiella pneumoniae strain HZW25 plasmid unnamed4, complete sequence	29143-29174	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021692	Escherichia coli strain AR_0151 plasmid tig00001251, complete sequence	34078-34109	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP022351	Klebsiella michiganensis strain K516 plasmid pK516_NDM5, complete sequence	23814-23845	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024833	Escherichia coli strain CREC-532 plasmid pCREC-532_3, complete sequence	18149-18180	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024820	Citrobacter freundii strain CRCB-101 plasmid pCRCB-101_1, complete sequence	33885-33916	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP046274	Enterobacter hormaechei strain E70 plasmid pE70-NDM1, complete sequence	19641-19672	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021534	Escherichia coli strain AR_0149 plasmid tig00000221, complete sequence	2233-2264	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021682	Escherichia coli strain AR_0162 plasmid tig00003144, complete sequence	45182-45213	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP039811	Klebsiella pneumoniae strain C2660 plasmid pC2660-4-NDM, complete sequence	10768-10799	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP029100	Klebsiella pneumoniae strain AR438 plasmid unnamed2	3514-3545	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP036195	Klebsiella pneumoniae strain BA34918 plasmid pIncX3	22143-22174	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP019679	Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-4, complete sequence	19503-19534	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024814	Enterobacter sp. CRENT-193 plasmid pCRENT-193_2, complete sequence	3445-3476	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048327	Escherichia coli strain 61 plasmid p61_A-OXA181, complete sequence	30091-30122	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	KY930325	Klebsiella pneumoniae plasmid pUCLAKPC2, complete sequence	38117-38148	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_020811	Klebsiella pneumoniae strain KPN5047 plasmid pKPN5047, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	KR822247	Escherichia coli strain E0083033-2 plasmid pEc2A, complete sequence	50101-50132	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021542	Klebsiella pneumoniae strain AR_0047 plasmid tig00000003, complete sequence	24504-24535	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024828	Escherichia coli strain CREC-544 plasmid pCREC-544_2, complete sequence	16750-16781	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024818	Escherichia coli strain CREC-629 plasmid pCREC-629_3, complete sequence	8887-8918	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024825	Escherichia coli strain CREC-591 plasmid pCREC-591_4, complete sequence	8033-8064	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP036179	Escherichia coli strain WCHEC025970 plasmid pNDM5_025970, complete sequence	38969-39000	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP036312	Enterobacter hormaechei strain WCHEH090011 plasmid pNDM5_090011, complete sequence	24493-24524	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MG570092	Escherichia coli plasmid pSTIB_IncX3_OXA_181, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_023914	Enterobacter cloacae strain CRE727 plasmid pNDM-HF727, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP009776	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPC-def, complete sequence	79356-79387	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP008799	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence	50296-50327	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP003997	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13d, complete sequence	38910-38941	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048325	Escherichia coli strain 64 plasmid p64_C-OXA181, complete sequence	31423-31454	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048346	Escherichia coli strain 124 plasmid p124_B-OXA181, complete sequence	5284-5315	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP018951	Escherichia coli strain Ecol_276 plasmid pEC276_2, complete sequence	42186-42217	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP028705	Escherichia coli strain VH1 plasmid pVH1, complete sequence	9072-9103	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041053	Enterobacter hormaechei strain C126 plasmid pEnC126OXA181, complete sequence	46846-46877	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP020074	Klebsiella pneumoniae strain AR_0115 plasmid tig00000004, complete sequence	29104-29135	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP020111	Klebsiella pneumoniae strain AR_0098 plasmid tig00000003, complete sequence	615-646	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN178638	Kluyvera cryocrescens strain SCW13 plasmid pNDM1_SCW13, complete sequence	27691-27722	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP038280	Raoultella ornithinolytica strain WLK218 plasmid pWLK-NDM, complete sequence	48824-48855	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP012563	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-2, complete sequence	11780-11811	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048321	Escherichia coli strain 32-4 plasmid p32-4_K-OXA181, complete sequence	31412-31443	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP050158	Enterobacter cloacae plasmid Carbapenemase(NDM-1)_IncX3, complete sequence	37623-37654	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP035910	Klebsiella pneumoniae strain BA4656 plasmid pIncX3	36458-36489	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP023897	Escherichia coli strain FDAARGOS_433 plasmid unnamed4, complete sequence	33047-33078	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034133	Klebsiella quasipneumoniae strain G4584 plasmid pG4584_52.4Kb, complete sequence	27263-27294	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP050157	Escherichia coli plasmid Carbapenemase(NDM-5)_IncX3, complete sequence	12450-12481	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP050161	Escherichia coli plasmid Carbapenemase(NDM-1)_IncX3, complete sequence	13275-13306	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	KX507346	Escherichia coli plasmid pECNDM101, complete sequence	19506-19537	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_LR130550	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 3	4570-4601	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP022575	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1b, complete sequence	20634-20665	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN792919	Enterobacter hormaechei subsp. steigerwaltii strain ST190 plasmid pLAU_ENM17_OXA181, complete sequence	40188-40219	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP050375	Klebsiella pneumoniae strain 50595 plasmid p50595_OXA_181, complete sequence	47223-47254	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_019083	Escherichia coli plasmid pEC14_35, complete sequence	9047-9078	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021715	Klebsiella pneumoniae strain AR_0129 plasmid tig00000002, complete sequence	17234-17265	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP024806	Escherichia coli strain AMA1167 plasmid pAMA1167-OXA-181, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN335922	Escherichia coli strain GD1-16 plasmid pNDM-T16, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP029386	Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pNDM6_040074, complete sequence	38828-38859	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP045195	Klebsiella pneumoniae strain YML0508 plasmid pOXA181_YML0508, complete sequence	29204-29235	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP028182	Klebsiella pneumoniae strain CFSAN054110 plasmid pGMI16-005_02, complete sequence	8944-8975	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	LC536680	Klebsiella pneumoniae MyNCGM036 plasmid pMyNCGM036, complete sequence	30093-30124	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_019384	Klebsiella pneumoniae plasmid pKpS90, complete sequence	43256-43287	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP027051	Klebsiella pneumoniae strain 20_GR_12 plasmid IncX3, complete sequence	30762-30793	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	LC545851	Escherichia coli Ec-MW07 plasmid pEc-MW07_NDM DNA, complete sequence	4004-4035	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP031138	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_4, complete sequence	17197-17228	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP026577	Escherichia coli strain WCHEC005237 plasmid pNDM5_005237, complete sequence	18897-18928	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP028577	Escherichia coli strain WCHEC005784 plasmid pNDM5_005784, complete sequence	5376-5407	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP032190	Klebsiella pneumoniae strain AR_0075 plasmid unnamed5, complete sequence	11041-11072	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MT028409	Klebsiella pneumoniae strain BS407 plasmid pBS407-3, complete sequence	25525-25556	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN865121	Escherichia coli strain SCNJ06 plasmid pNDM5_SCNJ06, complete sequence	16040-16071	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP052507	Klebsiella pneumoniae strain B16KP0226 plasmid pB16KP0226-2, complete sequence	8011-8042	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP026413	Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence	267-298	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_020552	Citrobacter freundii plasmid pYE315203, complete sequence	28929-28960	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP015825	Klebsiella pneumoniae isolate blood sample 2 plasmid 3, complete sequence	14285-14316	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP032305	Salmonella enterica subsp. enterica serovar Braenderup strain FORC93 plasmid unnamed1, complete sequence	11393-11424	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP023188	Klebsiella michiganensis strain K518 plasmid pK518_NDM5, complete sequence	19011-19042	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP027157	Klebsiella pneumoniae strain AR_0361 plasmid unnamed6	21163-21194	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP028786	Klebsiella pneumoniae strain SCKP020049 plasmid pNDM1_020049, complete sequence	1156-1187	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	AP023227	Escherichia coli YJ3 plasmid pYJ3-NDM1 DNA, complete genome	9965-9996	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP028536	Enterobacter hormaechei strain SCEH020042 plasmid pNDM5_020042, complete sequence	26561-26592	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP043513	Enterobacter kobei strain EB_P8_L5_01.19 plasmid unnamed2, complete sequence	11743-11774	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP031373	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_6, complete sequence	17229-17260	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP041938	Klebsiella pneumoniae strain KP14003 plasmid pNDM-KP14003, complete sequence	8215-8246	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048028	Escherichia coli strain GZEC065 plasmid pNDM5-GZEC065, complete sequence	32024-32055	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN227183	Klebsiella pneumoniae strain 709 plasmid pKP709-OXA181, complete sequence	4004-4035	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP023202	Escherichia coli strain TUM18780 plasmid pMTY18780-5_IncX3, complete sequence	30091-30122	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP023210	Escherichia coli strain TUM18781 plasmid pMTY18781-5, complete sequence	53-84	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NC_022740	Klebsiella pneumoniae strain MGR-K194 plasmid pNDM_MGR194, complete sequence	19503-19534	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP019073	Escherichia coli strain CRE1493 plasmid p1493-2, complete sequence	21042-21073	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP031884	Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence	69374-69405	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP035125	Escherichia coli strain EC25 plasmid pEC25_NDM-7, complete sequence	8990-9021	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MK715437	Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pNDM5-SCNJ1, complete sequence	18493-18524	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP034591	Escherichia coli strain L37 plasmid pL37-3, complete sequence	42520-42551	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP054267	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence	6975-7006	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP054717	Salmonella enterica strain 85-0120 plasmid unnamed1, complete sequence	79764-79795	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	CP028781	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pNDM5_020046, complete sequence	109780-109811	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP028718	Klebsiella pneumoniae strain SCM96 plasmid pSCM96-2, complete sequence	6365-6396	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP032889	Escherichia coli strain SCEC020022 plasmid pNDM5_020022, complete sequence	25446-25477	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018837	Escherichia coli strain M517 plasmid pM517-OXA181, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018838	Escherichia coli strain M518 plasmid pM518-OXA181, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018831	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-OXA181, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018836	Escherichia coli strain M513 plasmid pM513-OXA181, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP026015	Klebsiella variicola strain 13450 plasmid p13450-3, complete sequence	36659-36690	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP025007	Klebsiella pneumoniae strain AUSMDU00003562 plasmid pAUSMDU3562-2, complete sequence	26224-26255	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP042935	Escherichia coli 042 plasmid p1-Ec-BERN-042, complete sequence	10593-10624	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021759	Klebsiella pneumoniae strain AR_0138 plasmid tig00000002, complete sequence	42204-42235	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021901	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0136 plasmid tig00001456_pilon, complete sequence	903-934	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MG773377	Escherichia coli strain LSB54 plasmid pLSB54-NDM-5, complete sequence	17350-17381	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MG833404	Kluyvera intermedia plasmid pEnin-51781cz, complete sequence	15265-15296	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MG833405	Escherichia coli plasmid pEsco-4382cz, complete sequence	15265-15296	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018142	Escherichia coli strain M213 isolate M213 plasmid pM213_X3, complete sequence	25220-25251	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018146	Escherichia coli strain M216 isolate M216 plasmid pM216_X3, complete sequence	25220-25251	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_AP018141	Escherichia coli strain M110 isolate M110 plasmid pM110_X3, complete sequence	25220-25251	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP026476	Escherichia coli strain KBN10P04869 plasmid pKBN10P04869C, complete sequence	24592-24623	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP045062	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p3, complete sequence	8625-8656	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP021738	Escherichia coli strain AR_0150 plasmid tig00000260, complete sequence	17330-17361	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP036205	Escherichia coli strain L725 plasmid pNDM5-L725, complete sequence	9976-10007	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN937240	Enterobacter cloacae strain BSI034 plasmid pBSI034-NDM1, complete sequence	16685-16716	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP045055	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p3, complete sequence	8625-8656	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_LR595693	Escherichia coli isolate EcMAD1 plasmid pEcMAD2	22414-22445	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412917	Escherichia coli strain ABC264 plasmid pABC264-OXA-181, complete sequence	26370-26401	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK450346	Escherichia coli strain Z244 plasmid pNDM-Z244, complete sequence	25838-25869	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372393	Klebsiella pneumoniae strain ABC369 plasmid pABC369-NDM-5, complete sequence	20146-20177	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK450347	Escherichia coli strain Z214 plasmid pNDM-Z214, complete sequence	24062-24093	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK450348	Klebsiella pneumoniae strain K725 plasmid pNDM-K725, complete sequence	41491-41522	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK628734	Klebsiella pneumoniae strain GDQ8D112M plasmid pGDQ8D112M-NDM, complete sequence	13288-13319	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK308632	Klebsiella pneumoniae strain LDR plasmid pNDM5-LDR, complete sequence	23771-23802	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372385	Morganella morganii strain ABC140 plasmid pABC140-NDM-1, complete sequence	27482-27513	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372381	Klebsiella pneumoniae strain ABC52 plasmid pABC52-NDM-1, complete sequence	27456-27487	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK773535	Klebsiella pneumoniae strain QDE2 plasmid pQDE2-A, complete sequence	21053-21084	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MN064714	Klebsiella pneumoniae strain RJY9645 plasmid pY9645-NDM5, complete sequence	20530-20561	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN276078	Enterobacter cloacae strain GZ6DS3 plasmid pHN6DS3,complete sequence	21818-21849	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN276079	Escherichia coli strain GZ7CS2 plasmid pHN7CS2,complete sequence	21818-21849	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	MN276082	Citrobacter freundii strain GZ7DS4 plasmid pHN7DS4,complete sequence	21564-21595	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP032424	Escherichia coli strain SCEC020001 plasmid pNDM5_020001, complete sequence	11251-11282	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK033580	Escherichia coli strain HZ11 plasmid pHNHZ11-1, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK033579	Escherichia coli strain YX6P67 plasmid pHNYX667-1, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK033583	Escherichia coli strain HZ18 plasmid pHNHZ18-1, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH909333	Klebsiella pneumoniae strain 7-SP plasmid p7SP-NDM, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH909346	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-NDM, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH909335	Klebsiella pneumoniae strain 11-SP plasmid p11SP-NDM, complete sequence	28927-28958	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH917283	Klebsiella pneumoniae strain A575 plasmid pA575-NDM, complete sequence	32836-32867	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK033581	Escherichia coli strain YX6P58 plasmid pHNYX658-1, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK033578	Escherichia coli strain YX6P44 plasmid pHNYX644-1, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH105050	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence	199272-199303	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH909343	Klebsiella pneumoniae strain 1012018 plasmid p12018-NDM, complete sequence	31993-32024	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH909347	Klebsiella pneumoniae strain 362713 plasmid p362713-NDM, complete sequence	29854-29885	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH286949	Escherichia coli strain AHM6C87 plasmid pHNAH687, complete sequence	19938-19969	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234505	Escherichia coli strain CRE3694 plasmid pNDM-HK3694, complete sequence	27988-28019	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH917282	Klebsiella pneumoniae strain A457 plasmid pA457-NDA, complete sequence	28923-28954	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH286946	Escherichia coli strain AHM5C66 plasmid pHNAH566, complete sequence	19853-19884	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234499	Escherichia coli strain CRE3836 plasmid pNDM-HK3836, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH917280	Klebsiella pneumoniae strain QDE2 plasmid pQDE2-NDM, complete sequence	12749-12780	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234509	Escherichia coli strain CRE2967 plasmid pNDM-HK2967, complete sequence	22224-22255	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH286947	Escherichia coli strain AHM6C11 plasmid pHNAH611, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH347484	Escherichia coli strain 135 plasmid pEC135, complete sequence	32256-32287	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH349095	Escherichia coli strain 948 plasmid pMTC948, complete sequence	17655-17686	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK317995	Klebsiella pneumoniae strain CRE plasmid pAN65-3, complete sequence	12560-12591	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372386	Klebsiella pneumoniae strain BC700 plasmid pBC700-NDM-1, complete sequence	27456-27487	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK264770	Klebsiella pneumoniae strain KP89 plasmid pKP89, complete sequence	38911-38942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412914	Klebsiella pneumoniae strain ABC220 plasmid pABC220-KPC-2, complete sequence	21791-21822	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412915	Klebsiella pneumoniae strain ABC260 plasmid pABC260-OXA-181, complete sequence	26371-26402	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412920	Klebsiella pneumoniae strain BC-13-947 plasmid pBC947-OXA-181, complete sequence	26370-26401	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH107030	Klebsiella pneumoniae strain CZPF140026 plasmid pTBCZNDM01, complete sequence	30677-30708	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234501	Klebsiella pneumoniae strain CRE3816 plasmid pNDM-HK3816, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH286950	Escherichia coli strain AHM6C88 plasmid pHNAH688, complete sequence	19938-19969	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH161191	Klebsiella pneumoniae strain SCKLB138 plasmid pSCKLB138-2, complete sequence	7817-7848	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234504	Klebsiella pneumoniae strain CRE3706 plasmid pNDM-HK3706, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH341575	Klebsiella pneumoniae strain MYKLB95 plasmid pMYKLB95-2, complete sequence	41715-41746	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH781720	Klebsiella pneumoniae strain SCKLB684 plasmid pSCKLB684-ndm, complete sequence	9072-9103	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK256964	Escherichia coli strain R15 plasmid pR15_NDM-5, complete sequence	15229-15260	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412916	Escherichia coli strain ABC239 plasmid pABC239-OXA-181, complete sequence	26370-26401	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372391	Escherichia coli strain ABC268 plasmid pABC268-NDM-5, complete sequence	20123-20154	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412918	Escherichia coli strain ABC356 plasmid pABC356, complete sequence	26370-26401	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK412919	Escherichia coli strain ABC381 plasmid pABC381-OXA-181, complete sequence	26370-26401	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK416154	Escherichia coli strain AR24.2b plasmid pAN-OXA-181, complete sequence	40856-40887	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372388	Enterobacter cloacae strain ABC302 plasmid pABC302-NDM-4, complete sequence	24293-24324	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK450349	Klebsiella aerogenes strain CR33 plasmid pNDM-CR33, complete sequence	25837-25868	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372380	Enterobacter cloacae strain ABC40 plasmid pABC40-NDM-1, complete sequence	28926-28957	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MK372382	Escherichia coli strain ABC54 plasmid pABC54-NDM-1, complete sequence	27914-27945	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP020090	Enterobacter cloacae strain PIMB10EC27 plasmid pEC27-1, complete sequence	12879-12910	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234503	Escherichia coli strain CRE3712 plasmid pNDM-HK3712, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG252891	Escherichia coli strain Esco-5256cz plasmid pEsco-5256cz, complete sequence	7743-7774	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF547509	Escherichia coli strain P785MEM plasmid pP785-NDM5, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF458176	Escherichia coli strain CCD1 plasmid pNDM-20 clone ST1114, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG825382	Escherichia coli strain 977 plasmid p977-NDM, complete sequence	32086-32117	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG825368	Escherichia coli strain 787 plasmid p787-NDM, complete sequence	32086-32117	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG825384	Escherichia coli strain 1079 plasmid p1079-NDM, complete sequence	32086-32117	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF547507	Escherichia coli strain P788A-032 plasmid pP788A-NDM5, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF547511	Escherichia coli strain P744 plasmid pP744T-NDM5, complete sequence	20296-20327	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF547508	Escherichia coli strain P855MEM plasmid pP855-NDM5, complete sequence	20911-20942	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF344560	Enterobacter hormaechei strain 128379 plasmid p128379-NDM, complete sequence	35578-35609	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG252892	Enterobacter cloacae strain Encl-922cz plasmid pEncl-922cz, complete sequence	15265-15296	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG545911	Escherichia coli strain EC463 plasmid pEC463-NDM5, complete sequence	19487-19518	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG591703	Escherichia coli strain EC36 plasmid pNDM-EC36, complete sequence	18960-18991	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG702491	Escherichia coli strain CC1706-01 plasmid pD6-OXA_1_1, complete sequence	4003-4034	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH061381	Enterobacter cloacae strain En_MCR4 plasmid pEn_NDM, complete sequence	20630-20661	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH328008	Enterobacter cloacae strain 150 plasmid pEC150, complete sequence	20661-20692	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH143074	Escherichia coli strain CZEC1507017 plasmid pTBCZNDM03, complete sequence	11893-11924	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH286948	Escherichia coli strain AHM6C71 plasmid pHNAH671, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH094148	Escherichia coli strain A0917122A14A plasmid pNDM-5_A0917122, complete sequence	26048-26079	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH286945	Escherichia coli strain AHM5C07 plasmid pHNAH507-1, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH594478	Citrobacter freundii strain AA593 plasmid pIBAC_Incx3_A/C, complete sequence	161253-161284	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH105052	Escherichia coli strain EC600 plasmid pSL131T_IncX3, complete sequence	26682-26713	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH523639	Escherichia coli strain JN05 plasmid pJN05NDM7, complete sequence	21052-21083	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_KY499796	Klebsiella pneumoniae strain IN03-01 plasmid pIN03-01, complete sequence	24151-24182	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MF415608	Enterobacter cloacae strain hhy03 plasmid pNDM-BJ03, complete sequence	35016-35047	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MH234502	Escherichia coli strain CRE3774 plasmid pNDM-HK3774, complete sequence	20297-20328	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_MG252893	Raoultella ornithinolytica strain pRor-30818cz plasmid Ror-30818cz, complete sequence	7743-7774	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP031725	Enterobacter hormaechei strain WCHEH020038 plasmid pNDM5_020038, complete sequence	7305-7336	9	0.719
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP027204	Escherichia coli strain WCHEC025943 plasmid pNDM5_025943, complete sequence	19400-19431	9	0.719
NZ_CP021456_2	2.19\|126273\|32\|NZ_CP021456\|CRT	126273-126304	32	MN693134	Marine virus AFVG_25M117, complete genome	5200-5231	9	0.719
NZ_CP021456_2	2.22\|126456\|32\|NZ_CP021456\|CRT	126456-126487	32	MK448723	Streptococcus phage Javan271, complete genome	11021-11052	9	0.719
NZ_CP021456_3	3.3\|1238473\|32\|NZ_CP021456\|PILER-CR	1238473-1238504	32	NC_047897	Lactobacillus phage Lenus, complete genome	42994-43025	9	0.719
NZ_CP021456_5	5.4\|2319471\|30\|NZ_CP021456\|CRISPRCasFinder,CRT,PILER-CR	2319471-2319500	30	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	555137-555166	9	0.7
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_KY075650	Escherichia coli strain GD17 plasmid pGD17-2, complete sequence	46242-46274	10	0.697
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	CP031286	Escherichia fergusonii strain 40A plasmid p80_40A, complete sequence	3495-3527	10	0.697
NZ_CP021456_1	1.8\|116203\|33\|NZ_CP021456\|CRISPRCasFinder	116203-116235	33	NZ_CP040808	Escherichia fergusonii strain EFCF056 plasmid pEF03, complete sequence	5666-5698	10	0.697
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NC_010853	Bacillus coagulans plasmid pMSR0, complete sequence	6192-6223	10	0.688
NZ_CP021456_1	1.16\|116204\|32\|NZ_CP021456\|CRT	116204-116235	32	NZ_AP018829	Asticcacaulis excentricus strain M6 plasmid pASEM-1, complete sequence	56879-56910	10	0.688
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP013716	Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence	15679-15710	10	0.688
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP013716	Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence	47914-47945	10	0.688
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP044166	Campylobacter coli strain AR-0416 plasmid pAR-0416	175856-175887	10	0.688
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP028186	Campylobacter jejuni strain CFSAN054107 plasmid pGMI16-002, complete sequence	10139-10170	10	0.688
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP048757	Campylobacter jejuni strain ZS006 plasmid pCJ41K-01, complete sequence	1739-1770	10	0.688
NZ_CP021456_2	2.14\|125968\|32\|NZ_CP021456\|CRT	125968-125999	32	NZ_CP030195	Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence	11802-11833	10	0.688
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	NC_011216	Burkholderia phage KS10, complete genome	26614-26645	10	0.688
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	148110-148141	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP014152	Clostridium botulinum strain BrDura plasmid pRSJ20_1, complete sequence	191506-191537	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP006909	Clostridium botulinum CDC_1436 plasmid pCBG, complete sequence	18130-18161	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP013684	Clostridium botulinum strain AM282 plasmid pRSJ10_1, complete sequence	160742-160773	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP013710	Clostridium botulinum strain F634 plasmid pRSJ2_3, complete sequence	87848-87879	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NC_010418	Clostridium botulinum A3 str. Loch Maree plasmid pCLK, complete sequence	265353-265384	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP013700	Clostridium botulinum strain AM1195 plasmid pRSJ11_1, complete sequence	8277-8308	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NC_025146	Clostridium botulinum plasmid pCB111 DNA, complete sequence, strain: 111	138753-138784	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NC_012654	Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence	219166-219197	11	0.656
NZ_CP021456_1	1.13\|116021\|32\|NZ_CP021456\|CRT	116021-116052	32	NZ_CP031095	Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence	162986-163017	11	0.656
NZ_CP021456_2	2.3\|126028\|33\|NZ_CP021456\|PILER-CR,CRISPRCasFinder	126028-126060	33	NC_011216	Burkholderia phage KS10, complete genome	26614-26646	11	0.667
NZ_CP021456_2	2.15\|126029\|32\|NZ_CP021456\|CRT	126029-126060	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	596045-596076	11	0.656
NZ_CP021456_3	3.3\|1238473\|32\|NZ_CP021456\|PILER-CR	1238473-1238504	32	NC_014390	Butyrivibrio proteoclasticus B316 plasmid pCY186, complete sequence	42560-42591	11	0.656

1. spacer 1.2|115837|33|NZ_CP021456|CRISPRCasFinder matches to NZ_KJ868092 (UNVERIFIED: Lactobacillus pentosus strain F03 plasmid pF03-5, complete sequence) position: , mismatch: 0, identity: 1.0

tggagtctatatttaaaaggcttgacagtcaag	CRISPR spacer
tggagtctatatttaaaaggcttgacagtcaag	Protospacer
*********************************

2. spacer 1.10|115838|32|NZ_CP021456|CRT matches to NZ_KJ868092 (UNVERIFIED: Lactobacillus pentosus strain F03 plasmid pF03-5, complete sequence) position: , mismatch: 0, identity: 1.0

ggagtctatatttaaaaggcttgacagtcaag	CRISPR spacer
ggagtctatatttaaaaggcttgacagtcaag	Protospacer
********************************

3. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to KJ868088 (Lactobacillus pentosus strain F03 plasmid pF03-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tgcctagttttttgtttagaaactcatcaacat	Protospacer
*********************************

4. spacer 2.14|125968|32|NZ_CP021456|CRT matches to KJ868088 (Lactobacillus pentosus strain F03 plasmid pF03-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
gcctagttttttgtttagaaactcatcaacat	Protospacer
********************************

5. spacer 3.9|1238655|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP018797 (Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence) position: , mismatch: 0, identity: 1.0

tataacctcccataatgtatttgttacaacagt	CRISPR spacer
tataacctcccataatgtatttgttacaacagt	Protospacer
*********************************

6. spacer 3.9|1238655|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 0, identity: 1.0

tataacctcccataatgtatttgttacaacagt	CRISPR spacer
tataacctcccataatgtatttgttacaacagt	Protospacer
*********************************

7. spacer 3.9|1238655|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 0, identity: 1.0

tataacctcccataatgtatttgttacaacagt	CRISPR spacer
tataacctcccataatgtatttgttacaacagt	Protospacer
*********************************

8. spacer 3.9|1238655|33|NZ_CP021456|CRISPRCasFinder,CRT matches to CP002036 (Lactobacillus salivarius CECT 5713 plasmid pHN2, complete sequence) position: , mismatch: 0, identity: 1.0

tataacctcccataatgtatttgttacaacagt	CRISPR spacer
tataacctcccataatgtatttgttacaacagt	Protospacer
*********************************

9. spacer 3.9|1238655|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_AP014681 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-1, complete sequence) position: , mismatch: 0, identity: 1.0

tataacctcccataatgtatttgttacaacagt	CRISPR spacer
tataacctcccataatgtatttgttacaacagt	Protospacer
*********************************

10. spacer 3.9|1238655|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_LN898145 (Lactobacillus oligofermentans DSM 15707 = LMG 22743 isolate LACOL plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

tataacctcccataatgtatttgttacaacagt	CRISPR spacer
tataacctcccataatgtatttgttacaacagt	Protospacer
*********************************

11. spacer 3.12|1238658|29|NZ_CP021456|PILER-CR matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 0, identity: 1.0

aacctcccataatgtatttgttacaacag	CRISPR spacer
aacctcccataatgtatttgttacaacag	Protospacer
*****************************

12. spacer 3.12|1238658|29|NZ_CP021456|PILER-CR matches to CP002036 (Lactobacillus salivarius CECT 5713 plasmid pHN2, complete sequence) position: , mismatch: 0, identity: 1.0

aacctcccataatgtatttgttacaacag	CRISPR spacer
aacctcccataatgtatttgttacaacag	Protospacer
*****************************

13. spacer 3.12|1238658|29|NZ_CP021456|PILER-CR matches to NZ_CP018797 (Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence) position: , mismatch: 0, identity: 1.0

aacctcccataatgtatttgttacaacag	CRISPR spacer
aacctcccataatgtatttgttacaacag	Protospacer
*****************************

14. spacer 3.12|1238658|29|NZ_CP021456|PILER-CR matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 0, identity: 1.0

aacctcccataatgtatttgttacaacag	CRISPR spacer
aacctcccataatgtatttgttacaacag	Protospacer
*****************************

15. spacer 3.12|1238658|29|NZ_CP021456|PILER-CR matches to NZ_AP014681 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-1, complete sequence) position: , mismatch: 0, identity: 1.0

aacctcccataatgtatttgttacaacag	CRISPR spacer
aacctcccataatgtatttgttacaacag	Protospacer
*****************************

16. spacer 3.12|1238658|29|NZ_CP021456|PILER-CR matches to NZ_LN898145 (Lactobacillus oligofermentans DSM 15707 = LMG 22743 isolate LACOL plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

aacctcccataatgtatttgttacaacag	CRISPR spacer
aacctcccataatgtatttgttacaacag	Protospacer
*****************************

17. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

18. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025208 (Lactobacillus sakei strain WiKim0074 plasmid pLSW74_2, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

19. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032650 (Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

20. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028232 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

21. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP017932 (Lactobacillus sakei strain LK-145 plasmid pLs145-a, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

22. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022710 (Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

23. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015967 (Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

24. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025416 (Lactobacillus plantarum strain X7021 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattctcat	Protospacer
******************************

25. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_018222 (Enterococcus faecalis D32 plasmid EFD32pA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

26. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011284 (Enterococcus faecium strain E39 plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

27. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

28. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX810026 (Enterococcus faecium strain Efm0038 plasmid pJEG043, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

29. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX579977 (Enterococcus faecalis strain EF123 plasmid pEF123, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

30. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX579977 (Enterococcus faecalis strain EF123 plasmid pEF123, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

31. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX810025 (Enterococcus faecium strain Efm008 plasmid pJEG040, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

32. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX574671 (Enterococcus faecium strain V24 plasmid pHvH-V24, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

33. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

34. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX274135 (Staphylococcus arlettae strain SA-01 plasmid pSA-01, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

35. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK798157 (Enterococcus hirae strain fas4 plasmid pfas4-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

36. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KJ645709 (Enterococcus faecium strain P26 plasmid pXD5, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

37. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KJ645709 (Enterococcus faecium strain P26 plasmid pXD5, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

38. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KP842560 (Enterococcus faecium strain 17i48 ST17 plasmid pRUM-like, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

39. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR066794 (Enterococcus faecium strain Efm0123 plasmid pJEG050, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

40. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041740 (Enterococcus faecalis EnGen0107 strain B594 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

41. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to HF570055 (Lactobacillus reuteri 1063 plasmid pLUL631, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

42. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LT603681 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

43. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022486 (Enterococcus faecalis ARO1/DG plasmid pARO1.3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

44. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028725 (Enterococcus faecalis strain CVM N60443F plasmid pN60443F-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

45. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028726 (Enterococcus faecalis strain CVM N60443F plasmid pN60443F-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

46. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_004669 (Enterococcus faecalis V583 plasmid pTEF1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

47. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_003528 (Lactobacillus reuteri plasmid pTE44, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

48. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018831 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p2_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

49. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026081 (Staphylococcus aureus strain FDAARGOS_12 plasmid unnamed) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

50. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_021170 (Enterococcus faecium plasmid pF856, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

51. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020486 (Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

52. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK784777 (Enterococcus faecalis strain E211 plasmid pE211-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

53. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK784777 (Enterococcus faecalis strain E211 plasmid pE211-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

54. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK784777 (Enterococcus faecalis strain E211 plasmid pE211-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

55. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

56. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025078 (Enterococcus faecium strain LS170308 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

57. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041269 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

58. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_014726 (Enterococcus faecalis plasmid pTW9, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

59. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_014726 (Enterococcus faecalis plasmid pTW9, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

60. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013996 (Enterococcus faecium strain 6E6 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

61. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014452 (Enterococcus faecium strain ATCC 700221 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

62. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018072 (Enterococcus faecium strain VRE001 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

63. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027519 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

64. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027500 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

65. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027509 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

66. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027510 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

67. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027505 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

68. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135300 (Enterococcus faecium isolate E7429 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

69. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135289 (Enterococcus faecium isolate E7199 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

70. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135290 (Enterococcus faecium isolate E7199 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

71. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135335 (Enterococcus faecium isolate E7471 plasmid 5) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

72. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135342 (Enterococcus faecium isolate E7356 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

73. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC377536 (Staphylococcus aureus plasmid pNTUH_9448 NTUH_9448 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

74. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC377537 (Staphylococcus aureus plasmid pNTUH_1027 NTUH_1027 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

75. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC377538 (Staphylococcus aureus plasmid pNTUH_3874 NTUH_3874 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

76. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC377539 (Staphylococcus aureus plasmid pNTUH_6457 NTUH_6457 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

77. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC377540 (Staphylococcus aureus plasmid pNTUH_5066148 NTUH_5066148 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

78. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_012628 (Lactobacillus plantarum plasmid pLFE1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

79. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046078 (Enterococcus faecium strain VRE plasmid p4_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

80. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

81. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

82. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

83. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

84. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

85. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

86. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025755 (Enterococcus faecium strain AALTL plasmid pEFA-790c, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

87. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027516 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

88. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_015213 (Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

89. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135247 (Enterococcus faecium isolate E6988 plasmid 5) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

90. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135281 (Enterococcus faecium isolate E6975 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

91. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135283 (Enterococcus faecium isolate E6975 plasmid 6) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

92. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

93. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

94. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

95. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135239 (Enterococcus faecium isolate E7067 plasmid 5) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

96. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135200 (Enterococcus faecium isolate E6055 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

97. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135260 (Enterococcus faecium isolate E4457 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

98. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034168 (Enterococcus avium strain 352 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

99. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_011996 (Macrococcus caseolyticus JCSC5402 plasmid pMCCL2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

100. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

101. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_004532 (Lactobacillus reuteri endogenous plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

102. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

103. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019210 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

104. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015818 (Staphylococcus aureus strain FORC_039 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

105. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_005000 (Enterococcus faecium U37 plasmid pRUM, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

106. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_013319 (Staphylococcus aureus plasmid pI258, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

107. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018764 (Pediococcus acidilactici strain BCC1 plasmid pbcp1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

108. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

109. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135430 (Enterococcus faecium isolate E8927 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

110. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135437 (Enterococcus faecium isolate E8691 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

111. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

112. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135484 (Enterococcus faecium isolate E4456 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

113. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135477 (Enterococcus faecium isolate E8423 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

114. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

115. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

116. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135230 (Enterococcus faecium isolate E7025 plasmid 5) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

117. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022823 (Enterococcus saigonensis strain VE80 plasmid pVE80-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

118. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

119. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135366 (Enterococcus faecium isolate E8195 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

120. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135403 (Enterococcus faecium isolate E8377 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

121. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135396 (Enterococcus faecium isolate E8290 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

122. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024844 (Streptococcus iniae strain FP5228 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

123. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

124. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_021988 (Enterococcus faecium Aus0085 plasmid p3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

125. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135346 (Enterococcus faecium isolate E8202 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

126. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135327 (Enterococcus faecium isolate E7654 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

127. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

128. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135387 (Enterococcus faecium isolate E7933 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

129. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135320 (Enterococcus faecium isolate E7663 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

130. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

131. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036247 (Enterococcus faecalis R712 plasmid pR712_01, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

132. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

133. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

134. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011830 (Enterococcus faecium strain UW8175 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

135. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

136. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP019396 (Enterococcus faecium strain QU 50 plasmid pQS50, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

137. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LN999989 (Enterococcus faecium isolate EFE11651 plasmid III, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

138. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049776 (Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

139. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049776 (Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

140. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

141. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

142. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028836 (Enterococcus faecalis strain FC plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

143. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028836 (Enterococcus faecalis strain FC plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

144. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028836 (Enterococcus faecalis strain FC plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

145. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_019687 (Clostridium perfringens plasmid pCpb2-CP1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

146. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_020237 (Staphylococcus hyicus plasmid pSTE1 complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

147. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

148. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_002136 (Streptococcus agalactiae plasmid pGB3634, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

149. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023426 (Enterococcus faecium strain K60-39 plasmid pTT39_p3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

150. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

151. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

152. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_014959 (Enterococcus faecium plasmid pS177, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

153. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC102479 (Staphylococcus aureus plasmid pNTUH_3874 DNA, complete sequence, strain: NTUH_3874) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

154. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041279 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

155. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044494 (Streptococcus mutans strain MD plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

156. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044494 (Streptococcus mutans strain MD plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

157. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040708 (Enterococcus faecium strain HOU503 plasmid p2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

158. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_013963 (Bacillus sp. BS-01 plasmid pBS-01, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

159. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

160. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044276 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

161. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017795 (Enterococcus faecium strain E240 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

162. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019995 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-3) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

163. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

164. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

165. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_004566 (Lactobacillus fermentum plasmid pLME300) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

166. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

167. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028286 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

168. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_017962 (Enterococcus faecium DO plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

169. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020355 (Staphylococcus aureus strain FORC59 plasmid pFORC59, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

170. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

171. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042214 (Enterococcus faecalis strain L15 plasmid pL15, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

172. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042217 (Enterococcus faecalis strain L8 plasmid pL8, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

173. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019972 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-2 sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

174. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

175. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037957 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

176. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

177. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135310 (Enterococcus faecium isolate E7240 plasmid 4) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

178. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135311 (Enterococcus faecium isolate E7240 plasmid 5) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

179. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

180. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

181. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

182. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

183. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033211 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.5, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

184. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018539 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

185. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018539 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

186. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

187. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

188. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018131 (Enterococcus faecium strain A_020709_82 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

189. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP019410 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20S, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

190. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016166 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

191. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018825 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p2_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

192. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_010540 (Lactococcus garvieae plasmid pKL0018 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

193. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_010540 (Lactococcus garvieae plasmid pKL0018 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

194. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

195. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038162 (Enterococcus faecium strain GZ8 plasmid pGZ8, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

196. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038176 (Enterococcus faecium strain HN11 plasmid pHN11, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

197. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_013514 (Enterococcus faecalis plasmid pAMbeta1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

198. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MH277333 (UNVERIFIED: Listeria monocytogenes strain nh1 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

199. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012464 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p4, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

200. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012431 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

201. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH784601 (Enterococcus faecium strain 25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

202. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH784602 (Enterococcus faecium strain 27 plasmid pC27-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

203. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK140641 (Enterococcus faecalis strain E035 plasmid pE035, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

204. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK140641 (Enterococcus faecalis strain E035 plasmid pE035, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

205. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK140641 (Enterococcus faecalis strain E035 plasmid pE035, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

206. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041081 (Bacillus tropicus strain LM1212-W3 plasmid p8, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

207. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014240 (Selenomonas sp. oral taxon 136 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

208. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023796 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

209. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028728 (Enterococcus faecium strain FSIS1608820 plasmid pFSIS1608820, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

210. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028728 (Enterococcus faecium strain FSIS1608820 plasmid pFSIS1608820, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

211. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF477836 (Macrococcus canis strain KM0218 plasmid pKM0218, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

212. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH431899 (Staphylococcus chromogenes strain Sch-734Lar plasmid pSch-734Lar, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

213. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH465666 (Staphylococcus aureus strain Sau-392Lar plasmid pSau-392Lar, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

214. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG957432 (Enterococcus faecium strain 37BA plasmid pEf37BA, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

215. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH785229 (Staphylococcus aureus strain pa3 plasmid pPA3, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

216. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH785233 (Staphylococcus aureus strain ph2 plasmid pPH2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

217. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK465703 (Enterococcus faecium strain E505 plasmid pE505-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

218. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK465703 (Enterococcus faecium strain E505 plasmid pE505-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

219. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK465703 (Enterococcus faecium strain E505 plasmid pE505-1, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

220. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK465704 (Enterococcus faecium strain E211 plasmid pE211-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

221. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK465704 (Enterococcus faecium strain E211 plasmid pE211-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

222. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK465704 (Enterococcus faecium strain E211 plasmid pE211-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

223. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK784778 (Enterococcus faecalis strain E508 plasmid pE508-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

224. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK784778 (Enterococcus faecalis strain E508 plasmid pE508-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

225. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK784778 (Enterococcus faecalis strain E508 plasmid pE508-2, complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

226. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT598667 (Enterococcus faecium isolate Ef_aus00233 plasmid 5) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

227. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN270279 (Streptococcus phage phi-SsuZKB4_rum, complete genome) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

228. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN270276 (Streptococcus phage phi-SsuSSJ28_rum, complete genome) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

229. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to FN997652 (Streptococcus phage phi-SsUD.1 complete sequence) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

230. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to KT336321 (Streptococcus phage phiSC070807, complete genome) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

231. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN270273 (Streptococcus phage phi-SsuSC05017_rum, complete genome) position: , mismatch: 0, identity: 1.0

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtcttaa	Protospacer
******************************

232. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 0, identity: 1.0

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
taatcccatcttcttcacccaagccagaaagt	Protospacer
********************************

233. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NZ_CP019739 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence) position: , mismatch: 0, identity: 1.0

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
taatcccatcttcttcacccaagccagaaagt	Protospacer
********************************

234. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 0, identity: 1.0

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
taatcccatcttcttcacccaagccagaaagta	Protospacer
*********************************

235. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NZ_CP019739 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence) position: , mismatch: 0, identity: 1.0

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
taatcccatcttcttcacccaagccagaaagta	Protospacer
*********************************

236. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_025160 (Lactobacillus paraplantarum plasmid pC7, complete sequence) position: , mismatch: 1, identity: 0.97

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctacgtcgatttaccgttgacaga	Protospacer
******** ************************

237. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_014164 (Lactobacillus acidipiscis cryptic plasmid pLAC1, complete sequence, strain ACA-DC 1533) position: , mismatch: 1, identity: 0.97

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctacgtcgatttaccgttgacaga	Protospacer
******** ************************

238. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_025160 (Lactobacillus paraplantarum plasmid pC7, complete sequence) position: , mismatch: 1, identity: 0.969

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctacgtcgatttaccgttgacaga	Protospacer
******* ************************

239. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_014164 (Lactobacillus acidipiscis cryptic plasmid pLAC1, complete sequence, strain ACA-DC 1533) position: , mismatch: 1, identity: 0.969

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctacgtcgatttaccgttgacaga	Protospacer
******* ************************

240. spacer 5.3|2319405|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016798 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccaagggcagtacaatctacggtaaggccg	CRISPR spacer
ccaagggcagtacaatctacggtaaagccg	Protospacer
*************************.****

241. spacer 5.5|2319537|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccacggcataagcttagttggttctcctgt	CRISPR spacer
ccacggcataagcttagttggttcgcctgt	Protospacer
************************ *****

242. spacer 5.5|2319537|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014925 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccacggcataagcttagttggttctcctgt	CRISPR spacer
ccacggcataagcttagttggttcgcctgt	Protospacer
************************ *****

243. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046038 (Lactobacillus sakei strain CBA3614 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

caatggccgcccggattgccttattctcat	CRISPR spacer
aaatggccgcccggattgccttattctcat	Protospacer
 *****************************

244. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT907984 (Lactobacillus sakei subsp. sakei 23K plasmid pJ23A1, complete sequence) position: , mismatch: 1, identity: 0.967

caatggccgcccggattgccttattctcat	CRISPR spacer
taatggccgcccggattgccttattctcat	Protospacer
.*****************************

245. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT907987 (Lactobacillus sakei strain T332 plasmid p332A2, complete sequence) position: , mismatch: 1, identity: 0.967

caatggccgcccggattgccttattctcat	CRISPR spacer
taatggccgcccggattgccttattctcat	Protospacer
.*****************************

246. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_004992 (Leuconostoc lactis plasmid pCI411, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

247. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031007 (Lactobacillus curvatus strain TMW 1.1928 plasmid p-1.1928_4, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

248. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

249. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

250. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

251. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

252. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013170 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-14, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

253. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

254. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

255. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

256. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

257. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

258. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

259. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015445 (Lactobacillus helveticus strain FAM8627 plasmid pFAM8627, complete sequence) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

260. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to AP018704 (Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid5 DNA, complete genome) position: , mismatch: 1, identity: 0.967

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaag	Protospacer
.*****************************

261. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX518744 (Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

262. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MF679144 (Escherichia coli plasmid pBJ114-78, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

263. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR213453 (Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 plasmid 2) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

264. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX785323 (Streptococcus suis strain 3372 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagcgtcttaa	Protospacer
**********************.*******

265. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KU130396 (Escherichia coli strain S68 plasmid pS68, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

266. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT818627 (Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

267. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT725788 (Klebsiella pneumoniae strain ST147 plasmid pCC1410-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

268. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR091911 (Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

269. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR936172 (Enterococcus faecium strain Y13 plasmid pY13, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

270. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR936172 (Enterococcus faecium strain Y13 plasmid pY13, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

271. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448818 (Enterococcus faecalis strain 12-7 plasmid p12-7, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

272. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448818 (Enterococcus faecalis strain 12-7 plasmid p12-7, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

273. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448821 (Enterococcus faecalis strain E15 plasmid pE15, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

274. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448821 (Enterococcus faecalis strain E15 plasmid pE15, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

275. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448817 (Enterococcus faecalis strain 11-27 plasmid p11-27, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

276. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448817 (Enterococcus faecalis strain 11-27 plasmid p11-27, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

277. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448820 (Enterococcus faecalis strain D12-2 plasmid pD12-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

278. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448820 (Enterococcus faecalis strain D12-2 plasmid pD12-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

279. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448819 (Enterococcus faecalis strain 14-1 plasmid p14-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

280. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT448819 (Enterococcus faecalis strain 14-1 plasmid p14-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagaaaacagtgtcttaa	Protospacer
*************** **************

281. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to CP022460 (Shigella sonnei strain 2015C-3807 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

282. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX646543 (Shigella boydii strain 2246 plasmid p2246-CTXM, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

283. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP017618 (Escherichia coli strain MRY15-117 plasmid pMRY15-117_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

284. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to KY130431 (Klebsiella pneumoniae plasmid pABC143C-NDM, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

285. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010174 (Escherichia coli strain H8 plasmid B, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

286. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027679 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

287. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029575 (Escherichia coli strain DA33133 plasmid pDA33133-157, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

288. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029734 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed6, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

289. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034964 (Escherichia coli strain WCHEC020032 plasmid pCTXM3_020032, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

290. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MT077885 (Escherichia coli plasmid p37, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

291. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024475 (Shigella flexneri 7b strain 94-3007 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

292. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR213457 (Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 plasmid 3) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

293. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044156 (Shigella flexneri strain AR-0424 plasmid pAR-0424-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

294. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020517 (Escherichia coli strain 222 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

295. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036329 (Klebsiella pneumoniae strain BA28434 plasmid pIncFIA) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

296. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN915010 (Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

297. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN915012 (Escherichia coli strain GD-33 plasmid pNDM33-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

298. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN915013 (Escherichia coli strain TD-33 plasmid pNDM-TD33, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

299. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031549 (Escherichia coli strain cq9 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

300. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012139 (Shigella flexneri 2a strain 981 plasmid 981p2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

301. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC549806 (Escherichia coli VNCEc57 plasmid pVNCEc57 DNA, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

302. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LC549808 (Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

303. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040922 (Escherichia coli strain FC853_EC plasmid p853EC3, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

304. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029580 (Escherichia coli strain DA33137 plasmid pDA33137-178, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

305. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037911 (Escherichia coli strain YSP8-1 plasmid pYSP8-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

306. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041102 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

307. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to CP053755 (Shigella sonnei strain 506 plasmid pMHMC-004, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

308. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to AP014876 (Escherichia coli plasmid pV021-b DNA, complete sequence, strain: V021) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

309. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024831 (Escherichia coli strain CREC-532 plasmid pCREC-532_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

310. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to KY463220 (Escherichia coli plasmid pNDM5-IBAC, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

311. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034932 (Shigella flexneri strain 2013C-3749 plasmid p2013C-3749-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

312. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021684 (Escherichia coli strain AR_0162 plasmid tig00008015, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

313. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024836 (Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

314. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026201 (Escherichia coli strain ECONIH6 plasmid pNDM-d2e9, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

315. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031804 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

316. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021203 (Escherichia coli strain Z1002 plasmid p1002-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

317. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_010864 (Pediococcus acidilactici plasmid pEOC01, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgccttaa	Protospacer
************************.*****

318. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031615 (Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

319. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018147 (Escherichia coli strain M217 isolate M217 plasmid pM217_FII, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

320. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR135491 (Enterococcus faecium isolate E8414 plasmid 4) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtgttaa	Protospacer
************************* ****

321. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048372 (Escherichia coli strain 164 plasmid pC-F-163_A, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

322. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP051690 (Escherichia coli strain SCU-387 plasmid pSCU-387-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

323. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024816 (Escherichia coli strain CREC-629 plasmid pCREC-629_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

324. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033948 (Klebsiella pneumoniae subsp. pneumoniae strain ARLG-3135 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

325. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036181 (Escherichia coli strain WCHEC025970 plasmid p2_025970, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

326. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009860 (Escherichia coli strain ECONIH1 plasmid pECO-824, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

327. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134110 (Enterococcus faecium isolate E6043 plasmid 6) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaaaagtaaacagtgtgttaa	Protospacer
************************* ****

328. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024840 (Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

329. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP017621 (Escherichia coli strain MRY15-131 plasmid pMRY15-131_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

330. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX008967 (Shigella sonnei strain 183660 plasmid p183660, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

331. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048311 (Escherichia coli strain 32-4 plasmid p32-4_A, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

332. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041111 (Escherichia coli strain ECCTRSRTH03 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

333. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050372 (Klebsiella pneumoniae strain 50595 plasmid p50595_ERM, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

334. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050367 (Klebsiella pneumoniae strain 47733 plasmid p47733_NDM_5, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

335. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

336. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018960 (Escherichia coli strain Ecol_422 plasmid pEC422_2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

337. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033094 (Escherichia coli strain CP53 plasmid pCP53-mcr, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

338. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019028 (Escherichia coli strain Ecol_881 plasmid pEC881_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

339. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023918 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

340. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to CP045934 (Shigella sonnei strain AUSMDU00010534 plasmid pAUSMDU00010534_02, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

341. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025708 (Escherichia coli strain YDC107 plasmid pYDC107_184, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

342. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040070 (Escherichia coli strain A1_181 plasmid p_unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

343. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046044 (Acinetobacter towneri strain 19110F47 plasmid p19110F47-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

344. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043949 (Escherichia coli strain AR202.2 plasmid pMPCMY-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

345. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012197 (Escherichia coli strain ECwhn14 plasmid pECwhn14, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

346. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to AP023220 (Escherichia coli M505 plasmid pM505-NDM5 DNA, complete genome) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

347. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to AP023228 (Escherichia coli YJ3 plasmid pYJ3-a DNA, complete genome) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

348. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to AP023236 (Escherichia coli YJ6 plasmid pYJ6-NDM5 DNA, complete genome) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

349. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to LT174531 (Shigella sonnei plasmid pEG430-2, strain EG0430) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

350. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to AP018353 (Escherichia coli plasmid pVE769 DNA, complete genome, strain: E769) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

351. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029974 (Escherichia coli strain 51008369SK1 plasmid p51008369SK1_A, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

352. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015836 (Escherichia coli strain MS6198 plasmid pMS6198B, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

353. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043229 (Escherichia coli strain Ec-050 plasmid pEc-050-CMY-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

354. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043945 (Escherichia coli strain AR216.2b plasmid pMPCMY-2, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

355. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_014615 (Escherichia coli plasmid pETN48, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

356. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033847 (Escherichia coli strain FDAARGOS_497 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

357. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MK649824 (Klebsiella pneumoniae strain BA6201 plasmid pBA6201_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

358. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018136 (Escherichia coli strain M105 isolate M105 plasmid pM105_FII, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

359. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018138 (Escherichia coli strain M107 isolate M107 plasmid pM107_FII, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

360. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018144 (Escherichia coli strain M214 isolate M214 plasmid pM214_FII, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

361. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR213461 (Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 plasmid 4) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

362. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050740 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

363. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041441 (Escherichia coli strain YPE12 plasmid pYPE12-122k, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

364. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT985267 (Escherichia coli strain 637 plasmid RCS61_p, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

365. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT985267 (Escherichia coli strain 637 plasmid RCS61_p, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

366. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT985277 (Escherichia coli strain 522 plasmid RCS65_p, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

367. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH674341 (Escherichia coli strain EC07 plasmid pUR-EC07, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

368. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MN241905 (Salmonella enterica subsp. enterica serovar Typhimurium strain STM3224 plasmid pUY_STM96, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

369. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018939 (Escherichia coli strain JSWP006 plasmid pJSWP006_1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

370. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044043 (Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

371. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045943 (Shigella flexneri 2a strain AUSMDU00010535 plasmid pAUSMDU00010535_02, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

372. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MN218686 (Escherichia coli strain 5M plasmid pISV_IncFII_NDM-5, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

373. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF156697 (Escherichia coli strain BTR plasmid pBTR-CTXM, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

374. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG825377 (Escherichia coli strain 1108 plasmid p1108-emrB, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

375. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG764548 (Escherichia coli strain 11011 plasmid p11011-fosA, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

376. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF344576 (Escherichia coli strain 15061806 plasmid p61806-CTXM, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

377. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LC506717 (Klebsiella pneumoniae strain JUNP054 plasmid pJUNP054, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

378. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LC506718 (Klebsiella pneumoniae strain JUNP055 plasmid pJUNP055, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

379. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LC506720 (Klebsiella pneumoniae strain JUNP268 plasmid pJUNP268, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

380. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN548042 (Klebsiella pneumoniae strain QD23 plasmid pQD23-1, complete sequence) position: , mismatch: 1, identity: 0.967

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
atcctaaaccaagagtaaacagtgtcttaa	Protospacer
************.*****************

381. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NZ_CP031172 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence) position: , mismatch: 1, identity: 0.969

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
taatcccattttcttcacccaagccagaaagt	Protospacer
*********.**********************

382. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NZ_CP014917 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence) position: , mismatch: 1, identity: 0.969

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
taatcccattttcttcacccaagccagaaagt	Protospacer
*********.**********************

383. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 1, identity: 0.969

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
taagcccatcttcttcacccaagccagaaagt	Protospacer
*** ****************************

384. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 1, identity: 0.969

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
taagcccatcttcttcacccaagccagaaagt	Protospacer
*** ****************************

385. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NZ_CP031172 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence) position: , mismatch: 1, identity: 0.97

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
taatcccattttcttcacccaagccagaaagta	Protospacer
*********.***********************

386. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NZ_CP014917 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence) position: , mismatch: 1, identity: 0.97

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
taatcccattttcttcacccaagccagaaagta	Protospacer
*********.***********************

387. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 1, identity: 0.97

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
taagcccatcttcttcacccaagccagaaagta	Protospacer
*** *****************************

388. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 1, identity: 0.97

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
taagcccatcttcttcacccaagccagaaagta	Protospacer
*** *****************************

389. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_014627 (Lactobacillus plantarum plasmid pLPI8, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

390. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_KJ868089 (Lactobacillus pentosus strain F03 plasmid pF03-2, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

391. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_003893 (Lactobacillus plantarum plasmid pLP2000, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

392. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_012220 (Lactobacillus plantarum plasmid pLD1, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

393. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_001370 (Lactobacillus plantarum plasmid pC30il, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

394. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP046660 (Lactobacillus plantarum strain 123-17 plasmid p123-18.4, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

395. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_019321 (Lactobacillus plantarum plasmid pR18, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

396. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_011497 (Lactobacillus plantarum plasmid pLP2111, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

397. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

398. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

399. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

400. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

401. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

402. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

403. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

404. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP004408 (Lactobacillus plantarum DOMLa plasmid unnamed200, complete sequence) position: , mismatch: 2, identity: 0.939

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
taagcccctctaagtcgatttaccgttgacaga	Protospacer
******** *** ********************

405. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP014880 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtatagaaactcatcaacat	Protospacer
*.************* *****************

406. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP014880 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtatagaaactcatcaacat	Protospacer
*.************* *****************

407. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_025165 (Lactobacillus hilgardii plasmid pLAB1000 or pHL1 sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

408. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP014906 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtatagaaactcatcaacat	Protospacer
*.************* *****************

409. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP014906 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtatagaaactcatcaacat	Protospacer
*.************* *****************

410. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_KF559315 (Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

411. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP031207 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

412. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_014135 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

413. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_019900 (Lactobacillus plantarum strain BFE 5092 plasmid pMRI 5.2, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

414. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_MK167463 (Lactobacillus plantarum strain PC518 plasmid pLP325, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

415. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP037439 (Lactobacillus plantarum strain EM plasmid pEM10, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

416. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP037439 (Lactobacillus plantarum strain EM plasmid pEM10, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

417. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP037439 (Lactobacillus plantarum strain EM plasmid pEM10, complete sequence) position: , mismatch: 2, identity: 0.939

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaactcatcaacat	Protospacer
*.************* *****************

418. spacer 2.12|126577|33|NZ_CP021456|CRISPRCasFinder matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 2, identity: 0.939

ctaaaatccgatcattttcggccatcaatcaca	CRISPR spacer
ctaaaatccgatcgttttcggccatcagtcaca	Protospacer
*************.*************.*****

419. spacer 2.12|126577|33|NZ_CP021456|CRISPRCasFinder matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 2, identity: 0.939

ctaaaatccgatcattttcggccatcaatcaca	CRISPR spacer
ctaaaatccgatcgttttcggccatcagtcaca	Protospacer
*************.*************.*****

420. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_014627 (Lactobacillus plantarum plasmid pLPI8, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

421. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_KJ868089 (Lactobacillus pentosus strain F03 plasmid pF03-2, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

422. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_003893 (Lactobacillus plantarum plasmid pLP2000, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

423. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_012220 (Lactobacillus plantarum plasmid pLD1, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

424. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

425. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

426. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

427. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

428. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

429. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

430. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

431. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP004408 (Lactobacillus plantarum DOMLa plasmid unnamed200, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

432. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_001370 (Lactobacillus plantarum plasmid pC30il, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

433. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP046660 (Lactobacillus plantarum strain 123-17 plasmid p123-18.4, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

434. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_019321 (Lactobacillus plantarum plasmid pR18, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

435. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_011497 (Lactobacillus plantarum plasmid pLP2111, complete sequence) position: , mismatch: 2, identity: 0.938

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aagcccctctaagtcgatttaccgttgacaga	Protospacer
******* *** ********************

436. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KF559315 (Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

437. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP014880 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtatagaaactcatcaacat	Protospacer
.************* *****************

438. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP014880 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtatagaaactcatcaacat	Protospacer
.************* *****************

439. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP031207 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

440. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_014135 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

441. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_025165 (Lactobacillus hilgardii plasmid pLAB1000 or pHL1 sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

442. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_019900 (Lactobacillus plantarum strain BFE 5092 plasmid pMRI 5.2, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

443. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP014906 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtatagaaactcatcaacat	Protospacer
.************* *****************

444. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP014906 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtatagaaactcatcaacat	Protospacer
.************* *****************

445. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK167463 (Lactobacillus plantarum strain PC518 plasmid pLP325, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

446. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP037439 (Lactobacillus plantarum strain EM plasmid pEM10, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

447. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP037439 (Lactobacillus plantarum strain EM plasmid pEM10, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

448. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP037439 (Lactobacillus plantarum strain EM plasmid pEM10, complete sequence) position: , mismatch: 2, identity: 0.938

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaactcatcaacat	Protospacer
.************* *****************

449. spacer 2.24|126578|32|NZ_CP021456|CRT matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 2, identity: 0.938

taaaatccgatcattttcggccatcaatcaca	CRISPR spacer
taaaatccgatcgttttcggccatcagtcaca	Protospacer
************.*************.*****

450. spacer 2.24|126578|32|NZ_CP021456|CRT matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 2, identity: 0.938

taaaatccgatcattttcggccatcaatcaca	CRISPR spacer
taaaatccgatcgttttcggccatcagtcaca	Protospacer
************.*************.*****

451. spacer 3.3|1238473|32|NZ_CP021456|PILER-CR matches to NZ_CP019738 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence) position: , mismatch: 2, identity: 0.938

acttcatgatcaacaggaccgtcctttttaac	CRISPR spacer
acttcgtgatcgacaggaccgtcctttttaac	Protospacer
*****.*****.********************

452. spacer 3.3|1238473|32|NZ_CP021456|PILER-CR matches to NZ_CP019747 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence) position: , mismatch: 2, identity: 0.938

acttcatgatcaacaggaccgtcctttttaac	CRISPR spacer
acttcgtgatcgacaggaccgtcctttttaac	Protospacer
*****.*****.********************

453. spacer 3.6|1238472|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP019738 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence) position: , mismatch: 2, identity: 0.939

tacttcatgatcaacaggaccgtcctttttaac	CRISPR spacer
tacttcgtgatcgacaggaccgtcctttttaac	Protospacer
******.*****.********************

454. spacer 3.6|1238472|33|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP019747 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence) position: , mismatch: 2, identity: 0.939

tacttcatgatcaacaggaccgtcctttttaac	CRISPR spacer
tacttcgtgatcgacaggaccgtcctttttaac	Protospacer
******.*****.********************

455. spacer 5.3|2319405|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031171 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_B, complete sequence) position: , mismatch: 2, identity: 0.933

ccaagggcagtacaatctacggtaaggccg	CRISPR spacer
ccaagggaagcacaatctacggtaaggccg	Protospacer
******* **.*******************

456. spacer 5.3|2319405|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019738 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence) position: , mismatch: 2, identity: 0.933

ccaagggcagtacaatctacggtaaggccg	CRISPR spacer
ccaagggaagcacaatctacggtaaggccg	Protospacer
******* **.*******************

457. spacer 5.3|2319405|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019747 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence) position: , mismatch: 2, identity: 0.933

ccaagggcagtacaatctacggtaaggccg	CRISPR spacer
ccaagggaagcacaatctacggtaaggccg	Protospacer
******* **.*******************

458. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019739 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence) position: , mismatch: 2, identity: 0.933

gaccaactttacgtagtccttgttagctga	CRISPR spacer
gaccagcttcacgtagtccttgttagctga	Protospacer
*****.***.********************

459. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 2, identity: 0.933

gaccaactttacgtagtccttgttagctga	CRISPR spacer
gaccagcttcacgtagtccttgttagctga	Protospacer
*****.***.********************

460. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 2, identity: 0.933

gaccaactttacgtagtccttgttagctga	CRISPR spacer
gaccagcttcacgtagtccttgttagctga	Protospacer
*****.***.********************

461. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 2, identity: 0.933

gaccaactttacgtagtccttgttagctga	CRISPR spacer
gaccagcttcacgtagtccttgttagctga	Protospacer
*****.***.********************

462. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_021904 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence) position: , mismatch: 2, identity: 0.933

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttgctttggtagccttacctgaaa	Protospacer
**********.******.************

463. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016798 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence) position: , mismatch: 2, identity: 0.933

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttgccttggtaaccttaccagaca	Protospacer
************************* ** *

464. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_005952 (Lactobacillus brevis plasmid pRH45II, complete sequence) position: , mismatch: 2, identity: 0.933

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttgctttggtagccttacctgaaa	Protospacer
**********.******.************

465. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021472 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-2, complete sequence) position: , mismatch: 2, identity: 0.933

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggccgcccggattgccttattttcct	Protospacer
*************************.** *

466. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029967 (Lactobacillus curvatus strain ZJUNIT8 plasmid pnunamed1, complete sequence) position: , mismatch: 2, identity: 0.933

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggctgcccggatcgccttattctcat	Protospacer
*******.********.*************

467. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_011798 (Lactobacillus farciminis KCTC 3681 plasmid pLF24, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaaa	Protospacer
.****************************.

468. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_024985 (Lactobacillus plantarum subsp. plantarum strain Zhang-11 plasmid pZL2, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

469. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_021574 (Lactobacillus paracasei plasmid pLP5403, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

470. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_016034 (Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-2, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

471. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to MN730093 (Lactobacillus plantarum strain PC518 plasmid pLP224, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaagccaagacacttttgcgcatgcaaag	Protospacer
.**.**************************

472. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_007593 (Pediococcus damnosus plasmid pF8801, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

473. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012892 (Lactobacillus gallinarum strain HFD4 plasmid pMKG02, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

474. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012892 (Lactobacillus gallinarum strain HFD4 plasmid pMKG02, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

475. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_009666 (Lactobacillus plantarum M4 plasmid pM4, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

476. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_012548 (Lactobacillus brevis plasmid pLB925A01, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

477. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_012549 (Lactobacillus brevis plasmid pLB925A02, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

478. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG944248 (Lactobacillus plantarum strain LP27 plasmid pLP27, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

479. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_016635 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-1, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

480. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013167 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-12, complete sequence) position: , mismatch: 2, identity: 0.933

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagaccaagacacttttgcgcatgcaaag	Protospacer
.***.*************************

481. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_014475 (Enterococcus faecalis plasmid pWZ1668, complete sequence) position: , mismatch: 2, identity: 0.933

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
accctaaaccaaaagtaaacagtgccttaa	Protospacer
*.**********************.*****

482. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_019284 (Enterococcus faecalis plasmid pWZ7140, complete sequence) position: , mismatch: 2, identity: 0.933

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
accctaaaccaaaagtaaacagtgccttaa	Protospacer
*.**********************.*****

483. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_019213 (Enterococcus faecalis plasmid pWZ909, complete sequence) position: , mismatch: 2, identity: 0.933

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
accctaaaccaaaagtaaacagtgccttaa	Protospacer
*.**********************.*****

484. spacer 6.2|2386360|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to NC_047983 (Lactobacillus phage Lb, complete genome) position: , mismatch: 2, identity: 0.938

taatcccatcttcttcacccaagccagaaagt	CRISPR spacer
tagtcccatcttcttcacccaggccagaaagt	Protospacer
**.******************.**********

485. spacer 6.3|2386421|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 2, identity: 0.938

ggcgttcagcgctgttaacaaagcggctacta	CRISPR spacer
ggcgttcagcgctgttaacaaggcggccacta	Protospacer
*********************.*****.****

486. spacer 6.3|2386421|32|NZ_CP021456|CRISPRCasFinder,PILER-CR matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 2, identity: 0.938

ggcgttcagcgctgttaacaaagcggctacta	CRISPR spacer
ggcgttcagcgctgttaacaaggcggccacta	Protospacer
*********************.*****.****

487. spacer 6.6|2386360|33|NZ_CP021456|CRT matches to NC_047983 (Lactobacillus phage Lb, complete genome) position: , mismatch: 2, identity: 0.939

taatcccatcttcttcacccaagccagaaagta	CRISPR spacer
tagtcccatcttcttcacccaggccagaaagta	Protospacer
**.******************.***********

488. spacer 6.7|2386421|33|NZ_CP021456|CRT matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 2, identity: 0.939

ggcgttcagcgctgttaacaaagcggctactaa	CRISPR spacer
ggcgttcagcgctgttaacaaggcggccactaa	Protospacer
*********************.*****.*****

489. spacer 6.7|2386421|33|NZ_CP021456|CRT matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 2, identity: 0.939

ggcgttcagcgctgttaacaaagcggctactaa	CRISPR spacer
ggcgttcagcgctgttaacaaggcggccactaa	Protospacer
*********************.*****.*****

490. spacer 1.6|116081|33|NZ_CP021456|CRISPRCasFinder matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 3, identity: 0.909

tgtaatgttttccgaccccatggtgtccccagt	CRISPR spacer
tataatgttttccgcccccatggtgtccccggt	Protospacer
*.************ ***************.**

491. spacer 1.6|116081|33|NZ_CP021456|CRISPRCasFinder matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 3, identity: 0.909

tgtaatgttttccgaccccatggtgtccccagt	CRISPR spacer
tataatgttttccgcccccatggtgtccccggt	Protospacer
*.************ ***************.**

492. spacer 1.14|116082|32|NZ_CP021456|CRT matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 3, identity: 0.906

gtaatgttttccgaccccatggtgtccccagt	CRISPR spacer
ataatgttttccgcccccatggtgtccccggt	Protospacer
.************ ***************.**

493. spacer 1.14|116082|32|NZ_CP021456|CRT matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 3, identity: 0.906

gtaatgttttccgaccccatggtgtccccagt	CRISPR spacer
ataatgttttccgcccccatggtgtccccggt	Protospacer
.************ ***************.**

494. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_LM651913 (Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.909

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaattcatcaacat	Protospacer
*.************* ******.**********

495. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_006399 (Lactobacillus plantarum BIFI-38 plasmid pPB1, complete sequence) position: , mismatch: 3, identity: 0.909

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaacccatcaacat	Protospacer
*.************* *******.*********

496. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_019353 (Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence) position: , mismatch: 3, identity: 0.909

tgcctagttttttgtttagaaactcatcaacat	CRISPR spacer
tacctagttttttgtgtagaaattcatcaacat	Protospacer
*.************* ******.**********

497. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_LM651913 (Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.906

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaattcatcaacat	Protospacer
.************* ******.**********

498. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_006399 (Lactobacillus plantarum BIFI-38 plasmid pPB1, complete sequence) position: , mismatch: 3, identity: 0.906

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaacccatcaacat	Protospacer
.************* *******.*********

499. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_019353 (Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence) position: , mismatch: 3, identity: 0.906

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
acctagttttttgtgtagaaattcatcaacat	Protospacer
.************* ******.**********

500. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 3, identity: 0.9

gaccaactttacgtagtccttgttagctga	CRISPR spacer
aaccaactttacatagtccttattagctga	Protospacer
.***********.********.********

501. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016798 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence) position: , mismatch: 3, identity: 0.9

gaccaactttacgtagtccttgttagctga	CRISPR spacer
aaccaactttacatattccttgttagctga	Protospacer
.***********.** **************

502. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014925 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-1, complete sequence) position: , mismatch: 3, identity: 0.9

gaccaactttacgtagtccttgttagctga	CRISPR spacer
aaccaactttacatagtccttattagctga	Protospacer
.***********.********.********

503. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031171 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_B, complete sequence) position: , mismatch: 3, identity: 0.9

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttgctttggtagccttacctgaca	Protospacer
**********.******.********** *

504. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 3, identity: 0.9

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttaccttggtaaccttaccagaca	Protospacer
********.**************** ** *

505. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019738 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence) position: , mismatch: 3, identity: 0.9

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttgctttggtagccttacctgaca	Protospacer
**********.******.********** *

506. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 3, identity: 0.9

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttaccttggtaaccttaccagaca	Protospacer
********.**************** ** *

507. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 3, identity: 0.9

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttaccttggtaaccttaccagaca	Protospacer
********.**************** ** *

508. spacer 5.7|2319669|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019747 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence) position: , mismatch: 3, identity: 0.9

taggcgttgccttggtaaccttacctgaaa	CRISPR spacer
taggcgttgctttggtagccttacctgaca	Protospacer
**********.******.********** *

509. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggctgcccggattgccttattttcct	Protospacer
*******.*****************.** *

510. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 3, identity: 0.9

caatggccgcccggattgccttattctcat	CRISPR spacer
caatggctgcccggattgccttattttcct	Protospacer
*******.*****************.** *

511. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021476 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-5) position: , mismatch: 3, identity: 0.9

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcatgcaaga	Protospacer
.***************************..

512. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019714 (Lactobacillus plantarum strain Q7 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagactaagacacttttgcgcatgcaaag	Protospacer
.***.*.***********************

513. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_013789 (Lactobacillus plantarum plasmid pXY3, complete sequence) position: , mismatch: 3, identity: 0.9

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctagactaagacacttttgcgcatgcaaag	Protospacer
.***.*.***********************

514. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035270 (Weissella cibaria strain SRCM103448 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.9

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ctaggccaagacacttttgcgcaggaaaag	Protospacer
.********************** * ****

515. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_KJ868090 (Lactobacillus pentosus strain F03 plasmid pF03-3, complete sequence) position: , mismatch: 4, identity: 0.875

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaggctatctacgtcgatttaccgttgacaga	Protospacer
*** *.  ************************

516. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP019714 (Lactobacillus plantarum strain Q7 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.875

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaaccgttctacgtcgatttaccgttgacaga	Protospacer
**.** . ************************

517. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP019715 (Lactobacillus plantarum strain Q7 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.875

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaggctatctacgtcgatttaccgttgacaga	Protospacer
*** *.  ************************

518. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_013789 (Lactobacillus plantarum plasmid pXY3, complete sequence) position: , mismatch: 4, identity: 0.875

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaaccgttctacgtcgatttaccgttgacaga	Protospacer
**.** . ************************

519. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_012722 (Lactobacillus pentosus p1-4 plasmid complete sequence, strain F121-1) position: , mismatch: 4, identity: 0.875

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaggctatctacgtcgatttaccgttgacaga	Protospacer
*** *.  ************************

520. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP019714 (Lactobacillus plantarum strain Q7 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.848

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaaaccgttctacgtcgatttaccgttgacaga	Protospacer
 **.** . ************************

521. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_013789 (Lactobacillus plantarum plasmid pXY3, complete sequence) position: , mismatch: 5, identity: 0.848

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaaaccgttctacgtcgatttaccgttgacaga	Protospacer
 **.** . ************************

522. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NZ_CP031207 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence) position: , mismatch: 5, identity: 0.844

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaaacgccctacgtcgatttaccgttgacgga	Protospacer
**. * * *********************.**

523. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_006399 (Lactobacillus plantarum BIFI-38 plasmid pPB1, complete sequence) position: , mismatch: 5, identity: 0.844

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaaacgccctacgtcgatttaccgttgacgga	Protospacer
**. * * *********************.**

524. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_016606 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-2, complete sequence) position: , mismatch: 5, identity: 0.844

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
aaggctatctacgtcgatttaacgttgacaga	Protospacer
*** *.  ************* **********

525. spacer 2.7|126272|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to MH809530 (Lactobacillus phage Dionysus, complete genome) position: , mismatch: 6, identity: 0.818

tttatgccaactttctgccacacttagggcaat	CRISPR spacer
tctaaaataactttctaccacacttagggcaat	Protospacer
*.** . .********.****************

526. spacer 2.7|126272|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_048084 (Lactobacillus phage Iacchus, complete genome) position: , mismatch: 6, identity: 0.818

tttatgccaactttctgccacacttagggcaat	CRISPR spacer
tctaaaataactttctaccacacttagggcaat	Protospacer
*.** . .********.****************

527. spacer 2.7|126272|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to MH809531 (Lactobacillus phage Bromius, complete genome) position: , mismatch: 6, identity: 0.818

tttatgccaactttctgccacacttagggcaat	CRISPR spacer
tctaaaataactttctaccacacttagggcaat	Protospacer
*.** . .********.****************

528. spacer 2.19|126273|32|NZ_CP021456|CRT matches to MH809530 (Lactobacillus phage Dionysus, complete genome) position: , mismatch: 6, identity: 0.812

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaataactttctaccacacttagggcaat	Protospacer
.** . .********.****************

529. spacer 2.19|126273|32|NZ_CP021456|CRT matches to NC_048084 (Lactobacillus phage Iacchus, complete genome) position: , mismatch: 6, identity: 0.812

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaataactttctaccacacttagggcaat	Protospacer
.** . .********.****************

530. spacer 2.19|126273|32|NZ_CP021456|CRT matches to MH809531 (Lactobacillus phage Bromius, complete genome) position: , mismatch: 6, identity: 0.812

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaataactttctaccacacttagggcaat	Protospacer
.** . .********.****************

531. spacer 3.10|1238716|33|NZ_CP021456|CRISPRCasFinder,CRT matches to MN694520 (Marine virus AFVG_250M712, complete genome) position: , mismatch: 6, identity: 0.818

tatctattccaacctcaacgattccagaaactt	CRISPR spacer
tatctgttccaacctcaacggttccaaggacat	Protospacer
*****.**************.*****...** *

532. spacer 3.13|1238719|29|NZ_CP021456|PILER-CR matches to MN694520 (Marine virus AFVG_250M712, complete genome) position: , mismatch: 6, identity: 0.793

ctattccaacctcaacgattccagaaact	CRISPR spacer
ctgttccaacctcaacggttccaaggaca	Protospacer
**.**************.*****...**

533. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP025475 (Lactobacillus curvatus strain IRG2 plasmid pIRG201, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

534. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP016356 (Lactobacillus paracasei subsp. paracasei strain TMW 1.1434 plasmid pL11434-1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

535. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NC_021227 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp5, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

536. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP022131 (Lactobacillus pentosus strain SLC13 plasmid pSLC13, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

537. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP015859 (Lactobacillus plantarum strain LZ227 plasmid LZ227p4, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

538. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP053339 (Lactobacillus paraplantarum strain CK401 plasmid pCK401B, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

539. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

540. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

541. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP028981 (Lactobacillus plantarum strain LQ80 plasmid pLQ804, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

542. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP017068 (Lactobacillus plantarum strain LP3 plasmid pLB302, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

543. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP032758 (Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

544. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

545. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP021998 (Lactobacillus plantarum strain LPL-1 plasmid pPLP-1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

546. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP035017 (Lactobacillus plantarum strain 12_3 plasmid pldE, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

547. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP035025 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pE) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

548. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP022476 (Lactobacillus curvatus strain KG6 plasmid pKG6_1 sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

549. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP022476 (Lactobacillus curvatus strain KG6 plasmid pKG6_1 sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

550. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP027192 (Lactobacillus sp. CBA3605 plasmid pCBA3605-2, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

551. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_LT960786 (Lactobacillus sakei isolate MFPB19 plasmid 3, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

552. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP027197 (Lactobacillus sp. CBA3606 plasmid pCBA3606-3, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

553. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NC_021903 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ101, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

554. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_LT960792 (Lactobacillus sakei strain J54 plasmid 3, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

555. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_LT960779 (Lactobacillus sakei strain FLEC01 plasmid 3, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

556. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP020461 (Lactobacillus sakei strain FAM18311 plasmid pFAM18311_2) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

557. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP032660 (Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

558. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP031004 (Lactobacillus curvatus strain TMW 1.1928 plasmid p-1.1928_1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

559. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

560. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

561. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP022293 (Lactobacillus plantarum strain DSR_M2 plasmid pDSRM202, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

562. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

563. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_MF383377 (Lactobacillus curvatus strain CRL 705 plasmid pRC12, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

564. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to AP018702 (Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid3 DNA, complete genome) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

565. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP028338 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

566. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP012191 (Lactobacillus paracasei strain CAUH35 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

567. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP032655 (Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

568. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP013154 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-7, complete sequence) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca--	CRISPR spacer
gaaggcaagcagctggaagccat--gaccgat	Protospacer
********  *************   ***.

569. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NC_047925 (Lactobacillus phage Nyseid, complete genome) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca	CRISPR spacer
caagcagataagctggaagacattgaacca	Protospacer
 ***  .************ ***** ****

570. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to KU052488 (Lactobacillus phage SA-C12, complete genome) position: , mismatch: 6, identity: 0.8

gaaggcaataagctggaagccattgtacca	CRISPR spacer
caagcagataagctggaagacattgaacca	Protospacer
 ***  .************ ***** ****

571. spacer 5.2|2319339|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 6, identity: 0.8

cgaagtctattggcaagttccgaagaaaaa	CRISPR spacer
ggaggtagcttggcaagtgccgaagaaaaa	Protospacer
 **.**   ********* ***********

572. spacer 5.2|2319339|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 6, identity: 0.8

cgaagtctattggcaagttccgaagaaaaa	CRISPR spacer
ggaggtagcttggcaagtgccgaagaaaaa	Protospacer
 **.**   ********* ***********

573. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035173 (Lactobacillus plantarum strain SRCM103418 plasmid unnamed5) position: , mismatch: 6, identity: 0.8

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
ggcggataaaacacttttgcgcatgcaaag	Protospacer
   ** .**.********************

574. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to KJ868088 (Lactobacillus pentosus strain F03 plasmid pF03-1, complete sequence) position: , mismatch: 6, identity: 0.8

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgcatgcaaag	Protospacer
   ** .**.********************

575. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031207 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence) position: , mismatch: 6, identity: 0.8

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgcatgcaaag	Protospacer
   ** .**.********************

576. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_014135 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence) position: , mismatch: 6, identity: 0.8

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgcatgcaaag	Protospacer
   ** .**.********************

577. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_019353 (Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence) position: , mismatch: 6, identity: 0.8

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgcatgcaaag	Protospacer
   ** .**.********************

578. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LM651913 (Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgcatgcaaag	Protospacer
   ** .**.********************

579. spacer 2.1|125906|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_007593 (Pediococcus damnosus plasmid pF8801, complete sequence) position: , mismatch: 7, identity: 0.788

taagccccactacgtcgatttaccgttgacaga	CRISPR spacer
tacaatgctctacgtcgatttaccgttgaccga	Protospacer
** . . * ********************* **

580. spacer 2.13|125907|32|NZ_CP021456|CRT matches to NC_007593 (Pediococcus damnosus plasmid pF8801, complete sequence) position: , mismatch: 7, identity: 0.781

aagccccactacgtcgatttaccgttgacaga	CRISPR spacer
acaatgctctacgtcgatttaccgttgaccga	Protospacer
* . . * ********************* **

581. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX683284 (Escherichia coli strain EcU443 plasmid pECSEV_02, complete sequence) position: , mismatch: 7, identity: 0.781

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
gcatctttttttgatgagaaactcatcaagag	Protospacer
** *  ******* * ************* *

582. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694646 (Marine virus AFVG_250M1067, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

583. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN693911 (Marine virus AFVG_250M1064, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

584. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694813 (Marine virus AFVG_250M1071, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

585. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694441 (Marine virus AFVG_250M1066, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

586. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694492 (Marine virus AFVG_250M1068, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

587. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694093 (Marine virus AFVG_250M872, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

588. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN693639 (Marine virus AFVG_250M1070, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

589. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694318 (Marine virus AFVG_250M1065, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

590. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN694328 (Marine virus AFVG_250M871, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

591. spacer 2.15|126029|32|NZ_CP021456|CRT matches to MN693657 (Marine virus AFVG_250M1069, complete genome) position: , mismatch: 7, identity: 0.781

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
ttcttcagtatcagtttcttcagcaggttctt	Protospacer
 *.** ***************** **. .***

592. spacer 2.16|126090|32|NZ_CP021456|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

attgtgcaagtcatatacatgaaaaccaaaac	CRISPR spacer
acagggccggtcatatacaagaaaacaaaaac	Protospacer
*. * ** .********** ****** *****

593. spacer 2.19|126273|32|NZ_CP021456|CRT matches to NC_047926 (Lactobacillus phage Semele, complete genome) position: , mismatch: 7, identity: 0.781

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaatagctttctaccacacttagggcaat	Protospacer
.** . .*.******.****************

594. spacer 2.19|126273|32|NZ_CP021456|CRT matches to MG557979 (Lactobacillus phage Lpa804, complete genome) position: , mismatch: 7, identity: 0.781

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaatagctttctaccacacttagggcaat	Protospacer
.** . .*.******.****************

595. spacer 5.2|2319339|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH491967 (Proteus mirabilis strain HFK418 plasmid pHFK418-NDM, complete sequence) position: , mismatch: 7, identity: 0.767

cgaagtctattggcaagttccgaagaaaaa	CRISPR spacer
agttgtctattggcaagatacgaagaaatg	Protospacer
 *  ************* * ******** .

596. spacer 5.9|2319801|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020699 (Sulfitobacter sp. D7 plasmid p5SUD7, complete sequence) position: , mismatch: 7, identity: 0.767

caatggccgcccggattgccttattctcat	CRISPR spacer
ccaaacccgcccggattggcttattctgac	Protospacer
* * . ************ ******** *.

597. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KF559315 (Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence) position: , mismatch: 7, identity: 0.767

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcagataaaacacttttgcgcatgcaaag	Protospacer
   .* .**.********************

598. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014880 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence) position: , mismatch: 7, identity: 0.767

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgtatgcaaag	Protospacer
   ** .**.***********.********

599. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014906 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence) position: , mismatch: 7, identity: 0.767

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
agcggataaaacacttttgcgtatgcaaag	Protospacer
   ** .**.***********.********

600. spacer 5.11|2319933|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037912 (Escherichia coli strain YSP8-1 plasmid pYSP8-1-CTX-M-14, complete sequence) position: , mismatch: 7, identity: 0.767

atcctaaaccaaaagtaaacagtgtcttaa	CRISPR spacer
ccttaaaaccaagagtaaacagtgtcttta	Protospacer
 ... *******.*************** *

601. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to MN693436 (Marine virus AFVG_25M57, complete genome) position: , mismatch: 8, identity: 0.758

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
ttcactttattaattttaaaaaaatgaaaacaa	Protospacer
*  . ***.************ ********. *

602. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to MN693320 (Marine virus AFVG_25M58, complete genome) position: , mismatch: 8, identity: 0.758

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
ttcactttattaattttaaaaaaatgaaaacaa	Protospacer
*  . ***.************ ********. *

603. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024320 (Borrelia miyamotoi strain Yekat-6 plasmid pYkt6-lp41, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

604. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024393 (Borrelia miyamotoi strain Izh-4 plasmid pIzh4-lp41, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

605. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024208 (Borrelia miyamotoi strain Izh-5 plasmid pIzh5-lp41, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

606. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024336 (Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp41, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

607. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024354 (Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-1, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

608. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024355 (Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-2, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

609. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP024374 (Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp41, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
catttttgttaattttaaattattgaaaaaag	Protospacer
 *  *************** ** ******  .

610. spacer 1.16|116204|32|NZ_CP021456|CRT matches to MN693436 (Marine virus AFVG_25M57, complete genome) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
tcactttattaattttaaaaaaatgaaaacaa	Protospacer
  . ***.************ ********. *

611. spacer 1.16|116204|32|NZ_CP021456|CRT matches to MN693320 (Marine virus AFVG_25M58, complete genome) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
tcactttattaattttaaaaaaatgaaaacaa	Protospacer
  . ***.************ ********. *

612. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP016541 (Planococcus versutus strain L10.15 plasmid pPS15-1, complete sequence) position: , mismatch: 8, identity: 0.75

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
gaaatttgttaattttaaaaaaacgaaacctt	Protospacer
**..**************** **.**** ..

613. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP047439 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence) position: , mismatch: 8, identity: 0.758

tgcctagttttttgtttagaaactcatcaacat--	CRISPR spacer
tccctagttttttgtttaaagactca--gattttg	Protospacer
* ****************.*.*****  .*. *

614. spacer 2.2|125967|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NZ_CP047440 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence) position: , mismatch: 8, identity: 0.758

tgcctagttttttgtttagaaactcatcaacat--	CRISPR spacer
tccctagttttttgtttaaagactca--gattttg	Protospacer
* ****************.*.*****  .*. *

615. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP047439 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence) position: , mismatch: 8, identity: 0.75

gcctagttttttgtttagaaactcatcaacat--	CRISPR spacer
ccctagttttttgtttaaagactca--gattttg	Protospacer
 ****************.*.*****  .*. *

616. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP047440 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence) position: , mismatch: 8, identity: 0.75

gcctagttttttgtttagaaactcatcaacat--	CRISPR spacer
ccctagttttttgtttaaagactca--gattttg	Protospacer
 ****************.*.*****  .*. *

617. spacer 2.19|126273|32|NZ_CP021456|CRT matches to AY682195 (Lactobacillus plantarum bacteriophage LP65, complete genome) position: , mismatch: 8, identity: 0.75

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaatagctttctaccgcacttagggcaat	Protospacer
.** . .*.******.**.*************

618. spacer 2.19|126273|32|NZ_CP021456|CRT matches to NC_006565 (Lactobacillus phage LP65, complete genome) position: , mismatch: 8, identity: 0.75

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaatagctttctaccgcacttagggcaat	Protospacer
.** . .*.******.**.*************

619. spacer 2.19|126273|32|NZ_CP021456|CRT matches to MG765277 (Lactobacillus phage Bacchae, complete genome) position: , mismatch: 8, identity: 0.75

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
ctaaaatagctttctaccacacttaggacaat	Protospacer
.** . .*.******.***********.****

620. spacer 2.24|126578|32|NZ_CP021456|CRT matches to MH617513 (Microviridae sp. isolate ctdc874, complete genome) position: , mismatch: 8, identity: 0.75

taaaatccgatcattttcggccatcaatcaca	CRISPR spacer
tatcatgctatcattttcggccatcaattctt	Protospacer
**  ** * *******************. .

621. spacer 5.1|2319273|30|NZ_CP021456|CRISPRCasFinder,CRT matches to NZ_CP025615 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

gaaggcaataagctggaagccattgtacca	CRISPR spacer
cagggcaacaagctggaagccattcggtcc	Protospacer
 *.*****.***************  ..*

622. spacer 5.2|2319339|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to KX534340 (Phage Wrath, partial genome) position: , mismatch: 8, identity: 0.733

cgaagtctattggcaagttccgaagaaaaa	CRISPR spacer
tacggcttatttgcaggttccgaagaaaaa	Protospacer
.. .*..**** ***.**************

623. spacer 5.10|2319867|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NC_015063 (Rahnella sp. Y9602 plasmid pRAHAQ02, complete sequence) position: , mismatch: 8, identity: 0.733

ttaggccaagacacttttgcgcatgcaaag	CRISPR spacer
gccggcgaagacatttttgcgcatgcgcaa	Protospacer
 . *** ******.************. *.

624. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024393 (Borrelia miyamotoi strain Izh-4 plasmid pIzh4-lp41, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

625. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024208 (Borrelia miyamotoi strain Izh-5 plasmid pIzh5-lp41, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

626. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024336 (Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp41, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

627. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024355 (Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-2, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

628. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024320 (Borrelia miyamotoi strain Yekat-6 plasmid pYkt6-lp41, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

629. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024354 (Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp41-1, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

630. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP024374 (Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp41, complete sequence) position: , mismatch: 9, identity: 0.727

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
acatttttgttaattttaaattattgaaaaaag	Protospacer
  *  *************** ** ******  .

631. spacer 1.9|115777|32|NZ_CP021456|CRT matches to KT997864 (Uncultured Mediterranean phage uvDeep-CGR2-KM21-C345, complete genome) position: , mismatch: 9, identity: 0.719

atcatgcacatctcgcaggttattaatgccat	CRISPR spacer
cttgagtttatcttgcagcttattaatgccat	Protospacer
 *.. *. .****.**** *************

632. spacer 1.12|115960|32|NZ_CP021456|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtactgaccagttttagcgccagccttggtta	CRISPR spacer
tccctgaccagctttagcggcagcctctgctt	Protospacer
 . ********.******* ******. *.*

633. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_KY075650 (Escherichia coli strain GD17 plasmid pGD17-2, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
agatcctgttaatgttaaaatagtgaaaatga	Protospacer
... ..******* ********.******* *

634. spacer 1.16|116204|32|NZ_CP021456|CRT matches to CP031286 (Escherichia fergusonii strain 40A plasmid p80_40A, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
aaatcctgttaatgttaaaacaatgaaaatgc	Protospacer
.*. ..******* ******.*********

635. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP040808 (Escherichia fergusonii strain EFCF056 plasmid pEF03, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
aaatcctgttaatgttaaaacaatgaaaatgc	Protospacer
.*. ..******* ******.*********

636. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP014283 (Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
tgtctatattaattttgaaataatgataatct	Protospacer
 .  * *.********.********* ****

637. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP032614 (Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
tgtctatattaattttgaaataatgataatct	Protospacer
 .  * *.********.********* ****

638. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP014003 (Synechococcus sp. PCC 73109 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
aaggttttttaattttaaaaaaataggatgaa	Protospacer
.****** ************ ***...*   *

639. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP016489 (Synechococcus sp. PCC 8807 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
aaggttttttaattttaaaaaaataggatgaa	Protospacer
.****** ************ ***...*   *

640. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_CP016482 (Synechococcus sp. PCC 7117 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
aaggttttttaattttaaaaaaataggatgaa	Protospacer
.****** ************ ***...*   *

641. spacer 1.16|116204|32|NZ_CP021456|CRT matches to MN693868 (Marine virus AFVG_250M1130, complete genome) position: , mismatch: 9, identity: 0.719

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
agggttttttaattttaaattaatgttaccct	Protospacer
..***** *********** *****  * .*

642. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MK088486 (Klebsiella pneumoniae plasmid pHNHZ604-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

643. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041048 (Citrobacter sp. CF971 plasmid pBM527-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

644. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP052170 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

645. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP025948 (Escherichia coli strain SCEC020023 plasmid pNDM21_020023, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

646. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX470734 (Escherichia coli strain Ecoli14-55 plasmid pEC55-NDM4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

647. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX618696 (Escherichia coli strain NRS18 plasmid pEC-NRS18, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

648. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX674681 (Escherichia coli strain AS-01 plasmid pNDM5_AS, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

649. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX618698 (Escherichia coli strain 243 plasmid pEC-243, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

650. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX470735 (Escherichia coli strain Ecoli15-50 plasmid pEC50-NDM7, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

651. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX618697 (Escherichia coli strain 393 plasmid pEC-393, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

652. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX618702 (Escherichia coli strain 147 plasmid pEC-147, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

653. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX683284 (Escherichia coli strain EcU443 plasmid pECSEV_02, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

654. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX618701 (Escherichia coli strain 170 plasmid pEC-170, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

655. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX833071 (Escherichia coli strain AD-19R plasmid pAD-19R clone ST48, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

656. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY296103 (Enterobacter cloacae strain 13E169 plasmid pHN84NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

657. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY499797 (Klebsiella pneumoniae strain TH02-34 plasmid pTH02-34, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

658. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY659388 (Citrobacter freundii strain 145 plasmid pCr-145, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

659. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY659387 (Citrobacter freundii strain 30 plasmid pCfr-30, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

660. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY978629 (Cronobacter sakazakii strain 505108 plasmid p505108-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

661. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF072961 (Citrobacter freundii strain P10159 plasmid pP10159-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

662. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY435936 (Escherichia coli strain WCHEC005215 plasmid pNDM5_WCHEC0215, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

663. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF150120 (Klebsiella pneumoniae strain A64477 plasmid pKP64477d, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

664. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MG228426 (Escherichia coli strain BO15V plasmid pKP_BO_OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

665. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MF679147 (Escherichia coli plasmid pBJ114T-190, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

666. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KU934011 (Serratia marcescens strain 427862 plasmid IncX-3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

667. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX523903 (Klebsiella pneumoniae strain Kpn-29144/15 plasmid pOXA-181_29144, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

668. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX756453 (Klebsiella pneumoniae strain 1194/11 plasmid pKP1194a, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

669. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KU647721 (Escherichia coli strain CQ02-121 plasmid pCQ02-121, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

670. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX960110 (Escherichia coli strain CREC-TJ2 plasmid pCREC-TJ2-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

671. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KU167609 (Escherichia coli strain QD29 plasmid pNDM-QD29, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

672. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX960109 (Escherichia coli strain CREC-A6 plasmid pCREC-A6-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

673. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY041843 (Escherichia coli strain ZHDC40 plasmid pZHDC40, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

674. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KU963389 (Escherichia coli strain ECO37 plasmid ECO37P1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

675. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KU314941 (Klebsiella pneumoniae isolate KP04 plasmid pKP04NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

676. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX094555 (Escherichia coli strain ZHDC33 plasmid pZHDC33, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

677. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX214669 (Escherichia coli strain KW53T plasmid pKW53T-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

678. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX348144 (Klebsiella pneumoniae strain Kp01 plasmid pKPC_Kp01, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

679. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KX447767 (Escherichia coli strain MCR1_NJ plasmid pNDM5-NJ-IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

680. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KM400601 (Klebsiella pneumoniae strain Kp0003 plasmid pJEG027, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

681. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KT005457 (Klebsiella variicola strain KS22 plasmid pKS22, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

682. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KT362706 (Klebsiella pneumoniae strain ST512 plasmid p45-IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

683. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KP765744 (Enterobacter cloacae strain ECN49 plasmid pNDM-ECN49, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

684. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KP987216 (Citrobacter freundii strain 112298 plasmid p112298-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

685. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KT824791 (Escherichia coli strain 1929 plasmid pEc1929, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

686. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KP776609 (Escherichia coli strain OM26 plasmid pOM26-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

687. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KU167608 (Escherichia coli strain QD28 plasmid pNDM-QD28, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

688. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP043333 (Proteus mirabilis strain CRPM10 plasmid pNDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

689. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP018435 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

690. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP042339 (Escherichia coli strain GZ04-0086 plasmid pNDM5-GZ04_A, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

691. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP023194 (Escherichia coli strain TUM18530 plasmid pMTY18530-4_lncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

692. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP040399 (Escherichia coli strain BA22372 plasmid pOXA181_22372, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

693. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP043050 (Klebsiella pneumoniae strain KLP268 plasmid pKLP268-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

694. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP014006 (Klebsiella pneumoniae subsp. pneumoniae strain NUHL24835 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

695. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034284 (Klebsiella pneumoniae strain I72 plasmid p72_OXA181_X3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

696. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MK088485 (Escherichia coli plasmid pHN4109c, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

697. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041033 (Escherichia coli strain PT109 plasmid pLB_OXA-181_PT109, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

698. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048332 (Escherichia coli strain 10 plasmid p010_B-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

699. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034957 (Escherichia coli strain SCEC020026 plasmid pNDM5_020026, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

700. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP049352 (Escherichia coli strain 3R plasmid p3R-4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

701. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP049602 (Klebsiella aerogenes strain 18-2341 plasmid pSECR18-2341_NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

702. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP012995 (Klebsiella pneumoniae strain KpN06 plasmid pKpN06-NDM7, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

703. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041931 (Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374D, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

704. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP010395 (Klebsiella pneumoniae strain 34618 plasmid p34618-43.380kb, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

705. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP020512 (Escherichia coli strain 165 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

706. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP029735 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

707. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034965 (Escherichia coli strain WCHEC020032 plasmid pNDM5_020032, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

708. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP053726 (Escherichia coli strain CP66-6_Sichuan plasmid pCP66-6-IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

709. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034744 (Escherichia coli strain L65 plasmid pL65-9, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

710. spacer 2.14|125968|32|NZ_CP021456|CRT matches to KX023261 (Escherichia coli plasmid pSCE516-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

711. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP051221 (Escherichia coli strain SFE8 plasmid pSCZP2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

712. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP026727 (Escherichia coli strain 266917_2 plasmid p266917_2_04, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

713. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP014069 (Citrobacter amalonaticus strain FDAARGOS_165 plasmid unnamed) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

714. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP029245 (Escherichia coli strain ECCRA-119 plasmid pTB203, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

715. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP025041 (Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

716. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP052768 (Salmonella enterica subsp. enterica strain LHST_2018 plasmid pLHST2018_IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

717. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP011987 (Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-74.026kb, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

718. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN061454 (Enterobacter cloacae strain EC-14-60 plasmid pECL-14-60-NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

719. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN175389 (Klebsiella pneumoniae strain KP-13-8 plasmid pKP-13-8-NDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

720. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN092230 (Escherichia coli plasmid pJN11NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

721. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN017707 (Escherichia coli plasmid pCNUH-11, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

722. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_025130 (Raoultella planticola strain RJA274 plasmid NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

723. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041956 (Escherichia coli strain EC2 plasmid pEC2_1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

724. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041947 (Klebsiella pneumoniae strain KP2 plasmid pKP2_1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

725. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP020839 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

726. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP020839 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

727. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP011992 (Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-43.380kb, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

728. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN200942 (Escherichia coli strain E648 plasmid pE648NDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

729. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_019157 (Klebsiella pneumoniae plasmid pIncX-SHV, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

730. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_019162 (Klebsiella pneumoniae strain CRE380 plasmid pNDM-HN380, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

731. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP018423 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

732. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP012990 (Klebsiella pneumoniae strain KpN01 plasmid pKpN01-NDM7, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

733. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP033057 (Morganella morganii strain L241 plasmid pNDM5-L241, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

734. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP037965 (Klebsiella pneumoniae strain SCKP020135 plasmid pNDM1_020135, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

735. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021836 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000583_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

736. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP022694 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_03, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

737. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP010881 (Escherichia coli strain MNCRE44 plasmid pMNCRE44_5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

738. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034323 (Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

739. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP026758 (Klebsiella aerogenes strain AR_0062 plasmid tig00000058_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

740. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP025215 (Klebsiella pneumoniae strain HZW25 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

741. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021692 (Escherichia coli strain AR_0151 plasmid tig00001251, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

742. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP022351 (Klebsiella michiganensis strain K516 plasmid pK516_NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

743. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024833 (Escherichia coli strain CREC-532 plasmid pCREC-532_3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

744. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024820 (Citrobacter freundii strain CRCB-101 plasmid pCRCB-101_1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

745. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP046274 (Enterobacter hormaechei strain E70 plasmid pE70-NDM1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

746. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021534 (Escherichia coli strain AR_0149 plasmid tig00000221, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

747. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021682 (Escherichia coli strain AR_0162 plasmid tig00003144, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

748. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP039811 (Klebsiella pneumoniae strain C2660 plasmid pC2660-4-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

749. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP029100 (Klebsiella pneumoniae strain AR438 plasmid unnamed2) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

750. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP036195 (Klebsiella pneumoniae strain BA34918 plasmid pIncX3) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

751. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP019679 (Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

752. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024814 (Enterobacter sp. CRENT-193 plasmid pCRENT-193_2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

753. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048327 (Escherichia coli strain 61 plasmid p61_A-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

754. spacer 2.14|125968|32|NZ_CP021456|CRT matches to KY930325 (Klebsiella pneumoniae plasmid pUCLAKPC2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

755. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_020811 (Klebsiella pneumoniae strain KPN5047 plasmid pKPN5047, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

756. spacer 2.14|125968|32|NZ_CP021456|CRT matches to KR822247 (Escherichia coli strain E0083033-2 plasmid pEc2A, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

757. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021542 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000003, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

758. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024828 (Escherichia coli strain CREC-544 plasmid pCREC-544_2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

759. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024818 (Escherichia coli strain CREC-629 plasmid pCREC-629_3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

760. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024825 (Escherichia coli strain CREC-591 plasmid pCREC-591_4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

761. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP036179 (Escherichia coli strain WCHEC025970 plasmid pNDM5_025970, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

762. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP036312 (Enterobacter hormaechei strain WCHEH090011 plasmid pNDM5_090011, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

763. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MG570092 (Escherichia coli plasmid pSTIB_IncX3_OXA_181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

764. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_023914 (Enterobacter cloacae strain CRE727 plasmid pNDM-HF727, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

765. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP009776 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPC-def, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

766. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP008799 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

767. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP003997 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13d, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

768. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048325 (Escherichia coli strain 64 plasmid p64_C-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

769. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048346 (Escherichia coli strain 124 plasmid p124_B-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

770. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP018951 (Escherichia coli strain Ecol_276 plasmid pEC276_2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

771. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP028705 (Escherichia coli strain VH1 plasmid pVH1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

772. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041053 (Enterobacter hormaechei strain C126 plasmid pEnC126OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

773. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP020074 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

774. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP020111 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000003, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

775. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN178638 (Kluyvera cryocrescens strain SCW13 plasmid pNDM1_SCW13, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

776. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP038280 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

777. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP012563 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

778. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048321 (Escherichia coli strain 32-4 plasmid p32-4_K-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

779. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP050158 (Enterobacter cloacae plasmid Carbapenemase(NDM-1)_IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

780. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP035910 (Klebsiella pneumoniae strain BA4656 plasmid pIncX3) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

781. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP023897 (Escherichia coli strain FDAARGOS_433 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

782. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034133 (Klebsiella quasipneumoniae strain G4584 plasmid pG4584_52.4Kb, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

783. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP050157 (Escherichia coli plasmid Carbapenemase(NDM-5)_IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

784. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP050161 (Escherichia coli plasmid Carbapenemase(NDM-1)_IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

785. spacer 2.14|125968|32|NZ_CP021456|CRT matches to KX507346 (Escherichia coli plasmid pECNDM101, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

786. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_LR130550 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 3) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

787. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP022575 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1b, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

788. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN792919 (Enterobacter hormaechei subsp. steigerwaltii strain ST190 plasmid pLAU_ENM17_OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

789. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP050375 (Klebsiella pneumoniae strain 50595 plasmid p50595_OXA_181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

790. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_019083 (Escherichia coli plasmid pEC14_35, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

791. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021715 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000002, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

792. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP024806 (Escherichia coli strain AMA1167 plasmid pAMA1167-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

793. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN335922 (Escherichia coli strain GD1-16 plasmid pNDM-T16, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

794. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP029386 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pNDM6_040074, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

795. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP045195 (Klebsiella pneumoniae strain YML0508 plasmid pOXA181_YML0508, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

796. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP028182 (Klebsiella pneumoniae strain CFSAN054110 plasmid pGMI16-005_02, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

797. spacer 2.14|125968|32|NZ_CP021456|CRT matches to LC536680 (Klebsiella pneumoniae MyNCGM036 plasmid pMyNCGM036, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

798. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_019384 (Klebsiella pneumoniae plasmid pKpS90, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

799. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP027051 (Klebsiella pneumoniae strain 20_GR_12 plasmid IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

800. spacer 2.14|125968|32|NZ_CP021456|CRT matches to LC545851 (Escherichia coli Ec-MW07 plasmid pEc-MW07_NDM DNA, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

801. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP031138 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

802. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP026577 (Escherichia coli strain WCHEC005237 plasmid pNDM5_005237, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

803. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP028577 (Escherichia coli strain WCHEC005784 plasmid pNDM5_005784, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

804. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP032190 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

805. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MT028409 (Klebsiella pneumoniae strain BS407 plasmid pBS407-3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

806. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN865121 (Escherichia coli strain SCNJ06 plasmid pNDM5_SCNJ06, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

807. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP052507 (Klebsiella pneumoniae strain B16KP0226 plasmid pB16KP0226-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

808. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP026413 (Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
ttctagttgtttctttagaaactcaatctgat	Protospacer
 .****** *** ************ .   **

809. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_020552 (Citrobacter freundii plasmid pYE315203, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

810. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP015825 (Klebsiella pneumoniae isolate blood sample 2 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

811. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP032305 (Salmonella enterica subsp. enterica serovar Braenderup strain FORC93 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

812. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP023188 (Klebsiella michiganensis strain K518 plasmid pK518_NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

813. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP027157 (Klebsiella pneumoniae strain AR_0361 plasmid unnamed6) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

814. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP028786 (Klebsiella pneumoniae strain SCKP020049 plasmid pNDM1_020049, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

815. spacer 2.14|125968|32|NZ_CP021456|CRT matches to AP023227 (Escherichia coli YJ3 plasmid pYJ3-NDM1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

816. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP028536 (Enterobacter hormaechei strain SCEH020042 plasmid pNDM5_020042, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

817. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP043513 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

818. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP031373 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_6, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

819. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP041938 (Klebsiella pneumoniae strain KP14003 plasmid pNDM-KP14003, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

820. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048028 (Escherichia coli strain GZEC065 plasmid pNDM5-GZEC065, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

821. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN227183 (Klebsiella pneumoniae strain 709 plasmid pKP709-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

822. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP023202 (Escherichia coli strain TUM18780 plasmid pMTY18780-5_IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

823. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP023210 (Escherichia coli strain TUM18781 plasmid pMTY18781-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

824. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NC_022740 (Klebsiella pneumoniae strain MGR-K194 plasmid pNDM_MGR194, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

825. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP019073 (Escherichia coli strain CRE1493 plasmid p1493-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

826. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP031884 (Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

827. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP035125 (Escherichia coli strain EC25 plasmid pEC25_NDM-7, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

828. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MK715437 (Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pNDM5-SCNJ1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

829. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP034591 (Escherichia coli strain L37 plasmid pL37-3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

830. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP054267 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

831. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP054717 (Salmonella enterica strain 85-0120 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

832. spacer 2.14|125968|32|NZ_CP021456|CRT matches to CP028781 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pNDM5_020046, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

833. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP028718 (Klebsiella pneumoniae strain SCM96 plasmid pSCM96-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

834. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP032889 (Escherichia coli strain SCEC020022 plasmid pNDM5_020022, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

835. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018837 (Escherichia coli strain M517 plasmid pM517-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

836. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018838 (Escherichia coli strain M518 plasmid pM518-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

837. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018831 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

838. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018836 (Escherichia coli strain M513 plasmid pM513-OXA181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

839. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP026015 (Klebsiella variicola strain 13450 plasmid p13450-3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

840. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP025007 (Klebsiella pneumoniae strain AUSMDU00003562 plasmid pAUSMDU3562-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

841. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP042935 (Escherichia coli 042 plasmid p1-Ec-BERN-042, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

842. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021759 (Klebsiella pneumoniae strain AR_0138 plasmid tig00000002, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

843. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021901 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0136 plasmid tig00001456_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

844. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MG773377 (Escherichia coli strain LSB54 plasmid pLSB54-NDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

845. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MG833404 (Kluyvera intermedia plasmid pEnin-51781cz, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

846. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MG833405 (Escherichia coli plasmid pEsco-4382cz, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

847. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018142 (Escherichia coli strain M213 isolate M213 plasmid pM213_X3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

848. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018146 (Escherichia coli strain M216 isolate M216 plasmid pM216_X3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

849. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_AP018141 (Escherichia coli strain M110 isolate M110 plasmid pM110_X3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

850. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP026476 (Escherichia coli strain KBN10P04869 plasmid pKBN10P04869C, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

851. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP045062 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

852. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP021738 (Escherichia coli strain AR_0150 plasmid tig00000260, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

853. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP036205 (Escherichia coli strain L725 plasmid pNDM5-L725, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

854. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN937240 (Enterobacter cloacae strain BSI034 plasmid pBSI034-NDM1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

855. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP045055 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

856. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_LR595693 (Escherichia coli isolate EcMAD1 plasmid pEcMAD2) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

857. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412917 (Escherichia coli strain ABC264 plasmid pABC264-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

858. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK450346 (Escherichia coli strain Z244 plasmid pNDM-Z244, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

859. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372393 (Klebsiella pneumoniae strain ABC369 plasmid pABC369-NDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

860. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK450347 (Escherichia coli strain Z214 plasmid pNDM-Z214, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

861. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK450348 (Klebsiella pneumoniae strain K725 plasmid pNDM-K725, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

862. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK628734 (Klebsiella pneumoniae strain GDQ8D112M plasmid pGDQ8D112M-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

863. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK308632 (Klebsiella pneumoniae strain LDR plasmid pNDM5-LDR, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

864. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372385 (Morganella morganii strain ABC140 plasmid pABC140-NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

865. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372381 (Klebsiella pneumoniae strain ABC52 plasmid pABC52-NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

866. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK773535 (Klebsiella pneumoniae strain QDE2 plasmid pQDE2-A, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

867. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MN064714 (Klebsiella pneumoniae strain RJY9645 plasmid pY9645-NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

868. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN276078 (Enterobacter cloacae strain GZ6DS3 plasmid pHN6DS3,complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

869. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN276079 (Escherichia coli strain GZ7CS2 plasmid pHN7CS2,complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

870. spacer 2.14|125968|32|NZ_CP021456|CRT matches to MN276082 (Citrobacter freundii strain GZ7DS4 plasmid pHN7DS4,complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

871. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP032424 (Escherichia coli strain SCEC020001 plasmid pNDM5_020001, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

872. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK033580 (Escherichia coli strain HZ11 plasmid pHNHZ11-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

873. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK033579 (Escherichia coli strain YX6P67 plasmid pHNYX667-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

874. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK033583 (Escherichia coli strain HZ18 plasmid pHNHZ18-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

875. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH909333 (Klebsiella pneumoniae strain 7-SP plasmid p7SP-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

876. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH909346 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

877. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH909335 (Klebsiella pneumoniae strain 11-SP plasmid p11SP-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

878. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH917283 (Klebsiella pneumoniae strain A575 plasmid pA575-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

879. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK033581 (Escherichia coli strain YX6P58 plasmid pHNYX658-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

880. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK033578 (Escherichia coli strain YX6P44 plasmid pHNYX644-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

881. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH105050 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

882. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH909343 (Klebsiella pneumoniae strain 1012018 plasmid p12018-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

883. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH909347 (Klebsiella pneumoniae strain 362713 plasmid p362713-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

884. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH286949 (Escherichia coli strain AHM6C87 plasmid pHNAH687, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

885. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234505 (Escherichia coli strain CRE3694 plasmid pNDM-HK3694, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

886. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH917282 (Klebsiella pneumoniae strain A457 plasmid pA457-NDA, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

887. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH286946 (Escherichia coli strain AHM5C66 plasmid pHNAH566, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

888. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234499 (Escherichia coli strain CRE3836 plasmid pNDM-HK3836, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

889. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH917280 (Klebsiella pneumoniae strain QDE2 plasmid pQDE2-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

890. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234509 (Escherichia coli strain CRE2967 plasmid pNDM-HK2967, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

891. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH286947 (Escherichia coli strain AHM6C11 plasmid pHNAH611, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

892. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH347484 (Escherichia coli strain 135 plasmid pEC135, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

893. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH349095 (Escherichia coli strain 948 plasmid pMTC948, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

894. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK317995 (Klebsiella pneumoniae strain CRE plasmid pAN65-3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

895. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372386 (Klebsiella pneumoniae strain BC700 plasmid pBC700-NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

896. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK264770 (Klebsiella pneumoniae strain KP89 plasmid pKP89, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcgtcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

897. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412914 (Klebsiella pneumoniae strain ABC220 plasmid pABC220-KPC-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

898. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412915 (Klebsiella pneumoniae strain ABC260 plasmid pABC260-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

899. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412920 (Klebsiella pneumoniae strain BC-13-947 plasmid pBC947-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

900. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH107030 (Klebsiella pneumoniae strain CZPF140026 plasmid pTBCZNDM01, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

901. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234501 (Klebsiella pneumoniae strain CRE3816 plasmid pNDM-HK3816, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

902. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH286950 (Escherichia coli strain AHM6C88 plasmid pHNAH688, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

903. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH161191 (Klebsiella pneumoniae strain SCKLB138 plasmid pSCKLB138-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

904. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234504 (Klebsiella pneumoniae strain CRE3706 plasmid pNDM-HK3706, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

905. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH341575 (Klebsiella pneumoniae strain MYKLB95 plasmid pMYKLB95-2, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

906. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH781720 (Klebsiella pneumoniae strain SCKLB684 plasmid pSCKLB684-ndm, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

907. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK256964 (Escherichia coli strain R15 plasmid pR15_NDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

908. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412916 (Escherichia coli strain ABC239 plasmid pABC239-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

909. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372391 (Escherichia coli strain ABC268 plasmid pABC268-NDM-5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

910. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412918 (Escherichia coli strain ABC356 plasmid pABC356, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

911. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK412919 (Escherichia coli strain ABC381 plasmid pABC381-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

912. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK416154 (Escherichia coli strain AR24.2b plasmid pAN-OXA-181, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

913. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372388 (Enterobacter cloacae strain ABC302 plasmid pABC302-NDM-4, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

914. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK450349 (Klebsiella aerogenes strain CR33 plasmid pNDM-CR33, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

915. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372380 (Enterobacter cloacae strain ABC40 plasmid pABC40-NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

916. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MK372382 (Escherichia coli strain ABC54 plasmid pABC54-NDM-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

917. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP020090 (Enterobacter cloacae strain PIMB10EC27 plasmid pEC27-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

918. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234503 (Escherichia coli strain CRE3712 plasmid pNDM-HK3712, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

919. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG252891 (Escherichia coli strain Esco-5256cz plasmid pEsco-5256cz, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

920. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF547509 (Escherichia coli strain P785MEM plasmid pP785-NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

921. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF458176 (Escherichia coli strain CCD1 plasmid pNDM-20 clone ST1114, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

922. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG825382 (Escherichia coli strain 977 plasmid p977-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

923. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG825368 (Escherichia coli strain 787 plasmid p787-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

924. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG825384 (Escherichia coli strain 1079 plasmid p1079-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

925. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF547507 (Escherichia coli strain P788A-032 plasmid pP788A-NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

926. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF547511 (Escherichia coli strain P744 plasmid pP744T-NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

927. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF547508 (Escherichia coli strain P855MEM plasmid pP855-NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

928. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF344560 (Enterobacter hormaechei strain 128379 plasmid p128379-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

929. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG252892 (Enterobacter cloacae strain Encl-922cz plasmid pEncl-922cz, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

930. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG545911 (Escherichia coli strain EC463 plasmid pEC463-NDM5, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

931. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG591703 (Escherichia coli strain EC36 plasmid pNDM-EC36, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

932. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG702491 (Escherichia coli strain CC1706-01 plasmid pD6-OXA_1_1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

933. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH061381 (Enterobacter cloacae strain En_MCR4 plasmid pEn_NDM, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

934. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH328008 (Enterobacter cloacae strain 150 plasmid pEC150, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

935. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH143074 (Escherichia coli strain CZEC1507017 plasmid pTBCZNDM03, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

936. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH286948 (Escherichia coli strain AHM6C71 plasmid pHNAH671, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

937. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH094148 (Escherichia coli strain A0917122A14A plasmid pNDM-5_A0917122, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

938. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH286945 (Escherichia coli strain AHM5C07 plasmid pHNAH507-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

939. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH594478 (Citrobacter freundii strain AA593 plasmid pIBAC_Incx3_A/C, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

940. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH105052 (Escherichia coli strain EC600 plasmid pSL131T_IncX3, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

941. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH523639 (Escherichia coli strain JN05 plasmid pJN05NDM7, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

942. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_KY499796 (Klebsiella pneumoniae strain IN03-01 plasmid pIN03-01, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

943. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MF415608 (Enterobacter cloacae strain hhy03 plasmid pNDM-BJ03, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

944. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MH234502 (Escherichia coli strain CRE3774 plasmid pNDM-HK3774, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

945. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_MG252893 (Raoultella ornithinolytica strain pRor-30818cz plasmid Ror-30818cz, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

946. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP031725 (Enterobacter hormaechei strain WCHEH020038 plasmid pNDM5_020038, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

947. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP027204 (Escherichia coli strain WCHEC025943 plasmid pNDM5_025943, complete sequence) position: , mismatch: 9, identity: 0.719

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaagag	Protospacer
. *   ******* * ************* *

948. spacer 2.19|126273|32|NZ_CP021456|CRT matches to MN693134 (Marine virus AFVG_25M117, complete genome) position: , mismatch: 9, identity: 0.719

ttatgccaactttctgccacacttagggcaat	CRISPR spacer
atcacccatctttctaccacacttagggtgtt	Protospacer
 *   *** ******.************.. *

949. spacer 2.22|126456|32|NZ_CP021456|CRT matches to MK448723 (Streptococcus phage Javan271, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcactggtcatcatctcctaaattggtt	CRISPR spacer
acgatcattcgtcatcatctcctaaataaata	Protospacer
.* .***.* ***************** ..*

950. spacer 3.3|1238473|32|NZ_CP021456|PILER-CR matches to NC_047897 (Lactobacillus phage Lenus, complete genome) position: , mismatch: 9, identity: 0.719

---acttcatgatcaacaggaccgtcctttttaac	CRISPR spacer
cagatt---tgatcaacaggaccatcttttttgtt	Protospacer
   *.*   **************.**.*****. .

951. spacer 5.4|2319471|30|NZ_CP021456|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.7

gaccaactttacgtagtccttgttagctga	CRISPR spacer
caccaactttacgtaatccttcttgtaaat	Protospacer
 **************.***** **.   .

952. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_KY075650 (Escherichia coli strain GD17 plasmid pGD17-2, complete sequence) position: , mismatch: 10, identity: 0.697

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
gagatcctgttaatgttaaaatagtgaaaatga	Protospacer
 ... ..******* ********.******* *

953. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to CP031286 (Escherichia fergusonii strain 40A plasmid p80_40A, complete sequence) position: , mismatch: 10, identity: 0.697

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
gaaatcctgttaatgttaaaacaatgaaaatgc	Protospacer
 .*. ..******* ******.*********

954. spacer 1.8|116203|33|NZ_CP021456|CRISPRCasFinder matches to NZ_CP040808 (Escherichia fergusonii strain EFCF056 plasmid pEF03, complete sequence) position: , mismatch: 10, identity: 0.697

tgaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
gaaatcctgttaatgttaaaacaatgaaaatgc	Protospacer
 .*. ..******* ******.*********

955. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NC_010853 (Bacillus coagulans plasmid pMSR0, complete sequence) position: , mismatch: 10, identity: 0.688

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
tacaacggaatttttaaaaacctaattaaatc	Protospacer
 *. .   .*********** * *********

956. spacer 1.16|116204|32|NZ_CP021456|CRT matches to NZ_AP018829 (Asticcacaulis excentricus strain M6 plasmid pASEM-1, complete sequence) position: , mismatch: 10, identity: 0.688

gaggtttgttaattttaaaataatgaaaatca	CRISPR spacer
cgagggggttaattttaaattattgaaaatat	Protospacer
 ..*   ************ ** *******

957. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP013716 (Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence) position: , mismatch: 10, identity: 0.688

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
ttatagttttttgtttagaaatccatgttgct	Protospacer
 . ******************..***     *

958. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP013716 (Staphylococcus equorum strain C2014 plasmid pC2014-2, complete sequence) position: , mismatch: 10, identity: 0.688

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
ttatagttttttgtttagaaatccatgttgct	Protospacer
 . ******************..***     *

959. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP044166 (Campylobacter coli strain AR-0416 plasmid pAR-0416) position: , mismatch: 10, identity: 0.688

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
atttaattttttgtttagaaaatcatatattg	Protospacer
...**.*************** ****  *.

960. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP028186 (Campylobacter jejuni strain CFSAN054107 plasmid pGMI16-002, complete sequence) position: , mismatch: 10, identity: 0.688

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
atttaattttttgtttagaaaatcatatattg	Protospacer
...**.*************** ****  *.

961. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP048757 (Campylobacter jejuni strain ZS006 plasmid pCJ41K-01, complete sequence) position: , mismatch: 10, identity: 0.688

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
atttaattttttgtttagaaaatcatatattg	Protospacer
...**.*************** ****  *.

962. spacer 2.14|125968|32|NZ_CP021456|CRT matches to NZ_CP030195 (Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence) position: , mismatch: 10, identity: 0.688

gcctagttttttgtttagaaactcatcaacat	CRISPR spacer
agcatcttttttgatgagaaactcatcaaggg	Protospacer
. *   ******* * ************* .

963. spacer 2.15|126029|32|NZ_CP021456|CRT matches to NC_011216 (Burkholderia phage KS10, complete genome) position: , mismatch: 10, identity: 0.688

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
attttgaggatcaggttcttcaggttgtttcc	Protospacer
******** ***** *********  . ....

964. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
tgaaaggtgatttttaaaaatctaattaaaaa	Protospacer
 .  .. ************* * *******

965. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP014152 (Clostridium botulinum strain BrDura plasmid pRSJ20_1, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

966. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP006909 (Clostridium botulinum CDC_1436 plasmid pCBG, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

967. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP013684 (Clostridium botulinum strain AM282 plasmid pRSJ10_1, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

968. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP013710 (Clostridium botulinum strain F634 plasmid pRSJ2_3, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

969. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NC_010418 (Clostridium botulinum A3 str. Loch Maree plasmid pCLK, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

970. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP013700 (Clostridium botulinum strain AM1195 plasmid pRSJ11_1, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

971. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NC_025146 (Clostridium botulinum plasmid pCB111 DNA, complete sequence, strain: 111) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

972. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NC_012654 (Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

973. spacer 1.13|116021|32|NZ_CP021456|CRT matches to NZ_CP031095 (Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence) position: , mismatch: 11, identity: 0.656

gatcgattgatttttaaaaagcgaattaaatc	CRISPR spacer
agcatggggatttttaaatagcgatttaaatg	Protospacer
...  .  ********** ***** ******

974. spacer 2.3|126028|33|NZ_CP021456|PILER-CR,CRISPRCasFinder matches to NC_011216 (Burkholderia phage KS10, complete genome) position: , mismatch: 11, identity: 0.667

tattttgagtatcagtttcttcaggagaacctt	CRISPR spacer
gattttgaggatcaggttcttcaggttgtttcc	Protospacer
 ******** ***** *********  . ....

975. spacer 2.15|126029|32|NZ_CP021456|CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

attttgagtatcagtttcttcaggagaacctt	CRISPR spacer
gaagtgcgtatcagtttcttccggagagtagg	Protospacer
.   ** ************** *****..

976. spacer 3.3|1238473|32|NZ_CP021456|PILER-CR matches to NC_014390 (Butyrivibrio proteoclasticus B316 plasmid pCY186, complete sequence) position: , mismatch: 11, identity: 0.656

acttcatgatcaacaggaccgtcctttttaac	CRISPR spacer
ctctcatcatcaacatgaccgtccttaaggtt	Protospacer
 ..**** ******* **********   . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1037951 : 1071518

Lactobacillus_phage(50.0%)

capsid,terminase,portal,integrase

attL 1053193:1053211|attR 1061944:1061962

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143451625.1\|1037951_1039415_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_084994835.1\|1039771_1040245_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_110139542.1\|1040261_1041074_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_110139543.1\|1041189_1041939_-	hypothetical protein	NA	NA	NA	NA
WP_097547127.1\|1041998_1042883_-	hypothetical protein	NA	NA	NA	NA
WP_047021021.1\|1042941_1043421_-	hypothetical protein	NA	NA	NA	NA
WP_110139544.1\|1043424_1043832_-	helix-turn-helix transcriptional regulator	E3W8B9	Leuconostoc_phage	1.1e-08	39.3
WP_110139545.1\|1044094_1044310_+	hypothetical protein	NA	NA	NA	NA
WP_162551545.1\|1044322_1044490_+	hypothetical protein	NA	NA	NA	NA
WP_162551546.1\|1044512_1044707_-	hypothetical protein	NA	NA	NA	NA
WP_110139547.1\|1044917_1045766_+	DUF3102 domain-containing protein	A0A2H4JAH5	uncultured_Caudovirales_phage	1.1e-34	58.0
WP_110139548.1\|1045758_1046607_+	ParB N-terminal domain-containing protein	A0A288TY86	Enterococcus_phage	6.8e-24	30.3
WP_162551547.1\|1046714_1046903_+	hypothetical protein	NA	NA	NA	NA
WP_162551548.1\|1047113_1047386_+	hypothetical protein	NA	NA	NA	NA
WP_011667895.1\|1047474_1047753_+	hypothetical protein	NA	NA	NA	NA
WP_011667893.1\|1048079_1048259_+	hypothetical protein	NA	NA	NA	NA
WP_110139551.1\|1048251_1049142_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	1.1e-27	31.5
WP_110139552.1\|1049142_1049841_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	1.1e-88	74.8
WP_110139553.1\|1049837_1050419_+	DUF669 domain-containing protein	D2KRE3	Lactobacillus_phage	1.2e-32	47.1
WP_110139554.1\|1050434_1051001_+	HNH endonuclease	A0A1W6JPN8	Staphylococcus_phage	1.5e-30	44.4
WP_162551549.1\|1051001_1051754_+	conserved phage C-terminal domain-containing protein	U5U793	Lactobacillus_phage	1.3e-29	35.6
WP_162551550.1\|1051871_1052999_+	DNA helicase	A0A2D1GP91	Lactobacillus_phage	2.0e-55	38.0
WP_042254491.1\|1052991_1053405_+	hypothetical protein	NA	NA	NA	NA
1053193:1053211	attL	NA	NA	NA	NA
WP_052415610.1\|1053405_1054107_+	hypothetical protein	A0A0D4DC57	Staphylococcus_phage	4.2e-27	34.4
WP_060416824.1\|1054118_1054538_+	hypothetical protein	D6PSU8	Lactobacillus_phage	5.2e-17	53.7
WP_042254487.1\|1054530_1054746_+	hypothetical protein	NA	NA	NA	NA
WP_110139557.1\|1055120_1055477_+	hypothetical protein	NA	NA	NA	NA
WP_162551551.1\|1055502_1055892_+	hypothetical protein	O03921	Lactobacillus_phage	4.1e-08	35.0
WP_110139559.1\|1055872_1056064_+	hypothetical protein	D6PSV7	Lactobacillus_phage	3.3e-27	93.5
WP_110139560.1\|1056094_1056286_+	hypothetical protein	NA	NA	NA	NA
WP_162551552.1\|1056419_1056575_+	hypothetical protein	NA	NA	NA	NA
WP_110139561.1\|1056586_1056910_+	hypothetical protein	NA	NA	NA	NA
WP_110139562.1\|1057005_1057461_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	8.3e-45	54.8
WP_108477585.1\|1058414_1058741_+	hypothetical protein	NA	NA	NA	NA
WP_042254467.1\|1058803_1059244_+	hypothetical protein	NA	NA	NA	NA
WP_047021003.1\|1059276_1060035_+\|terminase	terminase small subunit	V5URT8	Oenococcus_phage	3.8e-58	48.2
WP_087609426.1\|1060041_1060629_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	2.6e-22	33.5
WP_110139563.1\|1060773_1062090_+\|terminase	PBSX family phage terminase large subunit	V5UQR5	Oenococcus_phage	8.3e-162	62.1
1061944:1061962	attR	NA	NA	NA	NA
WP_042254461.1\|1062101_1063625_+\|portal	phage portal protein	A0A0P0IJV3	Lactobacillus_phage	1.2e-74	37.8
WP_110139564.1\|1063545_1064481_+	hypothetical protein	A0A2P1JTW9	Anoxybacillus_phage	4.7e-18	23.4
WP_157662344.1\|1064673_1065327_+	DUF4355 domain-containing protein	A0A0P0ID10	Lactobacillus_phage	2.5e-26	53.1
WP_042254460.1\|1065338_1065740_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	2.9e-09	32.7
WP_011667860.1\|1065757_1066879_+\|capsid	major capsid protein	S5MNB6	Brevibacillus_phage	7.6e-47	33.5
WP_060416807.1\|1067051_1067402_+	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_087612774.1\|1067398_1067911_+	hypothetical protein	L7TME2	Rhizobium_phage	2.4e-08	34.1
WP_087612775.1\|1067925_1068222_+	hypothetical protein	NA	NA	NA	NA
WP_042254452.1\|1068236_1068620_+	hypothetical protein	NA	NA	NA	NA
WP_060416806.1\|1068603_1069092_+	hypothetical protein	NA	NA	NA	NA
WP_096109878.1\|1069109_1070261_+	hypothetical protein	NA	NA	NA	NA
WP_042254448.1\|1070278_1070761_+	hypothetical protein	NA	NA	NA	NA
WP_060416804.1\|1070891_1071518_+	hypothetical protein	D6PSY5	Lactobacillus_phage	3.0e-13	44.6

DBSCAN-SWA_2

1381136 : 1390391

Staphylococcus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_097546243.1\|1381136_1381988_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	5.8e-15	33.6
WP_011667560.1\|1382156_1382798_+	hemolysin III family protein	NA	NA	NA	NA
WP_110139677.1\|1382976_1383468_-	dihydrofolate reductase	A0A172Q0L3	Acinetobacter_phage	5.9e-12	29.4
WP_110139678.1\|1383484_1384435_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	4.5e-117	62.1
WP_043022299.1\|1384446_1386339_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	4.7e-49	29.3
WP_110139679.1\|1386367_1387561_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	1.4e-35	40.2
WP_043022335.1\|1387736_1388633_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-52	39.1
WP_011667553.1\|1390115_1390391_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP021461

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3528

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140147.1\|1072_1339_+	hypothetical protein	NA	NA	NA	NA
WP_110140148.1\|1376_2612_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003678293.1\|2835_3528_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	34.6

DBSCAN-SWA_2

10750 : 16837

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140153.1\|10750_12022_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-56	40.9
WP_110140154.1\|11984_12368_-	hypothetical protein	NA	NA	NA	NA
WP_110140155.1\|12355_13024_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-33	34.4
WP_033615028.1\|13099_13327_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_110140156.1\|13343_15299_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.7e-89	36.1
WP_032811340.1\|15328_15595_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_032811339.1\|15611_15983_-	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_110140157.1\|16249_16837_+	recombinase family protein	M4QQC6	Vibrio_phage	5.9e-19	42.4

DBSCAN-SWA_3

20245 : 24796

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140160.1\|20245_24796_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.8e-06	31.2

DBSCAN-SWA_4

28667 : 30807

unidentified_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140165.1\|28667_29597_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	2.6e-24	33.7
WP_048481076.1\|29645_29945_-	hypothetical protein	NA	NA	NA	NA
WP_013356270.1\|29946_30807_-	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-43	40.2

DBSCAN-SWA_5

37036 : 39172

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110140171.1\|37036_39172_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.2e-109	47.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021457

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021459

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP021456

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP021461

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection