CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP025502	Clostridium perfringens strain EHE-NE18 plasmid pJIR3535, complete sequence	0 crisprs	RT	7
NZ_CP025501	Clostridium perfringens strain EHE-NE18 chromosome, complete genome	4 crisprs	cas3,csx1,c2c9_V-U4,DEDDh,cas14j,cas2,csa3,DinG	7
NZ_CP025504	Clostridium perfringens strain EHE-NE18 plasmid pJIR3537, complete sequence	0 crisprs	RT	0
NZ_CP025503	Clostridium perfringens strain EHE-NE18 plasmid pJIR3844, complete sequence	0 crisprs	RT	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7877

Bacillus_phage(50.0%)

integrase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015060533.1\|1786_2155_-	conjugation protein TcpE	NA	NA	NA	NA
WP_015060532.1\|2166_2514_-	hypothetical protein	NA	NA	NA	NA
WP_015141749.1\|2525_3605_-	conjugation protein TcpC	NA	NA	NA	NA
WP_031942691.1\|3657_5241_-	DNA translocase FtsK	M4ZS25	Bacillus_phage	3.8e-20	29.3
WP_015060590.1\|5303_6104_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_003458874.1\|6493_6802_-	hypothetical protein	NA	NA	NA	NA
WP_015060589.1\|6802_7087_-	hypothetical protein	NA	NA	NA	NA
WP_015060588.1\|7112_7877_-	DNA adenine methylase	Q0SPG6	Clostridium_phage	7.1e-105	72.1

DBSCAN-SWA_2

13304 : 19497

Clostridium_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003474966.1\|13304_13679_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A291I9M9	Lactobacillus_phage	2.0e-12	33.3
WP_012478257.1\|14805_15180_-	hypothetical protein	M9Q1J7	Clostridium_phage	2.7e-09	32.1
WP_015141743.1\|15270_15477_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_110439921.1\|15673_16813_+	helix-turn-helix domain-containing protein	A0A0S2MVM8	Bacillus_phage	4.6e-07	44.4
WP_110439922.1\|17079_17892_-	plasmid replication protein	Q0SPH7	Clostridium_phage	4.3e-68	54.6
WP_015141740.1\|18397_19243_+	ParM/StbA family protein	Q0SPH6	Clostridium_phage	4.9e-123	76.5
WP_015141739.1\|19245_19497_+	hypothetical protein	Q0SPH5	Clostridium_phage	1.1e-11	53.2

DBSCAN-SWA_3

29731 : 39297

Staphylococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110003253.1\|29731_30700_+	alpha hemolysin	A0A2I6PEU3	Staphylococcus_phage	7.5e-27	30.1
WP_015141792.1\|30989_31151_+	hypothetical protein	NA	NA	NA	NA
WP_015141791.1\|31253_32429_+	ricin-type beta-trefoil lectin domain protein	A0A0K2CYN4	Paenibacillus_phage	1.7e-17	28.9
WP_078210014.1\|32822_33386_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	9.7e-27	43.1
WP_110439924.1\|33749_34607_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	4.3e-18	30.6
WP_110003252.1\|35576_37433_-	glycoside hydrolase family 18 protein	A0A2K9L3D4	Tupanvirus	4.9e-43	32.8
WP_031942708.1\|37461_39297_-	glycosyl hydrolase	A0A1X9VNM7	Mimivirus	1.4e-37	26.8

DBSCAN-SWA_4

54976 : 56329

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031942704.1\|54976_56329_-	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	2.7e-14	35.7

DBSCAN-SWA_5

64363 : 66344

Bacillus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_146199278.1\|64363_65080_+	diguanylate cyclase	G3MA91	Bacillus_virus	1.0e-17	36.8
WP_015141762.1\|65459_66344_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	E9P639	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.4e-16	32.1

DBSCAN-SWA_6

71648 : 72668

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110439929.1\|71648_72668_-	DNA (cytosine-5-)-methyltransferase	A0A0E3DF50	Bacillus_phage	1.9e-57	39.6

DBSCAN-SWA_7

78083 : 81789

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003476280.1\|78083_79886_-	maturase	A0A0U4J920	Pseudomonas_phage	6.3e-27	30.4
WP_015060535.1\|80440_81337_-	conjugation-related peptidoglycan hydrolase	A0A0A7RUS8	Clostridium_phage	2.8e-36	50.0
WP_110439932.1\|81336_81789_-	TcpF	A0A1S5SF64	Streptococcus_phage	1.2e-16	35.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP025501

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP025501_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025501_1

891892-891980

Orphan

Consensus_repeat	Method
AGTTTTATATAAATCAATATAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025501_1

>merge|NZ_CP025501|1|891892-891980|CRISPRCasFinder
AGTTTTATATAAATCAATATAAATTTAAAATTGCAATTTCAAAAGCTAGATTAGGTACTGATAAAGAGTTTTATATAAATCAATGTAAA

>NZ_CP025501|1|1|891892-891980|CRISPRCasFinder
AGTTTTATATAAATCAATATAAA	TTTAAAATTGCAATTTCAAAAGCTAGATTAGGTACTGATAAAG
AGTTTTATATAAATCAATGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025501.1\|WP_003453483.1\|905639_906923_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP025501.1\|WP_003453460.1\|903623_904436_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_CP025501.1\|WP_004458069.1\|887529_888666_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|366370
NZ_CP025501.1\|WP_003480009.1\|883205_883520_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_004458067.1\|888662_889286_+\|copper-homeostasis-protein-CutC	unknown	unknown	gnl\|CDD\|225684
NZ_CP025501.1\|WP_003458352.1\|882872_883121_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP025501.1\|WP_003460432.1\|908190_909372_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP025501.1\|WP_110083361.1\|909487_910921_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP025501.1\|WP_004458079.1\|892017_892695_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NZ_CP025501.1\|WP_004458058.1\|889982_891293_-\|DUF1576-domain-containing-protein	unknown	unknown	gnl\|CDD\|377881
NZ_CP025501.1\|WP_003453475.1\|902413_903160_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|234605
NZ_CP025501.1\|WP_004458077.1\|883656_884388_-\|NAD-dependent-protein-deacylase	unknown	unknown	gnl\|CDD\|234777
NZ_CP025501.1\|WP_003453458.1\|904453_905626_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP025501.1\|WP_003468707.1\|893032_895570_+\|beta-hexosaminidase	unknown	unknown	gnl\|CDD\|366376
NZ_CP025501.1\|WP_003453477.1\|906941_908177_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP025501.1\|WP_003464244.1\|891513_891810_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003470229.1\|901313_901781_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|224146
NZ_CP025501.1\|WP_003464290.1\|886839_887346_+\|CarD-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224248
NZ_CP025501.1\|WP_003464293.1\|889649_889862_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_004458048.1\|884603_885746_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227091

Protein	Function_ID	Function_description	E-value
NZ_CP025501.1\|WP_003453483.1\|905639_906923_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	5.35525e-51
NZ_CP025501.1\|WP_003453460.1\|903623_904436_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.59948e-37
NZ_CP025501.1\|WP_004458069.1\|887529_888666_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.0067e-41
NZ_CP025501.1\|WP_003453475.1\|902413_903160_+\|peptidylprolyl-isomerase	gnl\|CDD\|234605	PRK00059, prsA, peptidylprolyl isomerase; Provisional.	1.6338e-32
NZ_CP025501.1\|WP_003458352.1\|882872_883121_+\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	2.38946e-13
NZ_CP025501.1\|WP_003460432.1\|908190_909372_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	2.43573e-120
NZ_CP025501.1\|WP_110083361.1\|909487_910921_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	2.47475e-56
NZ_CP025501.1\|WP_004458079.1\|892017_892695_-\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	1.66958e-148
NZ_CP025501.1\|WP_004458058.1\|889982_891293_-\|DUF1576-domain-containing-protein	gnl\|CDD\|377881	pfam07613, DUF1576, Protein of unknown function (DUF1576). This small family is found in several undescribed proteins. The alignment is distinguished by the frequent occurrence of conserved glycine and aromatic residues.	2.98799e-64
NZ_CP025501.1\|WP_004458067.1\|888662_889286_+\|copper-homeostasis-protein-CutC	gnl\|CDD\|225684	COG3142, CutC, Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].	1.28712e-89
NZ_CP025501.1\|WP_004458077.1\|883656_884388_-\|NAD-dependent-protein-deacylase	gnl\|CDD\|234777	PRK00481, PRK00481, NAD-dependent deacetylase; Provisional.	6.5534e-133
NZ_CP025501.1\|WP_003453458.1\|904453_905626_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	7.45112e-115
NZ_CP025501.1\|WP_004458048.1\|884603_885746_+\|hypothetical-protein	gnl\|CDD\|227091	COG4748, COG4748, Uncharacterized conserved protein [Function unknown].	5.75924e-79
NZ_CP025501.1\|WP_003453477.1\|906941_908177_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.34702e-58
NZ_CP025501.1\|WP_003470229.1\|901313_901781_-\|peroxiredoxin	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	9.8243e-79
NZ_CP025501.1\|WP_003464290.1\|886839_887346_+\|CarD-family-transcriptional-regulator	gnl\|CDD\|224248	COG1329, COG1329, Transcriptional regulators, similar to M. xanthus CarD [Transcription].	2.01008e-14
NZ_CP025501.1\|WP_003468707.1\|893032_895570_+\|beta-hexosaminidase	gnl\|CDD\|366376	pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N terminal domain.	5.22634e-110

>NZ_CP025501.1|WP_003464244.1|891513_891810_-|hypothetical-protein
MKNYKDNDENFKLVPMNMKCNQEYSFMPMNKFNSNSMNLNPMINKNSNHSCCCMHNYVMKPSPYNNNYYENQMFPQNHTDNMMVKTLITVKKKSDLFD
>NZ_CP025501.1|WP_004458058.1|889982_891293_-|DUF1576-domain-containing-protein
MKRLPQEYLIHSILYISFIIFAFFLESPKEILNGLYNIISNSDILITDYISIGGFGATLINSALLGLIFIFLFYITDTKSTGKSIMSLWFLTGFGMFGKNIINIWPIVLGTFIYSKVKKKPFKDYLVIASLGTALAPTVSQFSFFPEVHPISGAIMGALVGIIVGFILPPIAKNASKIHSGFSLYNVGFAGGIIAIAVMSLMRAVGHDFETNSIWHKGNNILYMLFLFTISAYFIICSLILDKSKKSVLKDQIGINKEHGIFPSDFFSIYGSSCYFNMGVLCIFSTLFVLLINGDLNGPTIGAIFSMAGFGCYGKNLANSVPLIIGASLASLISISDINSPVTVVCILFSTGLAPISGYYGWPYGIIAGFLHIFMVFNIGELHGGLNLYNNGLASGFVAAIIVPVIESLQVTNTKNNLKDSSKRHPISLGIKKEAD
>NZ_CP025501.1|WP_003464293.1|889649_889862_+|hypothetical-protein
MLEKMILSDKECEYLAKSIAGGVLIGLALGAIFNNPQFGFALGGVTGIVASLIYTLVKRAKIKSDKKLIN
>NZ_CP025501.1|WP_004458067.1|888662_889286_+|copper-homeostasis-protein-CutC
MTIKLEACVGNYKEGKRAEELGANRIELCDNLAQGGTTPSYGTILQCKKDINIDINVIIRPRGGNFVYSKEELNIMKNDIKLCKDIGVTGVVFGFLKEDNTLDYETTKEFVELAKPLSVTFHMAFDEIENKVDALGKLIDLGVDRVLTKGGLDNAFKNKDTLKELVEHAKDKIIILPGGGVTKDNFLELKDYTNAREFHGTKIVGNL
>NZ_CP025501.1|WP_004458069.1|887529_888666_+|mechanosensitive-ion-channel-family-protein
MKELERLLGRITIINIKEIIIILVIMIIVLIINKILINNLFKLLMRGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVGIIVSIIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFISIIIRLIILLVGIIIIANEFGLTGFIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEEITFRSTRIRTFSMAIATVPNSKLANSNIINWTQRKLRRIHFKFTMDCKTQIESIKNSVNKIENMLKKHDKIDKNLIIVSFNELSTYGFGIFIYFYTDEFEYLKYEKLKEEINIKILEILREENVSLMFLNFDFKGFERRSGNCNLENTELESIKNITEEERGV
>NZ_CP025501.1|WP_003464290.1|886839_887346_+|CarD-family-transcriptional-regulator
MFKINDYIMYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKYPKKTVIKIPVDNKKISMRTLLSKEDVNSIINSIPETETLWIDNDRQRNDEFKTMLRSGNCDDLIVLIRSIYLDKKKRKLDGKKACKGDDEIMQTAEKLINEEFAVILDIRPEEVKSYIKSHIPQ
>NZ_CP025501.1|WP_004458048.1|884603_885746_+|hypothetical-protein
MTFKDDIQKLSVQVKERKEYITNEEMTKQALIIPFIQILGFDVFNPIEIRPEYSADFGIKKGEKVDYALFKENEPIIFIEAKSVNENLNNHDAQLARYFNSTKEVKLAILTNGVEYKFFTDLNANNVMDDTPFLNINLLEIKESDIESLNKLRKENFDKDSLITYAEELVYTSTLNESLRRLFSNPSDDFVRFIVKDFSEMRITSNVIERFRPLVKKAISNAVLDIVSKGLYQQETLTIKKEENINNDSVNRDDLSEIEIGNKVHKGIITTENELKGFNIVKDILEKNNRDISEINYKDTTNYFSVYLRNTTRWIIRFNLDASKKNVMTKLPVEYAKNICPNKEIEQAPKGIGESRVYINSIDELYDLEKYLVDAYDNVN
>NZ_CP025501.1|WP_004458077.1|883656_884388_-|NAD-dependent-protein-deacylase
MDDKITKLKEIIKNNNNIVFFGGAGVSTESGIPDFRSANGLFNEKLNITFTPEQLVSHSFFKRYPEEFFNFYKAKLIYPNAKPNDAHIALAKLEEMGKLKAIVTQNIDGLHQMAGSKNVFELHGSVLRNYCVDCHTFYDEKFILESKGVPKCTKCGGIVKPDVVLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGLINYFRGKNLVLINKSSTQADSKADLVINDSIGKVLGKVID
>NZ_CP025501.1|WP_003480009.1|883205_883520_-|hypothetical-protein
MFIQKILSYKKILKINMFFLILCLAINIILFKNLPNKIALQIVESGELGNYIPKLFFIFFTPIVISLITFYNYMKTELRVSRSIVPVIVLFILNIIILITNLFA
>NZ_CP025501.1|WP_003458352.1|882872_883121_+|spore-coat-protein
MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDEVRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG
>NZ_CP025501.1|WP_004458079.1|892017_892695_-|uracil-DNA-glycosylase
MAAEFNNDWDDLLKDEFEKEYYLNLRKFLINEYKTQKIHPSMYDIFNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNSIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIPNI
>NZ_CP025501.1|WP_003468707.1|893032_895570_+|beta-hexosaminidase
MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTLEEKLGQMIMPDFRMWQEEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQTTTLIHDLQEVAINDEDGNLPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYDAGYVIGKELNALGVNVDFAPVLDTNNNPENPVIGVRSISSNPELVGKLGKNIAKGIQDQGVAATAKHFPGHGDTATDSHYGLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHIQFPQIEKDTFISKKDGSQISIPATLSDDIIKGILREEMEYDGVVITDAMNMKAISDHFGELESTKMAINAGIDIILMPTILRNNEDVKKLDYIVNGILDSIKSGEIKEEEITDSAERIVKLKIDRGIIDLKNNNASLEEKIKKAKKTVGSVENRNIERRISEEAITITKNEENILPLNPKEGEKVLLIAPNESQIHSMKFGINRLIHENSLNNIKLDTYEYNNIGIIDDVLKEKIESSDYIIVASLSSNANHLKPGAWNRDLPRSVIDYGNKLNKDTVLISLRNPYDLAAYDNAKAQVVAYGFKGMDPTEGDTLFPTKSSGPNIPASMGVVFGAVEPKGKLPVDIPSLNNDGTMNTEVNYYDYGHGITNINSLGNVNISMNKKINLGDNFQVKFNLSDFNEIVAGKYRAKIKFQGEKLEFINGKVEFSGDLQTNIIDNNTLEVLINLEEGSLKANEVNFILEFKAIDKAELTSIEITSSELIDEKGRCFKQKYVISEFSIEDNKEDKPLSPDEDKEDEENNEDLGNSDDNNKDELPQTGSGVGKEFIFGLGSLSLLAGIGLKSKRFKRK
>NZ_CP025501.1|WP_003470229.1|901313_901781_-|peroxiredoxin
MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAGCTTEACDFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDETVCKLYDVIKEKNMYGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN
>NZ_CP025501.1|WP_003453475.1|902413_903160_+|peptidylprolyl-isomerase
MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVLEQAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKAFYEEHKENFVELETVTAKHILVASEEEAKKVEEEIASGSITFEDAANKYSSCPSKEQGGNLGSFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQVVNMLIQERQQKKYLELIKELREKYGVKLA
>NZ_CP025501.1|WP_003453460.1|903623_904436_+|ABC-transporter-permease
MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRPLAMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLVKKVKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFLAALSRLLSTWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNPLYYLAVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFKKFRPEFDDVL
>NZ_CP025501.1|WP_003453458.1|904453_905626_+|ATP-binding-cassette-domain-containing-protein
MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVSFEISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELTGMENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAINVDPDILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQKGEVVDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIAVKSNTKNVEYLEKLDLEVEYDLISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKLKVSLNKVNLVAGVYYIDFVLRDGEEEVYRKINGYSFTLNDKYRGEGFLILGHSWGN
>NZ_CP025501.1|WP_003453483.1|905639_906923_+|glycosyltransferase
MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALTYRKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYRTSEQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQYIKEKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEEIEEIRGKENVAMITNGVQYDHWQYRSDEVPEKLKDIVSKGNPIIGYFGALAKWFDYELLKKVAKERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTIPFLLNDITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALTLDKKDEYYNYLKEEALANTWREKAAILDRLIEKNI
>NZ_CP025501.1|WP_003453477.1|906941_908177_+|glycosyltransferase
MSLKRSLKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKNGNYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEENLYLVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVDDLSDDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGVQYEHFANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVLIGIDYDQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFVVNEITEATSPVKLFEYMALGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEGNQNTWRQKAKDIKELILNS
>NZ_CP025501.1|WP_003460432.1|908190_909372_+|ABC-transporter-ATP-binding-protein
MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTDVSFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPELTGEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVAININPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIWLEKGRVVDIGPSFDIVEKYYDKLMKSDDKEELETGKFVELINVEILDDKKVYKKGESIEFLVEYEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRNKITFKIDSLDVKEGIYYLDAIFSESQNLVALETQEDVVSFEVKNEGESEGFVFLDSTWT
>NZ_CP025501.1|WP_110083361.1|909487_910921_+|glycosyltransferase
MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLELTKVINEDGEETVYYENKITEEDILSGNFNELCSKTSKYIDDAISSILFEGQFNCFYEKIKSILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNIYSIKKIKDNLYVLNLDMYSLNVAFFEAIKSINNPKFVHVYATCLNSVDYEKIKTYMDKGFKVIYDFVDELSSEISGYNITSKMIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENENNILSPNAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWFDYKLIEQLAKEREDYEIVLIGMDYDGSYDQSNLKYYSNISYLGMIDYKDLINYSRYFDVCIVPFIKNDITDSTSPLKIFEYMALEKPIVTTDINECKNYESCLISKDYDEFIRNIDKALKLEIDNKEYFNILRREAEENTWDNRAELIKEAIKNLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025501_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025501_2

1745587-1745791

Orphan

Consensus_repeat	Method
TTTTAAACAATATTTGCTTTTAGGT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP025501_2

>merge|NZ_CP025501|2|1745587-1745791|CRISPRCasFinder
TTTTAAACAAGCTTTATTTTTTAGGTGCACAAACCATAATTTTTTTTGGGGCATTACAATAGATGATTTTAAACAATATTTGCTTTTAGGTCTGTTTACGAGCAAATATTAAATAAAATCTAAACTAGATACTTTTAAACAATATTTGTTTTTAGGTTCTAACAGCTTTTTAGTAGTTACTATTAATAGAATATTGATTTTAGGT

>NZ_CP025501|2|2|1745587-1745791|CRISPRCasFinder
TTTTAAACAAGCTTTATTTTTTAGG	TGCACAAACCATAATTTTTTTTGGGGCATTACAATAGATGA
TTTTAAACAATATTTGCTTTTAGGT	CTGTTTACGAGCAAATATTAAATAAAATCTAAACTAGATAC
TTTTAAACAATATTTGTTTTTAGGT	TCTAACAGCTTTTTAGTAGTTAC
TATTAATAGAATATTGATTTTAGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025501.1\|WP_003454035.1\|1742539_1743094_+\|BMC-domain-containing-protein	unknown	unknown	gnl\|CDD\|131578
NZ_CP025501.1\|WP_003453880.1\|1739732_1740509_+\|ethanolamine-utilization-cobalamin-adenosyltransferase	unknown	unknown	gnl\|CDD\|227149
NZ_CP025501.1\|WP_003477277.1\|1752807_1753266_+\|4Fe-4S-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|379137
NZ_CP025501.1\|WP_061415374.1\|1747458_1749099_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
NZ_CP025501.1\|WP_003453976.1\|1739364_1739655_+\|ethanolamine-utilization-microcompartment-protein-EutM	unknown	unknown	gnl\|CDD\|132899
NZ_CP025501.1\|WP_060669974.1\|1753430_1753649_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_110083135.1\|1750999_1752811_+\|ribonucleoside-triphosphate-reductase	unknown	unknown	gnl\|CDD\|236212
NZ_CP025501.1\|WP_003453793.1\|1745996_1746542_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP025501.1\|WP_060669976.1\|1754360_1755146_-\|phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP025501.1\|WP_003453956.1\|1742265_1742538_+\|EutN/CcmL-family-microcompartment-protein	unknown	unknown	gnl\|CDD\|377017
NZ_CP025501.1\|WP_003453938.1\|1746833_1747145_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_060669977.1\|1755504_1756602_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003454013.1\|1750243_1750669_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341244
NZ_CP025501.1\|WP_110439879.1\|1737531_1739010_+\|acetaldehyde-dehydrogenase-(acetylating)	unknown	unknown	gnl\|CDD\|131570
NZ_CP025501.1\|WP_003454016.1\|1743144_1744242_+\|ethanolamine-utilization-protein-EutH	unknown	unknown	gnl\|CDD\|237906
NZ_CP025501.1\|WP_011010109.1\|1741359_1742118_+\|ethanolamine-utilization-protein	unknown	unknown	gnl\|CDD\|274184
NZ_CP025501.1\|WP_087327787.1\|1744238_1744718_+\|DUF861-domain-containing-protein	unknown	unknown	gnl\|CDD\|114941
NZ_CP025501.1\|WP_110083134.1\|1749180_1749801_+\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|223728
NZ_CP025501.1\|WP_003454005.1\|1745085_1745562_+\|glutathione-peroxidase	unknown	unknown	gnl\|CDD\|238207
NZ_CP025501.1\|WP_003454092.1\|1740518_1741154_+\|phosphate-propanoyltransferase	unknown	unknown	gnl\|CDD\|237899

Protein	Function_ID	Function_description	E-value
NZ_CP025501.1\|WP_003454035.1\|1742539_1743094_+\|BMC-domain-containing-protein	gnl\|CDD\|131578	TIGR02526, putative_ethanolamine_utilization_protein, PduT-like ethanolamine utilization protein. This gene shows up in ethanolamine utilization operons in which a proteinaceous coat organelle is also encoded. It is closely related to the PduT protein in propane-diol operons with the same structure.	7.32798e-92
NZ_CP025501.1\|WP_003453880.1\|1739732_1740509_+\|ethanolamine-utilization-cobalamin-adenosyltransferase	gnl\|CDD\|227149	COG4812, EutT, Ethanolamine utilization cobalamin adenosyltransferase [Amino acid transport and metabolism].	1.25082e-69
NZ_CP025501.1\|WP_003477277.1\|1752807_1753266_+\|4Fe-4S-cluster-binding-domain-containing-protein	gnl\|CDD\|379137	pfam13353, Fer4_12, 4Fe-4S single cluster domain. This family includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. The structure of the domain is an alpha-antiparallel beta sandwich.	8.39284e-10
NZ_CP025501.1\|WP_061415374.1\|1747458_1749099_+\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	2.10316e-56
NZ_CP025501.1\|WP_003453976.1\|1739364_1739655_+\|ethanolamine-utilization-microcompartment-protein-EutM	gnl\|CDD\|132899	cd07059, BMC_PduA, 1,2-propanediol utilization protein A (PduA), Bacterial Micro-Compartment (BMC) domain. PduA is encoded within the 1,2-propanediol utilization (pdu) operon along with other homologous carboxysome shell proteins PduB, B', J, K, T, and U. PduA is thought to be required for the formation of the outer shell of bacterial pdu polyhedral organelles which are involved in coenzyme B12-dependent degradation of 1,2-propanediol. Although it has been suggested that PduA might form hexamers and further assemble into the flat facets of the polyhedral outer shell of pdu organelles, like PduU does, at present no experimental evidence directly supports this view.	4.19683e-40
NZ_CP025501.1\|WP_110083135.1\|1750999_1752811_+\|ribonucleoside-triphosphate-reductase	gnl\|CDD\|236212	PRK08270, PRK08270, ribonucleoside triphosphate reductase.	0
NZ_CP025501.1\|WP_003453793.1\|1745996_1746542_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.47125e-09
NZ_CP025501.1\|WP_060669976.1\|1754360_1755146_-\|phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	2.13218e-22
NZ_CP025501.1\|WP_003453956.1\|1742265_1742538_+\|EutN/CcmL-family-microcompartment-protein	gnl\|CDD\|377017	pfam03319, EutN_CcmL, Ethanolamine utilisation protein EutN/carboxysome. The crystal structure of EutN contains a central five-stranded beta-barrel, with an alpha-helix at the open end of this barrel (Structure 2HD3). The structure also contains three additional beta-strands, which help the formation of a tight hexamer, with a hole in the center. this suggests that EutN forms a pore, with an opening of 26 Angstrom in diameter on one face and 14 Angstrom on the other face. EutN is involved in the cobalamin-dependent degradation of ethanolamine.	5.50579e-37
NZ_CP025501.1\|WP_003454013.1\|1750243_1750669_+\|hypothetical-protein	gnl\|CDD\|341244	cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase. 2,3-dihydroxybenzoate-AMP ligase activates 2,3-dihydroxybenzoate (DHB) by ligation of AMP from ATP with the release of pyrophosphate. However, it can also catalyze the ATP-PPi exchange for 2,3-DHB analogs, such as salicyclic acid (o-hydrobenzoate), as well as 2,4-DHB and 2,5-DHB, but with less efficiency. Proteins in this family are the stand-alone adenylation components of non-ribosomal peptide synthases (NRPSs) involved in the biosynthesis of siderophores, which are low molecular weight iron-chelating compounds synthesized by many bacteria to aid in the acquisition of this vital trace elements. In Escherichia coli, the 2,3-dihydroxybenzoate-AMP ligase is called EntE, the adenylation component of the enterobactin NRPS system.	0.000416194
NZ_CP025501.1\|WP_110439879.1\|1737531_1739010_+\|acetaldehyde-dehydrogenase-(acetylating)	gnl\|CDD\|131570	TIGR02518, Acetaldehyde_dehydrogenase_acetylating, acetaldehyde dehydrogenase (acetylating).	0
NZ_CP025501.1\|WP_003454016.1\|1743144_1744242_+\|ethanolamine-utilization-protein-EutH	gnl\|CDD\|237906	PRK15086, PRK15086, ethanolamine utilization protein EutH; Provisional.	5.41583e-166
NZ_CP025501.1\|WP_011010109.1\|1741359_1742118_+\|ethanolamine-utilization-protein	gnl\|CDD\|274184	TIGR02536, putative_ethanolamine_utilization_protein, ethanolamine utilization protein. This family of proteins is found in operons for the polyhedral organelle-based degradation of ethanolamine. This family is not found in proteobacterial species which otherwise have the same suite of genes in the eut operon. Proteobacteria have two genes that are not found in non-proteobacteria which may complement this genes function, a phosphotransacetylase (pfam01515) and the EutJ protein (TIGR02529) of unknown function.	1.09012e-73
NZ_CP025501.1\|WP_087327787.1\|1744238_1744718_+\|DUF861-domain-containing-protein	gnl\|CDD\|114941	pfam06249, EutQ, Ethanolamine utilisation protein EutQ. The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine. The role of EutQ in this process is unclear.	2.00802e-93
NZ_CP025501.1\|WP_110083134.1\|1749180_1749801_+\|flavodoxin-family-protein	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	2.26817e-51
NZ_CP025501.1\|WP_003454005.1\|1745085_1745562_+\|glutathione-peroxidase	gnl\|CDD\|238207	cd00340, GSH_Peroxidase, Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.	8.48351e-99
NZ_CP025501.1\|WP_003454092.1\|1740518_1741154_+\|phosphate-propanoyltransferase	gnl\|CDD\|237899	PRK15070, PRK15070, phosphate propanoyltransferase.	5.80349e-116

>NZ_CP025501.1|WP_003454005.1|1745085_1745562_+|glutathione-peroxidase
MEIYDISVKDINGENVSLERYRGKVLLIVNTASKCGFTKQFDGLEELYEKYKDEGFEVLGFPCNQFKEQDPGSNSEIMNFCKLNFGVTFPMFEKIDVNGENESLLYSYLKEQKSGMFGSKIKWNFTKFLVDREGNVIKRFSPQTTPKSIEKDIEELLA
>NZ_CP025501.1|WP_087327787.1|1744238_1744718_+|DUF861-domain-containing-protein
MIMENISKELLEKLVRQIIEEKLAGAGNNDSVDFIRNKDKSGIMSIKLPTVKVDESNRLDTGNPRDVVYTKDLFTLEESPRLGAGIMEMKETTFDWTLNYDEIDYVIEGHLDIIIDGRKISADAGEIILIPKGSKIQFSVPDYARFIYVTYPADWASQA
>NZ_CP025501.1|WP_003454016.1|1743144_1744242_+|ethanolamine-utilization-protein-EutH
MSINEIIVYIMVACMALGAIDKCLGNKFGIGEQFEEGIMAMGSLALAMVGVICLAPVLASVLGPIVTPVFNALGADPAMFAGSILANDMGGAPLAASLAQDPQAGMFSGLIIGAMMGATIVFTIPVSLGIIEKKDHKFLATGILAGIITIPVGAFVGGLVAGFPAMMVLKNLVPIIIFAILIAIGLAFAEEAMIKGFNIFGKIVVIIITLALAAAIIEALTGFVIIPGMAPITDGIEIVGSIAIVLAGAFPLVYIITKVFKKPLMGLGKILGMNEIAAAGMIASLANNIPMFGMLKDMDDRGKIINVAFAVSASFVLGDHLGFTAGFNPEMIFPMIVAKLVGGITAVILAMFIAKKTLGKIEEAK
>NZ_CP025501.1|WP_003454035.1|1742539_1743094_+|BMC-domain-containing-protein
MKKSIGALEFRSISKGIEVSNEVVKKAFVEVSYLKSICPGKFFLIVNGDAGEVKEAIEFGEKLGEKYLVGSFIINSIHHDIINALKGKYSQKNIEDKAIGIMETGKVSSGILALDKTLKSSEVNLVKLQLAFGIGGKLVYIVSGDLSSVENGMREGQSILQEKDIINVSIIPFVHSEIAKNLIK
>NZ_CP025501.1|WP_003453956.1|1742265_1742538_+|EutN/CcmL-family-microcompartment-protein
MEIGRVVGNVWATRKDEKLNGQKFLIVKLLVSKDKEKEGLFVAADNAGAGIGDIVLITKGGAARQSIGNREVPIDAAIVGIVDSIDIEED
>NZ_CP025501.1|WP_011010109.1|1741359_1742118_+|ethanolamine-utilization-protein
MKGGKDNMDYEKLVEFLVDEIYKRIQEENNKSNSLEKRKSIVVIGESNVSFYREALKGFDINPLTSECKDCDILLISKLCIKGLSNIAQGTCTTKAENFALEMLLKGKKVYILEDGIEYRKYKNTAPKVLYNKYIKFEEELLAYGIEVIDDLNRISIESKDEKVSLSGIKEEISKNLCLCSENKVEGKKDLDTTAIADEFTINLSNKKLVSESDLRKPHINGVRTLIVDKKAIITPLAKDYIRINNLNVVLS
>NZ_CP025501.1|WP_003454092.1|1740518_1741154_+|phosphate-propanoyltransferase
MDNLLQDIIEEVVRRVKDEAFIEVEASGRHVHLTREHIDILFGEGHELTRIKDLSQPGQYACKERVTISGPRGKIDNVVVLGPPRNETQVEVSFTDALVLGSIPPVKLSGDLENTPEITISTERASIALNRGLMVAKRHIHMTPEDAIKFGVSNNESVKVKVLGKRPLIFDDVIVRVSKDYRTFMHIDYDEANACGFSKGTFALIVGKDEK
>NZ_CP025501.1|WP_003453880.1|1739732_1740509_+|ethanolamine-utilization-cobalamin-adenosyltransferase
MAVLTEGEVRKRLSREDLKALKEFKVVKGEIITPSAKSYLAEHNINLVYVNSEEEKLNKETEPKEIIREVVREKEYKYETVFGAKLDEKPEHMTHLTGNLLVFKDHKRIIFRGKIDSLEARIVETQVLCHKQGMNKLVEDLQEILNLIGRILRCEVLSEPLEGFSLQGMTEKDLREKSHNPKKYFGIGHEMPTYEMGEIVAALNILRTLTRETELSAYEAFKGEYGQVEREDLIRALNRLSSVFWIMIFKVRTGKYEK
>NZ_CP025501.1|WP_003453976.1|1739364_1739655_+|ethanolamine-utilization-microcompartment-protein-EutM
MANANALGMIETRGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGDLISVHVIPRPHFEVDAILPKAPKAE
>NZ_CP025501.1|WP_110439879.1|1737531_1739010_+|acetaldehyde-dehydrogenase-(acetylating)
MEFLDKDLVSIQETRGLIRKAKEAQSKLARMSQQDIDRIVKAISDAAYENSEKLAKMANEETGFGKWEDKVLKNVFAARTVYESIKDTKTVGIVEENVEKRAFKIMVPVGVVAGLIPSTNPTSTAIYKAMISIKARNAIVLSPHPSAKKCIIETAKIIAKAAERAGCPEGAIGCITVPSIEGTNELMKNKDTSLILATGGEAMVRAAYSSGTPAIGVGPGNGPAFIDKSADVKLAVKRILDSKTFDNGTICASEQSIVVEKAMEDEVVRELKEQGAYFLAEEQANQLSKFVMRANGTMNPQIVGKTPQDIAKLAGLEGIPSWARVLIPRECHVGHKYPFSREKLTTILTFFVEENVDAVLNRCREILLNEGAGHTFCMHANNEELVKKFALEMPVSRMVVNSPGALGGIGATINLVPALTLGCGAVGGSSTSHNIGPLDLMNTRNVAYGVRELEDIRELAVGATKEVASSLDLGDKEELINLLVKKIIEELK
>NZ_CP025501.1|WP_003453793.1|1745996_1746542_+|GNAT-family-N-acetyltransferase
MNLKRINSNDNCFNKAMEIYNGSFPIFERRTMDDQIKALDDTNYHFEVIYDKEEIVGILLYWDMGRYKYIEHFAIDSKLRGKNYGSRVLKEFCDHNKNVILEIDPPIDEISIKRLNFYLKLGFKLQDFDYTHPSYRKGCKRHSLKIMTFNHNMPKEDYDTFNILLKRDIMKYSEFKDRLNN
>NZ_CP025501.1|WP_003453938.1|1746833_1747145_+|hypothetical-protein
MKKVLIGVLVFLICIISVFLFFDREEESIVTDVVEKSQYGLLVNYEDGLIAVDTGDAEIVDRDGKENTLDCINEGDRIEIIYDGKIEETYPAQINNVYKIIIF
>NZ_CP025501.1|WP_061415374.1|1747458_1749099_+|EAL-domain-containing-protein
MKKRVFWVSIVFLIIITVLGITIKFDGKKVNCNRKTVKVGFYEYYPYYYLNKNSMPDGYYNEILELICNKLDLNYKYVDCNVTDALEKLKSGQIDLVFGISKTPDREKEYEFTDHYLNNDNFAIYTNKNIKNGDLKALNGLKMGFLKGEENNEWILRLLKDKGINVKPIYVSNYPEDEEYLYNNKVDFVVENTRSNINYENKNIKKIFEFSSGPVYIVSRKGNEKLIEGIDSVLGELEEDGEQKDTNLYSKYFDEHLDKLKNEKLLVVIFLIIISLFIYKKRKNKIFAIRTKRKIRDYMKNDKYILYYQPIVDPKKNRVKGFESLLRLNKDGKILTPYSFIKEIEDNNMSLEVSLWLLKKVISDYRIIKDYDMVKGRDFYISLNVSFKEIENPKFLRSLMKIAKDYKIDDCNICLEIVEKFGMEDIGRIQSAIRIIKEYGFLIAIDDFGVEYSNLDLLNKIDSDIVKLDKYFADNLDKSIINEKTVEFISEICIIANRTIVFEGIEEQYQVDIVKAFPYEKIYIQGYFYSKPVDIETLKDFKFKDS
>NZ_CP025501.1|WP_110083134.1|1749180_1749801_+|flavodoxin-family-protein
MKVLLVNGSPNKEGCTYTALKEVSKTLEENGIDTEIFQVGNKPIGGCIGCGSCKKTGECFMKDGVNEFVEKAKDADGFVFGSPVYYAAASGSITSFLDRAFYCGGKHMAFKPGAVICSARRAGTTSTLDQLSKYLTICNMPVVSSQYWNMVHGNTPEEVKKDLEGMQTMRVLGRNMAWLIKCIELGKKNNILKPELEERERTNFIR
>NZ_CP025501.1|WP_003454013.1|1750243_1750669_+|hypothetical-protein
MESKEMRLAKKAKKLIDEFERVQSVLLSGELSDQEVEIRDDGATIVLKNIMPGYSGEAMFKLTHISDVVKAYIDDMDEENDEMIKSYEVENTNWHESDLGDIYRESAMEHLEKVEVVGDKVRHTYKELKKIEEKAREIEGL
>NZ_CP025501.1|WP_110083135.1|1750999_1752811_+|ribonucleoside-triphosphate-reductase
MYNVSINKRDAKKDVKNMLSSKKIVDDYIKKIDWRVNENSNSPYSFGSLNKHIIAEVSKDYWLNEVYKDKRIIDAYKNGDMHIHDLGGLTLYCCGYSLRNIILMGVQGIPNIPTSSPAKHFDAILNQIANLVTIYQNEIMGAVAFNSFDTLLAPYIKKDNLTYEEVKQNLQNFIFSINSNSRAGAEPAFTNITFDLFPPKDLENDPALIGDKIQEFTYKECQKEMDMLNKAFYELMNEGDYNGRPFSYPIPTYNINSNFDFDNPNNDMLFEMTGKFGYPYFANFVNSDMDQSDVRSMCCRLNLDLRELRKRNGGLFGSGDSTGSIGVVTINLPRLAYKHKNNEKEFFNALKEILIIAKDSLEKKRKWLNDNIINKDMLPAFSTYVGTLKNHFSTIGIVGLNEMCENFNGNNILTEEGMEFSIKVCNFIREELINFQEETGNLYNFEATPAESTCYRLAKKDVEDFEDIIVRGGREYPYYTNSCHMPPNEVKNLKQLFDHQDKLQVLFTGGTVVHIYCDGAISGEKAKHIVKTVCKKYRTPYVSISPLNRYCEEHGYVKERVEECPICGKKLDLYQRITGYLRKVEFFNDGKKSEFKDRNQLSL
>NZ_CP025501.1|WP_003477277.1|1752807_1753266_+|4Fe-4S-cluster-binding-domain-containing-protein
MIIKTKGIVHERVEDAPFMGALISAVDCNLNCKGCFNQHLKDLPNIEMDSEDILDEVTNDPFNEGIILAGLEWSLQPKELREMVNSARKRKLKVIVYSGLSEEDFKKKFPDIYGLKGDMYFKFGKYDEKLKVNNNIQYDVKLATSNQKILKK
>NZ_CP025501.1|WP_060669974.1|1753430_1753649_-|hypothetical-protein
MKDENINIKYQNKVNLIFIILVTISFLLYRFCFDRNGNLLSLNYILIYLVVLVLVISSLRNFIRERTKNKHN
>NZ_CP025501.1|WP_060669976.1|1754360_1755146_-|phosphorylase
MYNFLIAGHTKYGLKKDTLCKSVLKCDDEAIKENVIIAPWWEPTIFKDIESELIVDTSIKIWNCKLFDKNITYIKTGIGASVCTDVTLALGNSNCKKIIFIGSVGALDDKINLGDIIIPTLSVCGDGVCRYLEKDLTKDCFGDKYYPDTKLNKILIKNTEKICKDNNVSYHIVPNFSVDTIFAQFAHLDYIMKLGCKSIEMETAAAFKACSICNIPIAAIFNVSDNSIKNKSIYNGKTESKLKYRKKVRNEIIPKIIYSLL
>NZ_CP025501.1|WP_060669977.1|1755504_1756602_+|hypothetical-protein
MNRCELLLMVEGDTIEVEAKVKLEKEMKISFVLKDSFNMLYSSAEYDTELIEPNFIGKCNKYTLEEETDNFTLRYRGKPYGFCTECSDEKVLLSFYCAWYPILDDFLFDDIKVIIKGLENFIVLDAVKEKDFWIFNNKIPFDCNIRAFNKDKVFSSECDFIKIYSGKESELGYINKIVGELHKINEYYSRILGEKENNKLQLISTGIENSGGYFREGFIVLPCLEDNDKFIYSFLGHELAHAWHMGYSVTTYDDWLNETGAEWSSLSYILSIGKNDLYNKQIQYAIKAFEEYPIMKPEDGSRPRTAHFGGVLLFDKIYERYGLDTINKLLRLAYETTPKNTDEFLKRVKGDFHTEIYNILSEPFR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025501_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025501_3

2373236-2373328

Orphan

Consensus_repeat	Method
TATGAAGATATTAATAAAACTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025501_3

>merge|NZ_CP025501|3|2373236-2373328|CRISPRCasFinder
TATGAAGATATTAATAAAACTTATAGATAGAATGTAGAGAATATCTACATGAATTTTAGACCTAAAAAATTATAAAGATATTAATAAAACTTA

>NZ_CP025501|3|3|2373236-2373328|CRISPRCasFinder
TATGAAGATATTAATAAAACTTA	TAGATAGAATGTAGAGAATATCTACATGAATTTTAGACCTAAAAAAT
TATAAAGATATTAATAAAACTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025501.1\|WP_003467271.1\|2359833_2361756_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274912
NZ_CP025501.1\|WP_003450474.1\|2387357_2388392_-\|sugar-binding-domain-protein	unknown	unknown	gnl\|CDD\|225263
NZ_CP025501.1\|WP_003460356.1\|2382278_2383817_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
NZ_CP025501.1\|WP_003450470.1\|2383941_2384688_-\|triose-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234589
NZ_CP025501.1\|WP_003460343.1\|2376503_2377061_-\|tryptophan-transporter	unknown	unknown	gnl\|CDD\|293704
NZ_CP025501.1\|WP_003467343.1\|2371581_2372190_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003465814.1\|2362559_2363924_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340890
NZ_CP025501.1\|WP_003450483.1\|2384931_2386125_-\|phosphoglycerate-kinase	unknown	unknown	gnl\|CDD\|234613
NZ_CP025501.1\|WP_003460354.1\|2378245_2379541_-\|phosphopyruvate-hydratase	unknown	unknown	gnl\|CDD\|234617
NZ_CP025501.1\|WP_003465824.1\|2369494_2370073_-\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|181705
NZ_CP025501.1\|WP_003467145.1\|2366627_2367140_-\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|225632
NZ_CP025501.1\|WP_003460335.1\|2380247_2381705_-\|glutamate:gamma-aminobutyrate-antiporter	unknown	unknown	gnl\|CDD\|129988
NZ_CP025501.1\|WP_003467369.1\|2361771_2362533_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NZ_CP025501.1\|WP_003456486.1\|2372630_2373101_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|376590
NZ_CP025501.1\|WP_003467231.1\|2370245_2371235_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP025501.1\|WP_003467303.1\|2365294_2366602_-\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP025501.1\|WP_003467359.1\|2367162_2368170_-\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270389
NZ_CP025501.1\|WP_003477916.1\|2376083_2376314_-\|preprotein-translocase-subunit-SecG	unknown	unknown	gnl\|CDD\|235881
NZ_CP025501.1\|WP_042261893.1\|2373539_2375795_-\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NZ_CP025501.1\|WP_003460339.1\|2386268_2387267_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|273675

Protein	Function_ID	Function_description	E-value
NZ_CP025501.1\|WP_003467271.1\|2359833_2361756_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|274912	TIGR03997, NADH:flavin_oxidoreductase, mycofactocin system FadH/OYE family oxidoreductase 2. The yeast protein called old yellow enzyme and FadH from Escherichia coli (2,4-dienoyl CoA reductase) are enzymes with 4Fe-4S, FMN, and FAD prosthetic groups, and interact with NADPH as well as substrate. Members of this related protein family occur in the vicinity of the putative mycofactocin biosynthesis operon in a number of Actinobacteria such as Frankia sp. and Rhodococcus sp., in Pelotomaculum thermopropionicum SI (Firmicutes), and in Geobacter uraniireducens Rf4 (Deltaproteobacteria). The function of this oxidoreductase is unknown.	5.89503e-108
NZ_CP025501.1\|WP_003450474.1\|2387357_2388392_-\|sugar-binding-domain-protein	gnl\|CDD\|225263	COG2390, DeoR, Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription].	2.61016e-73
NZ_CP025501.1\|WP_003450470.1\|2383941_2384688_-\|triose-phosphate-isomerase	gnl\|CDD\|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	1.22942e-154
NZ_CP025501.1\|WP_003460343.1\|2376503_2377061_-\|tryptophan-transporter	gnl\|CDD\|293704	pfam17099, TrpP, Tryptophan transporter TrpP. TrpP is a bacterial transmembrane protein that is probably involved in tryptophan uptake. Its expression is regulated by tryptophan-activated RNA-binding regulatory protein (TRAP).	1.35919e-66
NZ_CP025501.1\|WP_003460356.1\|2382278_2383817_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
NZ_CP025501.1\|WP_003465814.1\|2362559_2363924_-\|MFS-transporter	gnl\|CDD\|340890	cd17332, MFS_MelB_like, Salmonella enterica Na+/melibiose symporter MelB and similar transporters of the Major Facilitator Superfamily. This family is composed of Salmonella enterica Na+/melibiose symporter MelB, Major Facilitator Superfamily domain-containing proteins, MFSD2 and MFSD12, and other sugar transporters. MelB catalyzes the electrogenic symport of galactosides with Na+, Li+ or H+. The MFSD2 subfamily is composed of two vertebrate members, MFSD2A and MFSD2B. MFSD2A is more commonly called sodium-dependent lysophosphatidylcholine symporter 1 (NLS1). It is an LPC symporter that plays an essential role for blood-brain barrier formation and function. Inactivating mutations in MFSD2A cause a lethal microcephaly syndrome. MFSD2B is a potential risk or protect factor in the prognosis of lung adenocarcinoma. MelB-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.41396e-88
NZ_CP025501.1\|WP_003450483.1\|2384931_2386125_-\|phosphoglycerate-kinase	gnl\|CDD\|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
NZ_CP025501.1\|WP_003460354.1\|2378245_2379541_-\|phosphopyruvate-hydratase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
NZ_CP025501.1\|WP_003465824.1\|2369494_2370073_-\|xanthine-phosphoribosyltransferase	gnl\|CDD\|181705	PRK09219, PRK09219, xanthine phosphoribosyltransferase; Validated.	2.37693e-102
NZ_CP025501.1\|WP_003477916.1\|2376083_2376314_-\|preprotein-translocase-subunit-SecG	gnl\|CDD\|235881	PRK06870, secG, preprotein translocase subunit SecG; Reviewed.	1.4375e-08
NZ_CP025501.1\|WP_003460335.1\|2380247_2381705_-\|glutamate:gamma-aminobutyrate-antiporter	gnl\|CDD\|129988	TIGR00910, Glutamate/gamma-aminobutyrate_antiporter, glutamate:gamma-aminobutyrate antiporter. Lowered cutoffs from 1000/500 to 800/300, promoted from subfamily to equivalog, and put into a Genome Property DHH 9/1/2009 [Transport and binding proteins, Amino acids, peptides and amines].	0
NZ_CP025501.1\|WP_003467369.1\|2361771_2362533_-\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	2.74602e-11
NZ_CP025501.1\|WP_003456486.1\|2372630_2373101_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	4.64145e-85
NZ_CP025501.1\|WP_003467231.1\|2370245_2371235_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	2.54365e-13
NZ_CP025501.1\|WP_003467303.1\|2365294_2366602_-\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	2.23844e-132
NZ_CP025501.1\|WP_003467359.1\|2367162_2368170_-\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270389	cd13671, PBP2_TRAP_SBP_like_3, Uncharacterized substrate-binding protein of the Tripartite ATP-independent Periplasmic transporter family; the type 2 periplasmic-binding protein fold. This subfamily includes uncharacterized periplasmic substrate-binding proteins similar to TRAP transport systems such as SiaP (a sialic acid binding virulence factor) and TeaA (an ectoine binding protein). TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.33539e-150
NZ_CP025501.1\|WP_003467145.1\|2366627_2367140_-\|TRAP-transporter-small-permease	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	5.01825e-32
NZ_CP025501.1\|WP_042261893.1\|2373539_2375795_-\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NZ_CP025501.1\|WP_003460339.1\|2386268_2387267_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|273675	TIGR01534, Glyceraldehyde-3-phosphate_dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, type I. This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis].	0

>NZ_CP025501.1|WP_003456486.1|2372630_2373101_-|SsrA-binding-protein-SmpB
MAKRKDNKTLAENRKARHDYFVDEAMEAGIALVGTEVKSIRNGRVNLKDCYADINNGEIFINNMHISPYEQGNIFNVDPLRKRKLLLHKSEIQRLIGIVQQQGVALIPLSLYLKNGRVKVNLGVCRGKKNYDKRDTMLEKAHKREMDRQLKERNRY
>NZ_CP025501.1|WP_003467343.1|2371581_2372190_-|hypothetical-protein
MRVLKGVILAMIPVVLFVGCGELSKKDVVKVSFEPLSEKDEQILSLTDNRVFFYKVKNISKGKGYKIDLNYEVYKEGKEVKNEPILTSLSETYEKGKENITLGINFKDDNSINCLLGGDGVYSRHNYKAEENIKDYFSANFAGDYDLELEKGKRVCLYYATSGNGISSNVIGMDMDSEEIKEAINKSKDCIFLSISVEDYSE
>NZ_CP025501.1|WP_003467231.1|2370245_2371235_+|tetratricopeptide-repeat-protein
MTSFQSLIIILICILSIIIILYLIESDNFLPEKQIRKYVSLGKFKHALYLLDKYSEKLDPLFFYNNKILVLSKQKDFDAAYELSIEAIKKLKEPNYELYNNISFVYYNLKLYHRAIDFSEKALKLNPIDTFALNNKGFSYIEIGEYSKADECFDKALEFNPYFKNALSGKAYCAFEKSDYLLATKYLQDFVSIEKYNASAYKKLGECYFLLNDLKNSSKMYEKSLEIDQENDASYCEYANVLLCLGHYDKALNNLNKALAISPYNFMAFYYKARAYSLKKDFDNAFYYLERAFNYCDSLKEIALKDEMLTNLKFFSKFSELLEIHNIQN
>NZ_CP025501.1|WP_003465824.1|2369494_2370073_-|xanthine-phosphoribosyltransferase
MELLKDKIKKEGRVTEDNILMVDSFLNHQMDVEFFNEVGKEFKDRFKNDQIDKILTIESTGIGLGIITAQYFDNVPVVFGKKIERLPRNKREEVFNSEVYSFTKKTIYNVVVDKKFIKPGEKILIVDDFLANACAVFGLIDVVKQAGAEVVGVGIVIEKGFQSGRAHLEDKGIRVESLVTIDKIEDGEVYFK
>NZ_CP025501.1|WP_003467359.1|2367162_2368170_-|TRAP-transporter-substrate-binding-protein
MNKKIKALFVVATISLTLVGCGRTKSDDVRVMRVAHNQGEGHPIHLALKEFENIVETNTNNKIDIQVYPNELLGGQREAIELTQTGAIDIAVGSISLLESFNKSYSVFNLPYLFDSKEHYHAVMNDDEIMNDIYESTRESGFVGLTWFDAGSRNMYTTDKPIMKPEDLKGKKIRVQQSQTNIRMMELLGGSATPMSFGEVYTALQQKVIDGAENNELALTNNKHGEVAKYYSYNQHAMIPDILIMNAKLLDNLSEEHRNIILDAVDKINKFEVDAWEEKVEESKKQSEEMGVQFYYPELEPFKEKVLPLHDEMTKDPEVKTLYDNIQQKSQKESK
>NZ_CP025501.1|WP_003467145.1|2366627_2367140_-|TRAP-transporter-small-permease
MNKLRNILNKTIEVICMALLGFMVVLGTWQIITRYLLNNPSTISEDLLIYSFVWMALLGSAYVFGKKDHMTMVFFRQKLDNKSPKVKFILSVMTEVVILIFSALVLVLGGIQISNLAMGQISPALGIPMGYIYLALPFSGMITIIYNILNLVDLKSGLRRNSVNSTKVIK
>NZ_CP025501.1|WP_003467303.1|2365294_2366602_-|TRAP-transporter-large-permease
MELAFQAGTAIAIVFPILLLLGIPISITIGISSIFGILTTLSWDVAVLTGAQRIFTGISSFSLLAIPFFVLAGTIMNSGGIALRLVNFAKVLSGKLPGSLAHTNVVGNMLFGAVSGSSVAAAAAIGGTMAPLQKAEGYDKNYSAAVNIASAPTGLLIPPSNSLIIYSLVSGGTSVAALFMAGYIPGILWGLSVMVVAFILAKKYKYSSKYTITFKEAIKIFIDALPSLALIFIIIGGIVGGVFTATEGAAVAVVYSFILSFFFYKSIKLKDIPRILLETVEMTGIIIFLIGVSSIMSWVMAFTNIPNAITELLLGISSNPIVILLIMNLVLLIVGTFMDLTPAILIFTPIFLPIAKNFGMDSVQFGIMLIFNLCIGNITPPVGNTLFIGCKVGKTSIEEVIKYLLPFYGGILVVLMLVTFIPEISLFIPKLMGMI
>NZ_CP025501.1|WP_003465814.1|2362559_2363924_-|MFS-transporter
MRDFSMKDKIGYTLGDLGCCCTEQFRAMFLTVFYTLVLKINPIHVGTILLITKVWDAINDPIIGAIIDARKAKAGKKFIPWMRAFSIPCAILMCIGFLNVSNWDYGFKLAYVLITYVLYESMYTCVNVPFGSLSSVMTDDTNHRTDLSRYRSLGGTIFMTVIVIVGPLFLYKDNQPVASNFLLLAIICACISVFCIQVTCVWCKERVEIPDVEREKINYFQVLKNISKNRALLGVIIASLVGMIAASVVNGLNTYLFKDYFGNVKLMSISGMLSTVYAIITFIGTKFVANKFGKKEWCMYGAGFAAIVYGVLFFLPIKNPIMFIAINGICYIGASGFQILIWAMVNDSIDYQELKTGTRNESIVYSTYSFFRKIAAALSASLSSFILAFIGYNVNAATQTPEVISNLWKSYTGIYSLGYVIAILSLFFIYPLTKKKTEEMLQELSIKREKTKSV
>NZ_CP025501.1|WP_003467369.1|2361771_2362533_-|alpha/beta-hydrolase
MVKLIEINNRKNKVLRGVLTLPDNIENPIVVLNLHGFAGDKSGYKYAHTHLSRVLEANGFGCARFDFYGCGESDGEFEEMTFTGLIEDAIDMYNWLIDSKITTSDRIILSGHSMGGYVASCVAPKLKPTGLILMCPGGGMWYGCRERADELKNRSIQYANMEGLKFNIDFNYDLYNYEPFSNAKGYDNDVIIIRGTEDKLVNDQICKTYLDCYNSKKAKYVEIETGDHNFANIKAKSDCEDAIINFCKLINNK
>NZ_CP025501.1|WP_003467271.1|2359833_2361756_-|FAD-dependent-oxidoreductase
MKLLEKINIGKITLKNRVMFPPLTTGYEGRDGSITPQCIDFYERLAEGGVGYIVIGDVAPINSFSPTPKLFDDKQIDGFKKLSDSIHKYGAKVAVQIFHPEYDCDAINKMFATGDFNGVRKKLHHDMQHFVNEISEEGLKEIINKMCNCAIRAEKAGVDIIQIHGDRLVGSLCSTILNKRTDKYGGTLENRTRFALEFVRALKKAVPNMTIDYKFSVVTPERGKGGVNLDEAPIFAKWLEEAGVDMLHVAQANHTGNMADTIPPMGVQPYGFFVDIAAQIKKSVNIPVSTVGRIFNPKMAESILESDKADIIGIGRILLADADWVNKIIENRQEDIRECICCNKGCTDNIQNRKFLSCILNAENGYEGTRKINKSESKKKVIVVGGGPAGLEAARVASLKGHDVTLFDESTSLGGQLNLACIPPRKNEMRRAIRFLTHSVVSQNVDLRLGKKVTQEDILSLNPDVVLVAVGASNFIPHIDGYDKQIVCDSWKILSGEQQVFGNIAVIGGGMVGCEVTEYLCFEEGNKVSIVEMDNNIAKGESSTILPTMMENFSKNNVKIYTNHKVNKIDKDCIICENDSKEIKIPCDYVVMAVGAKPNSFEINKLLENNIKVVKIGDCKDRASDIENAIKTAYDAANEI
>NZ_CP025501.1|WP_042261893.1|2373539_2375795_-|ribonuclease-R
MKIKDIILGLMKEEAYRPMTMLELSKIFNINKAEYKQFKKVFKALEAEGLIARDEEDRFGLIDKVGLIPGKIQIHQKGFGFLIPDEEGVTDVFIPKNALNGAMNGDRVLGKVVKESQEGKRREGEIVRITERVNTKVIGIYEDNKSFGFVLPQDQRIQNDIFISKKDRNGAKKGNVVVVEITKWPDGRRKNPEGVVVEILGNRGDLGLDIITVIKKYALPEEFPPQVLAFAEEISEEIQESEIKRRTDLRDVKMVTIDGEDAKDLDDAVSIERLPNGNYKLGVHIADVTHYVKENNPLDKEAFKRATSVYLVDRVIPMLPKKLSNGICSLNPQVDRLALTCFMEIDHKGNVVNHSIHESVIKTNERMTYTDVTKILRDNDQELIERYKDLVDDFKAMEELCKILNKRRMGRGAIDFEFAESKIILDEKGKPIDIKPYERAIANRIIEEFMLVCNETIAEYMNKAEIPFVYRIHEEPDNEKLQRFKNFAYSLGYSFNFGELIEPRDLQKVVEEVKGKNEEMVINTLLLRSMMQARYSPDCAGHFGLAAEYYCHFTSPIRRYPDLQIHRIIKEYINKKIDPKRAKRLLSIVDSASKQSSEMERIAQEAERETNDLKKAEYMKDRIGEIFDGIISSVTGFGAFVELPNTVEGLVHVASFRDDYYIYDEENLQLIGERTKKVYKLGEKVKVLCSRVEMDTREVYFEIVEDKYTIEEKEAETEKRENLLDEVKKELEAEGKVEIIEPREETAEEEL
>NZ_CP025501.1|WP_003477916.1|2376083_2376314_-|preprotein-translocase-subunit-SecG
MNTILVVVQTILAIVILVSIMMQPSKADALSGLIQGSQDSFFSRNKGRTREARLIKVTIFASVLFAINTLAINLVK
>NZ_CP025501.1|WP_003460343.1|2376503_2377061_-|tryptophan-transporter
MNVRNNTKLITINSLLLAIGVILHQITPVLGLPMQPDFALTMLFIIIILNDNFKITMVSGTLMGIFTAMTTKFPGGQLPNVVDKIFTALIVFLFIALIKKSNILGRLSVEKRNNILMAIVLPLGTLVSGILFLGTAKIIVGLPASFSILFLTVVVPSVALNTVIGLVLYRIVEKSLRRASYSIRG
>NZ_CP025501.1|WP_003460354.1|2378245_2379541_-|phosphopyruvate-hydratase
MKQYIEIIDVVARQILDSRCFPTVEVEVYLEDGTVGRAAVPSGASTGIYEAVELRDGDKDKYLGKGVEKAVANVNDTIAEEIIGLNVLDQAYIDKTLIELDGTKNKGKLGANAILGVSLAVAQAAANYLGMPLYQYIGGVNAKVLPVPMMNIINGGSHADNSVDIQEFMIMPVGFDCFERAVRACAEVYHALKKTLNSKGYSTGVGDEGGFAPNLKSNAEAIEVILEAIEKAGYEPGKEFFIAIDAASSEYYKDGKYVLEHEGKTLTAAEMVDFFEDWVNKYPIISIEDGMAEEDWEGWKLMTERLGKKVQLVGDDLFVTNTERLKTGIEKGIANSILIKLNQIGTLTETLNAIEMANRAGYTAVVSHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLIRINEELGEVAEYRGRNAFFNLSK
>NZ_CP025501.1|WP_003460335.1|2380247_2381705_-|glutamate:gamma-aminobutyrate-antiporter
MKQEGTTKKSLTLFGFFAMTASMVMAVYEYPTFATSKLHLVFYLLLGGFLWFIPVALCAAEMATVDGWEKGGVFTWTGKNLGKKYGFANLFFEFFEITVGFVTMIYFILGALSYVFDWPALNSNPMIKFIGVLVIFWILALSQFGGTKYTAKIAKIGFIVGILLPAAILIILALVYIIQGNPIYISSKDTFVPDFTKVNTLVVFVSFILSYMGVEASATHANEMDNPKKEYPLAMLLLVIVAIVVSTLGGLAIAAVIPQDQINLSAGVVQTFAVLLGHFTANNTILVKIIALLLAFGVIAEVSSWVVGPTRGMIIAAEEGAIPKSWAKTNEHDVPVYLVIAQGIIVSIWDAVLTFGAGGSNLSFLAAMSLTVVIYLSGYILFFVGYIKAILGEGLNGAYQMPGGKPVKIIVAIIGLATSIFAFFISFVPPTSIAGNAVQSHEYMWMLIISYVISLILPFAIYDLCQKYMHSHEGNIHHIVAGHKH
>NZ_CP025501.1|WP_003460356.1|2382278_2383817_-|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MSKKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIKEGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVLGEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVARIKDGDSVIFFNFRPDRAREITRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVAAKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLDQDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWISKDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEMTGTCLLNK
>NZ_CP025501.1|WP_003450470.1|2383941_2384688_-|triose-phosphate-isomerase
MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVNY
>NZ_CP025501.1|WP_003450483.1|2384931_2386125_-|phosphoglycerate-kinase
MNFNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAKPEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGEELSKELASLAEMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVINNLLEKVDTLIIGGGMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDVEAVVTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTIIGGGDSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK
>NZ_CP025501.1|WP_003460339.1|2386268_2387267_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MVKVAINGFGRIGRLALRLMIDNPEFEVVAINDLTDAKTLAHLFKYDSAQGRFNGEIEVKEGAFVVNGKEIKVTAKSNPAELPWGELGVDVVLECTGFFASKEKASAHLTAGAKKVVISAPAGNDLPTVVYNVNHDILDGSEDVISGASCTTNCLAPMAKALNDNFGLNKGFMTTIHAYTNDQNTLDAPHKKGDLRRARAAAANIVPNSTGAAKAIGLVIPELAGKLDGNAQRVPVITGSLTELVCTLDKKVTVEEVNAAMKAASNESFGYTEDPIVSSDVIGISFGSLFDATQTKIMEVDGQQLVKVASWYDNEASYTNQLIRTLKCLVSK
>NZ_CP025501.1|WP_003450474.1|2387357_2388392_-|sugar-binding-domain-protein
MLEILKLQKIIVPEMVELLVKRYNIIRTIYYNQPIGRRALANNLNLGERIVRTEIGFLKSQNLIQINTPGMSVTQEGEFMLESLKGFIHEIKGLSNLEKQLCDMLHVRNVIVVPGDCSEDENTIKELGKAAANYSKNIIKDGYTIAVTGGSTVKEVIDELPEMANLKNVLVVPARGGMGKKVETQSNTLAANLAKKLNGTYKMLHVPDNISKEVMDALMKQEDMKELIQNIKNADMLIYGIGQAKKMANKRGVPKDQIIKLLDLGAIGEAFGCYFNDKSEVVYVMPTLGVTINDLRKIKNHIAVAGGKNKAEAILTTVYGNENAVLITDEGAANEILNFLNRDE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP025501_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP025501_4

2984289-2984401

Orphan

Consensus_repeat	Method
TTCTATTTAAATCTATTACTTTACATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP025501_4

>merge|NZ_CP025501|4|2984289-2984401|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAAGAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGGAGACCTCTTCTTCTCTTCTATTTAAATTTATTACTTTACATAA

>NZ_CP025501|4|4|2984289-2984401|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAA	GAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGGAGACCTCTTCTTCTC
TTCTATTTAAATTTATTACTTTACATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP025501.1\|WP_003451410.1\|2978614_2979004_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NZ_CP025501.1\|WP_003468964.1\|2988779_2989799_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224376
NZ_CP025501.1\|WP_003451536.1\|2979088_2979586_-\|stage-III-sporulation-protein-AH	unknown	unknown	gnl\|CDD\|378918
NZ_CP025501.1\|WP_003451336.1\|2979611_2980217_-\|stage-III-sporulation-protein-AG	unknown	unknown	gnl\|CDD\|274319
NZ_CP025501.1\|WP_003468962.1\|2987004_2987355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003451464.1\|2984470_2984833_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003468999.1\|2985674_2986022_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003451671.1\|2982453_2982651_-\|stage-III-sporulation-protein-AC	unknown	unknown	gnl\|CDD\|131895
NZ_CP025501.1\|WP_003468981.1\|2980231_2980789_-\|stage-III-sporulation-protein-AF	unknown	unknown	gnl\|CDD\|131942
NZ_CP025501.1\|WP_003458670.1\|2982726_2983242_-\|stage-III-sporulation-protein-SpoAB	unknown	unknown	gnl\|CDD\|131880
NZ_CP025501.1\|WP_003451501.1\|2988358_2988787_-\|type-IV-pilin	unknown	unknown	gnl\|CDD\|236714
NZ_CP025501.1\|WP_003468989.1\|2987401_2987692_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003451406.1\|2981979_2982366_-\|stage-III-sporulation-protein-AD	unknown	unknown	gnl\|CDD\|131896
NZ_CP025501.1\|WP_049039555.1\|2983388_2984273_-\|stage-III-sporulation-protein-AA	unknown	unknown	gnl\|CDD\|274324
NZ_CP025501.1\|WP_003451649.1\|2984946_2985504_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NZ_CP025501.1\|WP_003458684.1\|2980796_2981969_-\|stage-III-sporulation-protein-AE	unknown	unknown	gnl\|CDD\|213743
NZ_CP025501.1\|WP_003451187.1\|2978088_2978496_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP025501.1\|WP_042262400.1\|2986018_2986459_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003469001.1\|2986418_2987030_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP025501.1\|WP_003468957.1\|2987826_2988339_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076

Protein	Function_ID	Function_description	E-value
NZ_CP025501.1\|WP_003451410.1\|2978614_2979004_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	5.69298e-30
NZ_CP025501.1\|WP_003468964.1\|2988779_2989799_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224376	COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion].	3.16251e-51
NZ_CP025501.1\|WP_003451536.1\|2979088_2979586_-\|stage-III-sporulation-protein-AH	gnl\|CDD\|378918	pfam12685, SpoIIIAH, SpoIIIAH-like protein. Stage III sporulation protein AH (SpoIIIAH) is a protein that is involved in forespore engulfment. It forms a channel with SpoIIIAH that is open on the forespore end and closed (or gated) on the mother cell end. This allows sigma-E-directed gene expression in the mother-cell compartment of the sporangium to trigger the activation of sigma-G forespore-specific gene expression by a pathway of intercellular signaling. This family of proteins is found in bacteria, archaea and eukaryotes and so must have a wider function that in sporulation. Proteins in this family are typically between 174 and 223 amino acids in length.	3.45938e-23
NZ_CP025501.1\|WP_003451336.1\|2979611_2980217_-\|stage-III-sporulation-protein-AG	gnl\|CDD\|274319	TIGR02830, Stage_III_sporulation_protein_AG, stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG. [Cellular processes, Sporulation and germination].	2.26928e-69
NZ_CP025501.1\|WP_003468957.1\|2987826_2988339_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	0.000955242
NZ_CP025501.1\|WP_003451671.1\|2982453_2982651_-\|stage-III-sporulation-protein-AC	gnl\|CDD\|131895	TIGR02848, Stage_III_sporulation_protein_AC, stage III sporulation protein AC. Members of this protein family are designated SpoIIIAC, part of the spoIIIA operon of sporulation genes whose mutant phenotype is linked to sporulation stage III. Members of this family are encoded by the genome of a species if and only if that species is capable of endospore formation, as in Bacillus subtilis. The molecular function of this small, probable integral membrane protein is unknown. [Cellular processes, Sporulation and germination].	1.97477e-14
NZ_CP025501.1\|WP_003468981.1\|2980231_2980789_-\|stage-III-sporulation-protein-AF	gnl\|CDD\|131942	TIGR02896, Stage_III_sporulation_protein_AF, stage III sporulation protein AF. This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment. [Cellular processes, Sporulation and germination].	1.64506e-24
NZ_CP025501.1\|WP_003458670.1\|2982726_2983242_-\|stage-III-sporulation-protein-SpoAB	gnl\|CDD\|131880	TIGR02833, Stage_III_sporulation_protein_AB, stage III sporulation protein AB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB. [Cellular processes, Sporulation and germination].	1.85407e-76
NZ_CP025501.1\|WP_003451406.1\|2981979_2982366_-\|stage-III-sporulation-protein-AD	gnl\|CDD\|131896	TIGR02849, Stage_III_sporulation_protein_AD, stage III sporulation protein AD. Members of this family are the uncharacterized protein SpoIIIAD, part of the spoIIIA operon that acts at sporulation stage III as part of a cascade of events leading to endospore formation. Note that the start sites of members of this family as annotated tend to be variable; quite a few members have apparent homologous protein-coding regions continuing upstream of the first available start codon. The length of the alignment and the scoring cutoff thresholds for the model have been set to try to detect all valid members of the family, even if annotation of the start site begins too far downstream. [Cellular processes, Sporulation and germination].	5.58273e-33
NZ_CP025501.1\|WP_049039555.1\|2983388_2984273_-\|stage-III-sporulation-protein-AA	gnl\|CDD\|274324	TIGR02858, Stage_III_sporulation_protein_AA, stage III sporulation protein AA. Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation. [Cellular processes, Sporulation and germination].	4.84306e-161
NZ_CP025501.1\|WP_003451649.1\|2984946_2985504_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	2.22205e-107
NZ_CP025501.1\|WP_003458684.1\|2980796_2981969_-\|stage-III-sporulation-protein-AE	gnl\|CDD\|213743	TIGR02829, Stage_III_sporulation_protein_AE, stage III sporulation protein AE. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AE. [Cellular processes, Sporulation and germination].	3.04994e-149
NZ_CP025501.1\|WP_003451187.1\|2978088_2978496_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	2.5545e-50
NZ_CP025501.1\|WP_003451501.1\|2988358_2988787_-\|type-IV-pilin	gnl\|CDD\|236714	PRK10557, PRK10557, prepilin peptidase-dependent protein.	0.0024359

>NZ_CP025501.1|WP_049039555.1|2983388_2984273_-|stage-III-sporulation-protein-AA
MKEIFAVLPDKINSCLKDKSNLNKLQEIRVKVGKPLNIVLDNTETIFNYVIRIEDVKAIIQKISNYSLYAFEEDIRQGYITIQGGHRVGLAGQCVIEDNSIKTIRNITSLNIRVCREIVGCSNSLMNSLVENNRVNNTLIISPPKCGKTTLLRDITRNISNGISQIGFKGKRTVVIDERSEIAACYNGIPQMNVGMRTDVYDNCIKSEGMMMAVRGLSPEVIICDEIGTYKDMEGLMMAYNSGVSIIATLHGRNVEELYRRPVFREIVENNIINKVVVLSGKKGIGTIEGIYNV
>NZ_CP025501.1|WP_003458670.1|2982726_2983242_-|stage-III-sporulation-protein-SpoAB
MKVFFLLIIVLLSSLIGYLYGEGFRNRLSQLRELKRALIDFENDIVYTYTPLPESIESIALKAKSPIKELFNEISFKLKNNEVENVYMAFKESINEHKKEMNLRNKDFEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYLGVAVGAMIAIFLV
>NZ_CP025501.1|WP_003451671.1|2982453_2982651_-|stage-III-sporulation-protein-AC
MSDLSLIFQIAGVGIVLVILDKVLDQSGKKEYATLANIVGVVIILTMMIQLISRLFSSVKSMFLF
>NZ_CP025501.1|WP_003451406.1|2981979_2982366_-|stage-III-sporulation-protein-AD
MDVVIQVISFVLISLFLYLVLKDNKSTFAVFLLLGAGIVIFLFVMPYVNEIIAFMQDIARESGMDSSYIAIVMKIIAIAYLSTFCSYICNDAGVTVLGKKVEFTGKIMILLLAIPIMANILNSILSIM
>NZ_CP025501.1|WP_003458684.1|2980796_2981969_-|stage-III-sporulation-protein-AE
MKKLINIILLSLIFVFCFNLKVLANDNLESSKEKIDNDSRIERFYDYINNLETEEDILGNMSAKEYIMNYLESGEDPITLKKIGASILSYIFRELNIVLKFIASILVIALLSALLKNLQDAFNIEEGVTQIAFFACYALLIMLLTKSFFISLNLGKEVLTSIIDFMNVIVPVIVMLIATSGGVTSAVTIDPIVLGAVSITPRIYTYFLFPLILAYFTLQFVNNLSSEFKIDRMCKFIKQVVMISQGFILTIFVGILTLRGMTADTLDAVAVKTVKFAVDNFVPIVGKAFSDAITTVAGYSLAMKSVITSLGVIVIVVIVIYPIIKIGLMAICFKLTSAVIEPVVDSKISSSVETVGEALFMIMSCIISVSIMFFIMASMMATAGNFIVGG
>NZ_CP025501.1|WP_003468981.1|2980231_2980789_-|stage-III-sporulation-protein-AF
MELLKNWISTLCVVIVIISIAHIILPNSSIKKHVKFAFSLIILSVMLSPIIGLLTMNKDIDETVFQEKISDVTRSDEEKKSLYDEEAILKSVEKNLEKSLKDEFYENEFEVNLIGKIDFDEVKFNIEKAEITVLDEKKVKKVDKVVVGKEKVNKEEKKDSFLEKIEKFVEKELEISHENIIVSYA
>NZ_CP025501.1|WP_003451336.1|2979611_2980217_-|stage-III-sporulation-protein-AG
MHELKEKIANLFKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDSEVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGTRVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLYNISVDKVNVLAMKK
>NZ_CP025501.1|WP_003451536.1|2979088_2979586_-|stage-III-sporulation-protein-AH
MNRKQAGIILTLLALIVCTGVLATRVNNQIKESMGEVPTAFGENDDNATETSSNYFYESRNLREQKDSKTIDNLKAIVEDKNTSAEQKEEAEKELTEKTMARDYETRIELSIKSKGYEDVICFIDGDNAKVVVKTNEELTQEKMVEIQDIVMNVSKVYDVDIEKK
>NZ_CP025501.1|WP_003451410.1|2978614_2979004_-|Asp23/Gls24-family-envelope-stress-response-protein
MNEMNRDEANLGIVNISDEVIGVVAGIAASEIDGILEINHNNSTGIGHKFSKKSLGKGIKVNVENGEAVIEIGVTVQYGIKIPDVVSQVQENVRRTVEAITGLKVALVNIYVQNIIILKEEDKNEILKK
>NZ_CP025501.1|WP_003451187.1|2978088_2978496_-|transcription-antitermination-factor-NusB
MNRVKSREYLLQLAYQMEITSETALETFNSFMENEDISKDDLDLAYIKSGLLGIEENKEKLDSLIESQLVKWKLNRISKVNLSILRISTYEILFAEDVPGKVSINEAIELCKKYSDNKSVSFINGVLDKVYKNMQ
>NZ_CP025501.1|WP_003451464.1|2984470_2984833_-|hypothetical-protein
MKDIKNNISNLLKAMDKNTELDKEFKDSLLNVISSLVDKVEELQVNVETLDENVNLLNDDLSGVQDELFEELTLEELEEYDDEYCEVVCDKCHKPIYIEKDILNRSESIPCPYCGNEFEV
>NZ_CP025501.1|WP_003451649.1|2984946_2985504_-|elongation-factor-P
MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEMQYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSVKGNTATTAMKTAVVETGATVMVPMFVEEGNTIRIDTRTGEYMERV
>NZ_CP025501.1|WP_003468999.1|2985674_2986022_-|hypothetical-protein
MKKLRLDVTLATIFIVILLVQGIELFKLRNYEIPVLTNSIGEMDLNTVLKNIENKDCTVLQLEYKEGWIGKVLFTGSLEDLSNYVNLLKNNNINIKNYKIEKSEELRCFLELKVV
>NZ_CP025501.1|WP_042262400.1|2986018_2986459_-|hypothetical-protein
MRLEVRRIYIKKYKNFLPIEYVEEYNRKIKKKLNIYILLLLLFNLFFYGKIKTENNKIKNYLSEIRGVNRERSLDKEFLEDINKLKEIIKDEKILNLSLERKSFEVEVNSIYKNSLINYINKINGRVYDISLNESNNTYRLKGELR
>NZ_CP025501.1|WP_003469001.1|2986418_2987030_-|hypothetical-protein
MLIKTLVINDTNDISKLKELKDKRVKIILLNEKIFIETLRVDKKCNIEEKIEQLIRDRFFNYTPLVHYEVLKYNKSLFLIVYFIGCDERFKSLLYERKDFSLTFPELKNKNILSFNKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKDFTFKIQKEYLKEEIKEWFKGLKLNEIRGEENLYQKI
>NZ_CP025501.1|WP_003468962.1|2987004_2987355_-|hypothetical-protein
MIVTILMDNSFQRRKELDRSFKITCNNIDKNNSEEQFLKYMLKEKILNKDTFQELKFSLNNMKAEYSKKARILNIKNKDKISGLSRDTYYEIKVINDDIILSKRGNYEFVNKDLSN
>NZ_CP025501.1|WP_003468989.1|2987401_2987692_-|hypothetical-protein
MYLNHRFWDNMVEYIKINKEKNYIVVKFWRKGIVEENKIEKKEDKLHVYYISSGENRNHILIENVEEFDLVEKKNLFYIKLKVKNQEERIYCYEKA
>NZ_CP025501.1|WP_003468957.1|2987826_2988339_-|type-II-secretion-system-protein
MEGKINKKKGYLLVDMVLALALISILFLGIGKSYSTYIKNNYYIKEKIKVAEIINSLAMELKHNISFEDLRSINSGTYKISTLKINDLINSDIKEFLRKNLILHNKNHNDLGWTINISHFDQYESIINIIYKNEKPYISENKEVKIYKFLEKSSQNLENQLQKEEEKHIY
>NZ_CP025501.1|WP_003451501.1|2988358_2988787_-|type-IV-pilin
MYRKRKGFTLSEVIIYLAITSLILAIPTSFMIIKDRGYELKVEGEISKIHDFLMEAKQLSKKDNLYGEIIFDILDNKLIYENAIRTTSLKLNGVKVSFNRDNLITINETGMISIAGTITIIDKNNKQREITIVPGIWKINVK
>NZ_CP025501.1|WP_003468964.1|2988779_2989799_-|type-II-secretion-system-F-family-protein
MFGFKDEASYICLNLSTYVKSGMPIGRSLDLIKNTVKDKKYKESLKRIEKKVLNGEALSKAFKEEGNLYPDLMKDMMKIGEESGNLEEVLEKCARNILAEKEIKNKIIKSLRYPVSLLIGLIIMIFGYVTYILPQFVDMYELREIEGSKIMTLLNNYINFVEENPNVEVIVFCYFSCALISLYLLFKVIPSEKILEKIEVYRMYYEIRILFLINMILNSGISLNNSLSVFGESLSDVKLRKYIKSINEELIKGTTLSSSIGKINVISHVSKGFLITGEESGLFSKNIEELLKIREKDFDRALNKTVGKIEPAMFIILGFVISAMMLLVLVPTFEGMKYV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

234466 : 341721

102

Clostridium_phage(59.09%)

integrase,capsid,tail,holin,tRNA,head,terminase,plate,protease,portal

attL 255117:255135|attR 341457:341475

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025648643.1\|234466_235864_-\|tRNA	cysteine--tRNA ligase	A0A0U2SJ70	Niemeyer_virus	5.9e-57	30.2
WP_003459370.1\|235971_237684_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003459324.1\|238037_238715_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_003459365.1\|238728_239835_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003459340.1\|240146_240548_+	hypothetical protein	NA	NA	NA	NA
WP_003452233.1\|240581_241646_-	DNA integrity scanning protein DisA	NA	NA	NA	NA
WP_003479244.1\|241665_243027_-	DNA repair protein RadA	NA	NA	NA	NA
WP_011591132.1\|243277_244006_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_003469605.1\|244002_244725_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003452255.1\|245182_245410_+	glutaredoxin family protein	A0A292GID4	Xanthomonas_phage	1.4e-05	40.6
WP_003459369.1\|245531_246980_-	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003452243.1\|246996_247230_-	glutaredoxin family protein	NA	NA	NA	NA
WP_110083452.1\|247232_248171_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	6.1e-58	39.3
WP_003459331.1\|248447_250892_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2C9CYX3	Yersinia_phage	1.5e-124	39.8
WP_110035061.1\|250916_251930_-	protein arginine kinase	NA	NA	NA	NA
WP_003482390.1\|251913_252441_-	hypothetical protein	NA	NA	NA	NA
WP_003452250.1\|252460_252916_-	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_003482391.1\|253132_253786_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_110083451.1\|253836_255519_-	ligase	NA	NA	NA	NA
255117:255135	attL	NA	NA	NA	NA
WP_003452217.1\|255635_255806_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_003452261.1\|255974_256880_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_011591135.1\|256882_257806_-	DNA polymerase III subunit delta'	NA	NA	NA	NA
WP_003459310.1\|257827_258157_-	hypothetical protein	NA	NA	NA	NA
WP_003459338.1\|258485_259076_-	guanylate kinase	A0A0K2FM14	Brevibacillus_phage	6.4e-21	34.9
WP_049039912.1\|259321_260752_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_003452260.1\|260769_260946_-	carnitine-CoA ligase	NA	NA	NA	NA
WP_049039907.1\|261101_262271_+	amidohydrolase	NA	NA	NA	NA
WP_003459375.1\|262299_262797_-	hypothetical protein	NA	NA	NA	NA
WP_003459363.1\|263071_264016_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_049039901.1\|264107_264989_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_003470204.1\|272318_273695_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_049039360.1\|274005_275049_+	[FeFe] hydrogenase H-cluster radical SAM maturase HydE	NA	NA	NA	NA
WP_057232181.1\|275290_276532_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_078209983.1\|276624_277494_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_110439802.1\|278685_279132_-	hypothetical protein	I2E8X1	Clostridium_phage	1.5e-51	83.1
WP_110439803.1\|279331_279718_+	hypothetical protein	Q0SPG9	Clostridium_phage	2.6e-15	80.0
WP_110439804.1\|279763_280771_-	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	3.8e-74	47.2
WP_003465517.1\|280863_281115_-\|holin	holin	A0A2H4J047	uncultured_Caudovirales_phage	2.5e-19	60.2
WP_110439805.1\|281114_281432_-	hypothetical protein	A0A2H4J1Q4	uncultured_Caudovirales_phage	5.8e-13	47.8
WP_110439806.1\|281510_281747_-	hypothetical protein	NA	NA	NA	NA
WP_110439807.1\|281763_284025_-\|plate	BppU family phage baseplate upper protein	I2E8W5	Clostridium_phage	6.0e-128	42.4
WP_110439915.1\|284040_285915_-	MBL fold metallo-hydrolase	I2E8W4	Clostridium_phage	1.9e-268	80.8
WP_110439808.1\|285971_288983_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	0.0e+00	61.8
WP_110439809.1\|288983_289691_-\|tail	phage tail protein	Q8SBP0	Clostridium_phage	3.8e-105	77.9
WP_110439810.1\|289684_292480_-\|tail	phage tail tape measure protein	Q8SBP1	Clostridium_phage	1.3e-116	61.9
WP_110439811.1\|292522_292819_-	hypothetical protein	NA	NA	NA	NA
WP_075810699.1\|293028_293343_-	hypothetical protein	Q8SBP2	Clostridium_phage	7.3e-32	66.3
WP_110439812.1\|293362_293971_-\|tail	phage tail protein	Q8SBP3	Clostridium_phage	1.1e-92	85.9
WP_110439813.1\|293990_294341_-	hypothetical protein	Q8SBP4	Clostridium_phage	1.5e-38	67.6
WP_110439814.1\|294342_294792_-	HK97 gp10 family phage protein	Q8SBP5	Clostridium_phage	1.0e-63	76.5
WP_057231834.1\|294792_295122_-\|head	phage head closure protein	I2E8V6	Clostridium_phage	2.0e-48	87.2
WP_011590784.1\|295114_295393_-\|head,tail	phage gp6-like head-tail connector protein	Q8SBP7	Clostridium_phage	6.2e-27	61.5
WP_110439815.1\|295404_296589_-\|capsid	phage major capsid protein	Q8SBP8	Clostridium_phage	9.8e-146	79.0
WP_057231838.1\|296629_297274_-\|head,protease	HK97 family phage prohead protease	Q8SBP9	Clostridium_phage	1.2e-97	87.6
WP_110439816.1\|297390_298638_-\|portal	phage portal protein	Q8SBQ1	Clostridium_phage	1.6e-210	85.3
WP_110439916.1\|298638_300378_-\|terminase	terminase large subunit	Q8SBQ2	Clostridium_phage	4.6e-309	86.2
WP_081378905.1\|300370_300883_-\|terminase	phage terminase small subunit P27 family	Q8SBQ3	Clostridium_phage	5.4e-77	88.6
WP_110439817.1\|300973_301396_-	HNH endonuclease	Q8SBK4	Clostridium_phage	2.0e-64	82.1
WP_134854798.1\|301388_301574_-	hypothetical protein	NA	NA	NA	NA
WP_110439819.1\|301564_301729_-	transmembrane Fragile-X-F protein	A0A2H4PB38	Lactobacillus_phage	7.7e-09	55.6
WP_110439820.1\|301895_302444_-\|integrase	site-specific integrase	Q8SBK8	Clostridium_phage	2.3e-73	75.1
WP_153302721.1\|302489_302657_-	hypothetical protein	NA	NA	NA	NA
WP_110439821.1\|303112_303661_-	transcriptional regulator	A0A0A7RUC3	Clostridium_phage	8.9e-17	36.1
WP_110439822.1\|303688_305623_-	hypothetical protein	A0A142F1B5	Bacillus_phage	1.2e-15	26.3
WP_110439823.1\|305636_306038_-	hypothetical protein	NA	NA	NA	NA
WP_110439824.1\|306062_306395_-	hypothetical protein	NA	NA	NA	NA
WP_110439826.1\|306926_307322_-	RusA family crossover junction endodeoxyribonuclease	A0A2K9V3I2	Faecalibacterium_phage	2.0e-18	43.3
WP_110439827.1\|307325_307508_-	hypothetical protein	A0A0A7S0P6	Clostridium_phage	4.8e-12	58.2
WP_003449198.1\|307501_307675_-	hypothetical protein	NA	NA	NA	NA
WP_110439828.1\|307695_308487_-	helix-turn-helix domain-containing protein	F0PIG9	Enterococcus_phage	1.1e-20	51.0
WP_161553626.1\|308538_308697_-	hypothetical protein	NA	NA	NA	NA
WP_110439829.1\|309066_309273_+	hypothetical protein	NA	NA	NA	NA
WP_110439830.1\|309262_309481_-	hypothetical protein	M9Q1J2	Clostridium_phage	1.1e-13	68.9
WP_110439831.1\|309494_309674_-	hypothetical protein	M9Q2G4	Clostridium_phage	2.6e-18	79.7
WP_110439832.1\|309667_309850_-	hypothetical protein	NA	NA	NA	NA
WP_110439917.1\|309896_310667_-	hypothetical protein	A0A075KJT3	Lactobacillus_phage	3.2e-20	36.3
WP_110083872.1\|310739_310931_-	hypothetical protein	NA	NA	NA	NA
WP_110083873.1\|311144_311522_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_110083874.1\|311868_312072_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_110083875.1\|312091_313558_+	recombinase family protein	A0A1L2BY67	Clostridium_phage	1.1e-50	33.5
WP_003450306.1\|314026_315430_-\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	2.8e-51	29.7
WP_057232183.1\|316117_317623_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	3.8e-94	40.0
WP_003450338.1\|317648_318125_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_003459360.1\|318403_319384_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003450343.1\|319390_320170_-	type III pantothenate kinase	NA	NA	NA	NA
WP_003459368.1\|320372_322043_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_110439833.1\|322244_324050_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	C7U047	Ostreococcus_tauri_virus	6.3e-112	44.5
WP_003459345.1\|324124_324676_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	2.9e-15	36.8
WP_049040127.1\|324678_326088_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_049040128.1\|326304_328695_-	stage II sporulation protein E	NA	NA	NA	NA
WP_003450336.1\|330000_330405_-	RNA-binding protein S1	NA	NA	NA	NA
WP_057232185.1\|330464_330785_-	septum formation initiator family protein	NA	NA	NA	NA
WP_003467923.1\|330880_331255_-	spore cortex biosynthesis protein YabQ	NA	NA	NA	NA
WP_003479288.1\|331264_331564_-	sporulation protein YabP	NA	NA	NA	NA
WP_003450572.1\|331694_331955_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_003450698.1\|332062_332338_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	5.2e-18	51.7
WP_057232187.1\|332554_334006_-	nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_003467866.1\|334035_335568_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_003472465.1\|335747_336296_-	stage V sporulation protein T	A0A2I7SC16	Paenibacillus_phage	1.6e-10	68.6
WP_003479293.1\|336488_337517_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_057232190.1\|337617_341124_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_003450588.1\|341154_341721_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
341457:341475	attR	NA	NA	NA	NA

DBSCAN-SWA_2

982312 : 1081161

Clostridium_phage(58.97%)

integrase,capsid,tail,holin,head,terminase,protease,portal,coat

attL 978828:978846|attR 1053909:1053927

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
978828:978846	attL	NA	NA	NA	NA
WP_003458048.1\|982312_982684_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_003458068.1\|982758_983430_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_057230502.1\|984374_987194_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.1
WP_003473867.1\|987528_987963_+	FHA domain-containing protein	NA	NA	NA	NA
WP_003457997.1\|987976_989206_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_003452191.1\|989206_990670_+	penicillin-binding protein	NA	NA	NA	NA
WP_057230504.1\|990826_992689_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_003457971.1\|992837_993752_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_003457961.1\|993990_994875_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.0e-10	28.5
WP_110083355.1\|994871_996218_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.5e-46	34.4
WP_003457993.1\|996220_997171_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.0e-44	34.6
WP_110083354.1\|997344_997899_+	hypothetical protein	NA	NA	NA	NA
WP_003479012.1\|999289_999826_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003457972.1\|1000293_1001544_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	8.6e-84	39.9
WP_004457554.1\|1001748_1002528_+	hypothetical protein	A0A0E3XA08	Staphylococcus_phage	9.7e-09	28.2
WP_003455617.1\|1005682_1006642_+	6-phosphofructokinase	NA	NA	NA	NA
WP_011590151.1\|1006735_1008139_+	pyruvate kinase	NA	NA	NA	NA
WP_003479007.1\|1008718_1009075_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_011590152.1\|1009383_1010181_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_057230510.1\|1010352_1011888_+	cardiolipin synthase	NA	NA	NA	NA
WP_003479004.1\|1012094_1012253_-	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_057230512.1\|1012519_1014082_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_110003725.1\|1014209_1015577_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	7.7e-110	44.1
WP_110003724.1\|1015642_1016785_-\|integrase	site-specific integrase	A0A0A8WIE1	Clostridium_phage	6.0e-124	58.8
WP_110003723.1\|1016858_1017299_-	ImmA/IrrE family metallo-endopeptidase	M9Q1J0	Clostridium_phage	4.9e-66	84.4
WP_110003722.1\|1017401_1017827_-	helix-turn-helix transcriptional regulator	M9Q2L3	Clostridium_phage	7.5e-40	66.9
WP_110003721.1\|1018023_1018218_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_110003720.1\|1018220_1018997_+	phage antirepressor KilAC domain-containing protein	A0A2H4PQV4	Staphylococcus_phage	4.3e-65	48.1
WP_057230526.1\|1019008_1019206_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_057230529.1\|1019217_1019397_+	hypothetical protein	M9Q2G4	Clostridium_phage	1.2e-18	84.7
WP_110003719.1\|1019410_1019656_+	hypothetical protein	M9Q1J2	Clostridium_phage	4.2e-19	89.3
WP_057230533.1\|1019618_1019852_-	hypothetical protein	NA	NA	NA	NA
WP_110003718.1\|1020771_1021593_+	hypothetical protein	M9Q2G6	Clostridium_phage	2.9e-128	85.7
WP_110003717.1\|1021564_1022302_+	ATP-binding protein	M9Q1J4	Clostridium_phage	5.0e-140	99.2
WP_110439859.1\|1022694_1023627_+	DNA cytosine methyltransferase	H7BVD3	unidentified_phage	3.4e-101	60.2
WP_043013175.1\|1023651_1023900_+	hypothetical protein	NA	NA	NA	NA
WP_110003715.1\|1023912_1024149_+	hypothetical protein	Q8SBL4	Clostridium_phage	3.1e-27	83.1
WP_003465269.1\|1024176_1024452_+	winged helix-turn-helix transcriptional regulator	M9Q2I9	Clostridium_phage	4.7e-43	100.0
WP_110003714.1\|1024460_1024763_+	stage III sporulation protein D	M9Q261	Clostridium_phage	1.2e-44	94.0
WP_003478983.1\|1024767_1025094_+	hypothetical protein	M9Q2G8	Clostridium_phage	8.6e-52	100.0
WP_003465272.1\|1026191_1026851_+\|integrase	tyrosine-type recombinase/integrase	M9Q2H0	Clostridium_phage	1.2e-121	100.0
WP_110003713.1\|1027108_1027591_+	Xaa-His dipeptidase	NA	NA	NA	NA
WP_110003712.1\|1027587_1028019_+	hypothetical protein	NA	NA	NA	NA
WP_110003711.1\|1028118_1028592_+\|terminase	phage terminase small subunit P27 family	A0A0A7RUQ4	Clostridium_phage	1.8e-26	47.7
WP_110003710.1\|1028578_1030285_+\|terminase	terminase	U3PBG5	Lactobacillus_phage	5.0e-143	49.7
WP_003478976.1\|1030296_1030482_+	hypothetical protein	NA	NA	NA	NA
WP_110439860.1\|1030497_1031763_+\|portal	phage portal protein	A0A0A7RUE7	Clostridium_phage	2.5e-86	42.6
WP_110439861.1\|1031755_1032493_+\|protease	Clp protease ClpP	A0A0A7RTN2	Clostridium_phage	2.0e-48	48.3
WP_110003707.1\|1032516_1033707_+\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	1.5e-48	36.2
WP_003478969.1\|1033731_1034001_+	hypothetical protein	NA	NA	NA	NA
WP_110003706.1\|1033997_1034333_+\|head	phage head closure protein	NA	NA	NA	NA
WP_110003705.1\|1034332_1034752_+	hypothetical protein	NA	NA	NA	NA
WP_110003704.1\|1034756_1035068_+	hypothetical protein	NA	NA	NA	NA
WP_110003703.1\|1035087_1035672_+\|tail	phage tail protein	NA	NA	NA	NA
WP_110003702.1\|1035718_1036042_+	hypothetical protein	NA	NA	NA	NA
WP_057230570.1\|1040472_1041123_+\|tail	phage tail protein	Q0SPL3	Clostridium_phage	2.2e-46	48.1
WP_057230573.1\|1041148_1041415_+	hypothetical protein	Q0SPL4	Clostridium_phage	3.2e-36	93.0
WP_057230575.1\|1041488_1041734_+	hypothetical protein	NA	NA	NA	NA
WP_110083252.1\|1041746_1049177_+	hypothetical protein	H7BVF2	unidentified_phage	4.1e-72	46.1
WP_003459702.1\|1049192_1049441_+	hypothetical protein	Q0SPG3	Clostridium_phage	3.5e-37	91.5
WP_003478944.1\|1049458_1049692_+	membrane protein	Q0SPG4	Clostridium_phage	9.8e-34	98.7
WP_057231083.1\|1049707_1049938_+	hypothetical protein	NA	NA	NA	NA
WP_057231085.1\|1050013_1050199_+	hypothetical protein	NA	NA	NA	NA
WP_057231094.1\|1050256_1051012_+	DNA adenine methylase	Q0SPG6	Clostridium_phage	2.1e-133	92.4
WP_057231087.1\|1051031_1052273_+	SH3 domain-containing protein	A0A1L6BY22	Clostridium_phage	2.5e-83	51.2
WP_057231089.1\|1052579_1053164_-	hypothetical protein	NA	NA	NA	NA
WP_057231091.1\|1053173_1053650_-	hypothetical protein	NA	NA	NA	NA
WP_057230584.1\|1054903_1055761_-	AraC family transcriptional regulator	NA	NA	NA	NA
1053909:1053927	attR	NA	NA	NA	NA
WP_110083352.1\|1055949_1057218_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003455606.1\|1057291_1058218_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_003455248.1\|1058234_1059062_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_057230588.1\|1059089_1061297_+	alpha-galactosidase	NA	NA	NA	NA
WP_057230590.1\|1061335_1063873_+	family 16 glycosylhydrolase	NA	NA	NA	NA
WP_003480077.1\|1064074_1064626_+	hypothetical protein	NA	NA	NA	NA
WP_003473767.1\|1064744_1065323_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_110083351.1\|1065672_1067466_+	oleate hydratase	NA	NA	NA	NA
WP_057230594.1\|1067856_1069590_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.3e-39	28.0
WP_003450049.1\|1069582_1071364_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.7e-57	31.1
WP_057230596.1\|1071444_1071843_-	rubrerythrin	NA	NA	NA	NA
WP_057230598.1\|1072108_1073137_+	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	2.0e-147	72.2
WP_057230600.1\|1073394_1073796_+\|holin	phage holin family protein	M9Q253	Clostridium_phage	1.8e-43	66.4
WP_057230604.1\|1074048_1074699_+	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_057230606.1\|1074711_1075758_+	anti-sigma factor domain-containing protein	NA	NA	NA	NA
WP_057230608.1\|1075896_1076595_+	polyphosphate polymerase domain-containing protein	NA	NA	NA	NA
WP_003473840.1\|1076627_1077308_+	DUF4956 domain-containing protein	NA	NA	NA	NA
WP_003478921.1\|1077486_1078038_+	recombinase family protein	A0JC18	Ralstonia_phage	9.5e-27	40.2
WP_057230609.1\|1078279_1078972_+	polyphosphate polymerase domain-containing protein	NA	NA	NA	NA
WP_057230611.1\|1078997_1079666_+	DUF4956 domain-containing protein	NA	NA	NA	NA
WP_003478918.1\|1079667_1081161_+\|coat	spore coat protein CotH	A0A2D1GD28	Mycobacterium_phage	8.3e-25	26.2

DBSCAN-SWA_3

1412422 : 1425012

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003457021.1\|1412422_1413073_+	aminotransferase	A0A1B1P8C0	Bacillus_phage	2.9e-14	31.1
WP_110083107.1\|1413577_1414888_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_003457110.1\|1415125_1418926_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	4.7e-32	24.9
WP_003453078.1\|1419236_1419716_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-28	47.4
WP_003456948.1\|1419715_1420423_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.8e-47	43.8
WP_011009969.1\|1420444_1421890_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.4e-56	33.0
WP_003468449.1\|1421890_1422892_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.7e-71	49.0
WP_003468450.1\|1422879_1423494_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-24	38.3
WP_110083108.1\|1423506_1425012_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-66	47.2

DBSCAN-SWA_4

2141469 : 2179890

Clostridium_phage(47.37%)

integrase,capsid,tail,head,tRNA,terminase,protease,portal,bacteriocin

attL 2141483:2141498|attR 2171565:2171580

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003449335.1\|2141469_2142813_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
2141483:2141498	attL	NA	NA	NA	NA
WP_003469975.1\|2144463_2146077_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_075841162.1\|2146233_2147250_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	2.5e-20	23.7
WP_110083235.1\|2147879_2148194_+	hypothetical protein	NA	NA	NA	NA
WP_057232782.1\|2148253_2148751_+	hypothetical protein	NA	NA	NA	NA
WP_153302716.1\|2148807_2148978_+	hypothetical protein	NA	NA	NA	NA
WP_057232784.1\|2148995_2149595_+	hypothetical protein	NA	NA	NA	NA
WP_153302717.1\|2150081_2150243_+	hypothetical protein	NA	NA	NA	NA
WP_075841165.1\|2150245_2150572_+	hypothetical protein	NA	NA	NA	NA
WP_075841166.1\|2150576_2151911_+	hypothetical protein	NA	NA	NA	NA
WP_075841167.1\|2151917_2152526_+	hypothetical protein	NA	NA	NA	NA
WP_075841168.1\|2152841_2153375_+	hypothetical protein	NA	NA	NA	NA
WP_057232701.1\|2153521_2154037_+	restriction endonuclease	Q331T5	Clostridium_botulinum_C_phage	1.9e-16	43.2
WP_110002989.1\|2154130_2154283_-	hypothetical protein	NA	NA	NA	NA
WP_057232703.1\|2154774_2155056_+	hypothetical protein	NA	NA	NA	NA
WP_071241080.1\|2155232_2155553_+	hypothetical protein	I2E8X0	Clostridium_phage	2.7e-18	54.6
WP_057232705.1\|2156124_2156334_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_057232707.1\|2156501_2159672_+	hypothetical protein	H7BV05	unidentified_phage	2.8e-14	23.4
WP_153302718.1\|2160040_2160208_+	hypothetical protein	NA	NA	NA	NA
WP_057232710.1\|2160250_2161537_+	hypothetical protein	A0A0H3UZN6	Geobacillus_virus	1.1e-28	29.2
WP_110083234.1\|2162183_2162804_-	hypothetical protein	NA	NA	NA	NA
WP_057232714.1\|2162990_2163209_+	hypothetical protein	NA	NA	NA	NA
WP_057232716.1\|2163227_2163521_+	hypothetical protein	NA	NA	NA	NA
WP_057232303.1\|2163999_2164527_+	hypothetical protein	X2KXT0	Enterococcus_phage	1.1e-35	45.7
WP_057232301.1\|2164557_2165265_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_110083233.1\|2165319_2165526_+	hypothetical protein	NA	NA	NA	NA
WP_057232723.1\|2165571_2165799_+	hypothetical protein	NA	NA	NA	NA
WP_057232725.1\|2165785_2166073_+	hypothetical protein	NA	NA	NA	NA
WP_057232728.1\|2166073_2166373_+	hypothetical protein	NA	NA	NA	NA
WP_057232730.1\|2166422_2166881_+	hypothetical protein	A0A0A7RUV1	Clostridium_phage	1.4e-15	39.0
WP_057232732.1\|2167065_2167548_+\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	7.3e-23	41.1
WP_057232734.1\|2167528_2169277_+\|terminase	terminase large subunit	A6M948	Geobacillus_virus	2.2e-125	40.8
WP_081379638.1\|2169537_2170707_+\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	7.3e-69	39.3
WP_057232740.1\|2170699_2171290_+\|head,protease	HK97 family phage prohead protease	Q8SBP9	Clostridium_phage	1.1e-33	46.0
WP_057232742.1\|2171347_2172466_+\|capsid	phage major capsid protein	A0A288WGE9	Bacillus_phage	4.6e-28	28.4
2171565:2171580	attR	NA	NA	NA	NA
WP_057232744.1\|2172509_2172779_+\|head,tail	phage gp6-like head-tail connector protein	A0A0A7RWM0	Clostridium_phage	4.5e-14	46.1
WP_057232746.1\|2172782_2173106_+\|head	phage head closure protein	A0A0A7RUH8	Clostridium_phage	4.9e-15	36.5
WP_057232748.1\|2173117_2173471_+	hypothetical protein	A0A0A7RUF1	Clostridium_phage	4.8e-16	42.2
WP_057232750.1\|2173470_2173821_+	hypothetical protein	A0A0A7S158	Clostridium_phage	1.1e-17	40.2
WP_057232753.1\|2173866_2174454_+	hypothetical protein	A0A2K5B294	Erysipelothrix_phage	1.2e-08	29.4
WP_057232755.1\|2174537_2174906_+	hypothetical protein	NA	NA	NA	NA
WP_057232758.1\|2174989_2175178_+	hypothetical protein	NA	NA	NA	NA
WP_110083231.1\|2175194_2178530_+\|tail	phage tail tape measure protein	A0A0A7RVT5	Clostridium_phage	3.5e-63	41.0
WP_057232763.1\|2178588_2179146_+	hypothetical protein	NA	NA	NA	NA
WP_061427715.1\|2179160_2179601_+	hypothetical protein	NA	NA	NA	NA
WP_061427717.1\|2179662_2179890_+\|bacteriocin	bacteriocin	A0A249XXC7	Clostridium_phage	4.2e-13	59.6

DBSCAN-SWA_5

2404310 : 2517378

112

Clostridium_phage(57.58%)

integrase,capsid,tail,holin,head,tRNA,terminase,protease,portal

attL 2454618:2454635|attR 2492057:2492074

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003477928.1\|2404310_2405303_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_003450775.1\|2405447_2405957_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_003460870.1\|2405975_2406878_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	4.9e-89	56.1
WP_003477931.1\|2407216_2408488_-	magnesium transporter	NA	NA	NA	NA
WP_070956886.1\|2408827_2409616_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003470319.1\|2409629_2410271_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003470317.1\|2410282_2410975_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-26	35.3
WP_003466518.1\|2411146_2411827_-	hypothetical protein	NA	NA	NA	NA
WP_003460604.1\|2411899_2412781_-	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_003453570.1\|2413095_2413617_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_003453576.1\|2413663_2414014_-	hypothetical protein	NA	NA	NA	NA
WP_003460610.1\|2414035_2414572_-	rubrerythrin family protein	NA	NA	NA	NA
WP_003470307.1\|2414623_2415973_-	SpoVR family protein	NA	NA	NA	NA
WP_070956887.1\|2415999_2417178_-	sporulation protein YhbH	NA	NA	NA	NA
WP_003470316.1\|2417181_2419104_-	PrkA family serine protein kinase	A0MN77	Thermus_phage	2.7e-84	32.8
WP_003470318.1\|2419193_2420972_-	DNA helicase RecQ	A0A2P1EM61	Moumouvirus	1.0e-77	36.9
WP_003470303.1\|2421202_2421826_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_003470314.1\|2421818_2422616_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_003470309.1\|2422627_2423422_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003460605.1\|2423730_2424570_+	patatin family protein	NA	NA	NA	NA
WP_003470312.1\|2424687_2425701_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_025647963.1\|2425918_2426983_+	galactose/glucose ABC transporter substrate-binding protein MglB	NA	NA	NA	NA
WP_003469787.1\|2427057_2428605_+	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	4.9e-12	33.3
WP_003449090.1\|2428576_2429605_+	galactose/methyl galactoside ABC transporter permease MglC	NA	NA	NA	NA
WP_003469812.1\|2429860_2430883_-	galactose mutarotase	NA	NA	NA	NA
WP_003469784.1\|2431108_2432272_+	galactokinase	NA	NA	NA	NA
WP_110439897.1\|2432358_2433855_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_110083206.1\|2434042_2435698_-	nucleoside kinase	NA	NA	NA	NA
WP_003469799.1\|2435827_2436526_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003469820.1\|2436522_2436957_+	DUF4363 family protein	NA	NA	NA	NA
WP_003449129.1\|2437053_2437920_+	class II fructose-1,6-bisphosphate aldolase	NA	NA	NA	NA
WP_003469802.1\|2437966_2439010_-	nucleoid-associated protein	J9QE81	Clostridium_phage	1.2e-38	29.5
WP_003469797.1\|2439149_2439713_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_042262674.1\|2439963_2440566_-	hypothetical protein	NA	NA	NA	NA
WP_110083205.1\|2440707_2442369_-	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	3.5e-16	37.2
WP_003449139.1\|2442534_2442903_-	DUF2164 family protein	NA	NA	NA	NA
WP_003469790.1\|2443090_2443477_+	hypothetical protein	NA	NA	NA	NA
WP_060670527.1\|2443795_2444281_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_110083204.1\|2444940_2445969_-	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	1.6e-189	93.9
WP_057231096.1\|2446054_2446471_-	hypothetical protein	M9Q2G0	Clostridium_phage	1.9e-59	92.0
WP_011590482.1\|2446511_2446928_-\|holin	phage holin family protein	M9Q253	Clostridium_phage	1.2e-69	97.8
WP_011590481.1\|2446941_2447190_-	hypothetical protein	Q0SPG3	Clostridium_phage	5.4e-38	95.1
WP_110083203.1\|2447208_2452707_-	hypothetical protein	M9Q2I5	Clostridium_phage	7.4e-103	51.4
WP_110083202.1\|2452722_2452959_-	hypothetical protein	NA	NA	NA	NA
WP_110083201.1\|2453023_2453284_-	hypothetical protein	Q0SPL4	Clostridium_phage	2.2e-26	74.1
WP_110439898.1\|2453386_2453641_+	hypothetical protein	NA	NA	NA	NA
WP_158524234.1\|2453628_2453787_-	hypothetical protein	NA	NA	NA	NA
WP_110083199.1\|2453786_2454158_-	hypothetical protein	NA	NA	NA	NA
WP_075810618.1\|2454172_2454826_-\|tail	phage tail protein	Q0SPL3	Clostridium_phage	2.9e-43	45.3
2454618:2454635	attL	NA	NA	NA	NA
WP_110439899.1\|2454829_2458603_-\|tail	phage tail tape measure protein	A0A0A7RVT5	Clostridium_phage	3.4e-67	44.3
WP_110083446.1\|2458616_2458817_-	hypothetical protein	NA	NA	NA	NA
WP_078209997.1\|2458843_2459167_-	hypothetical protein	NA	NA	NA	NA
WP_110019924.1\|2459217_2459802_-\|tail	phage tail protein	NA	NA	NA	NA
WP_110083445.1\|2459821_2460136_-	hypothetical protein	NA	NA	NA	NA
WP_110083444.1\|2460140_2460560_-	hypothetical protein	NA	NA	NA	NA
WP_110083443.1\|2460559_2460898_-\|head	phage head closure protein	NA	NA	NA	NA
WP_161553630.1\|2461230_2462463_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_110083450.1\|2462492_2463116_-\|head,protease	HK97 family phage prohead protease	A0A1W6JP53	Morganella_phage	3.5e-09	33.5
WP_110083449.1\|2463126_2464335_-\|portal	phage portal protein	X4YEM3	Lactococcus_phage	1.7e-15	22.4
WP_110020665.1\|2464408_2466067_-\|terminase	terminase	A0A0A8WIA5	Clostridium_phage	7.9e-85	35.0
WP_057230548.1\|2466131_2466476_-	hypothetical protein	NA	NA	NA	NA
WP_110083440.1\|2466590_2467286_-	HNH endonuclease	NA	NA	NA	NA
WP_110083439.1\|2467287_2467764_-	Xaa-His dipeptidase	NA	NA	NA	NA
WP_110083438.1\|2468031_2468676_-\|integrase	tyrosine-type recombinase/integrase	F6K8Q2	Clostridium_phage	3.8e-27	35.9
WP_110083437.1\|2468729_2468936_-	hypothetical protein	NA	NA	NA	NA
WP_110083436.1\|2469077_2469539_-	sigma-70 family RNA polymerase sigma factor	A0A0A8WFM4	Clostridium_phage	4.8e-16	40.4
WP_110083435.1\|2469702_2469915_-	hypothetical protein	NA	NA	NA	NA
WP_110083434.1\|2470187_2470577_-	single-stranded DNA-binding protein	Q8SBL5	Clostridium_phage	8.1e-41	62.3
WP_158524238.1\|2470591_2470738_-	hypothetical protein	NA	NA	NA	NA
WP_110083448.1\|2470749_2472033_-	DNA helicase	Q8SBL9	Clostridium_phage	1.4e-198	82.9
WP_110083433.1\|2472043_2472784_-	hypothetical protein	Q8SBM0	Clostridium_phage	1.2e-64	54.9
WP_158524237.1\|2472810_2472969_-	hypothetical protein	NA	NA	NA	NA
WP_110083432.1\|2472971_2473151_-	hypothetical protein	I2E8Z1	Clostridium_phage	4.2e-08	58.5
WP_110083431.1\|2473176_2473407_-	hypothetical protein	NA	NA	NA	NA
WP_110083430.1\|2473412_2473910_-	transcriptional regulator	A0A2K9V3J3	Faecalibacterium_phage	2.6e-23	41.5
WP_110083429.1\|2473959_2474148_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_110083428.1\|2474301_2474646_+	helix-turn-helix transcriptional regulator	A0A1L2BY72	Clostridium_phage	2.0e-22	52.7
WP_110439900.1\|2474667_2476836_+	sensor histidine kinase	NA	NA	NA	NA
WP_110083426.1\|2476846_2477920_+	hypothetical protein	NA	NA	NA	NA
WP_110083425.1\|2477932_2479147_-	DNA cytosine methyltransferase	M1PSQ0	Streptococcus_phage	3.4e-37	31.3
WP_110083424.1\|2479333_2479831_+	ImmA/IrrE family metallo-endopeptidase	A0A1L2BY64	Clostridium_phage	1.4e-29	41.8
WP_110083423.1\|2479844_2481353_+	recombinase family protein	M9Q2G2	Clostridium_phage	6.8e-59	33.3
WP_003460061.1\|2482106_2482481_-	hypothetical protein	NA	NA	NA	NA
WP_003460069.1\|2482956_2483517_-	AAA family ATPase	NA	NA	NA	NA
WP_003460052.1\|2483595_2484546_-	ribonuclease Z	NA	NA	NA	NA
WP_110083422.1\|2484658_2489095_-	family 20 glycosylhydrolase	NA	NA	NA	NA
WP_003449118.1\|2489307_2489934_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003460038.1\|2489985_2490738_-	hypothetical protein	NA	NA	NA	NA
WP_003449110.1\|2491038_2491542_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_080503687.1\|2491841_2492630_+	histidinol-phosphatase	NA	NA	NA	NA
2492057:2492074	attR	NA	NA	NA	NA
WP_003460070.1\|2492980_2494294_+	sodium-dependent transporter	NA	NA	NA	NA
WP_003449164.1\|2494585_2495281_+	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_003460055.1\|2495389_2496466_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003470420.1\|2496606_2497653_-	calcium/proton exchanger	NA	NA	NA	NA
WP_003470423.1\|2498093_2499377_-	alkaline phosphatase family protein	O90761	Fowlpox_virus	7.6e-11	24.8
WP_003460059.1\|2499445_2499781_-	hypothetical protein	NA	NA	NA	NA
WP_003470422.1\|2499919_2500333_-	hypothetical protein	NA	NA	NA	NA
WP_003470424.1\|2500532_2501444_-	DUF368 domain-containing protein	NA	NA	NA	NA
WP_003460040.1\|2503490_2504282_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_003470421.1\|2504551_2504878_-	hypothetical protein	NA	NA	NA	NA
WP_003470419.1\|2505362_2506304_+	hypothetical protein	NA	NA	NA	NA
WP_003466212.1\|2506341_2507211_-	methionyl aminopeptidase	NA	NA	NA	NA
WP_003460916.1\|2507558_2508155_-	zinc dependent phospholipase C family protein	NA	NA	NA	NA
WP_003477990.1\|2508256_2509180_+	hypothetical protein	NA	NA	NA	NA
WP_003466204.1\|2509319_2509889_-	hypothetical protein	NA	NA	NA	NA
WP_003477994.1\|2509974_2510232_-	hypothetical protein	NA	NA	NA	NA
WP_003460758.1\|2510253_2510469_-	hypothetical protein	NA	NA	NA	NA
WP_003470444.1\|2510504_2510987_-	hypothetical protein	NA	NA	NA	NA
WP_003448636.1\|2511202_2511796_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003470447.1\|2511795_2514126_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	8.0e-176	45.3
WP_003470442.1\|2514247_2515960_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	2.3e-23	27.4
WP_003448621.1\|2516070_2517378_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.0e-140	58.4

DBSCAN-SWA_6

2620306 : 2633560

Clostridium_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003457168.1\|2620306_2621344_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.4e-31	36.0
WP_003454568.1\|2621542_2621812_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003468319.1\|2621828_2623181_+	PFL family protein	NA	NA	NA	NA
WP_003468337.1\|2623392_2623896_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	2.4e-13	37.2
WP_003468377.1\|2624220_2625096_-	MBL fold metallo-hydrolase	Q332C0	Clostridium_botulinum_C_phage	8.2e-65	50.2
WP_003468349.1\|2625265_2626588_-	sensor histidine kinase	X5JAC0	Clostridium_phage	2.1e-72	37.8
WP_003449818.1\|2626581_2627292_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	3.3e-32	31.8
WP_003468308.1\|2627430_2628444_-	N-acetylmuramoyl-L-alanine amidase	Q8SBN4	Clostridium_phage	8.4e-122	64.5
WP_003468317.1\|2628540_2628828_-	thiamine-binding protein	NA	NA	NA	NA
WP_003456055.1\|2629051_2630065_-	DUF348 domain-containing protein	A0A143FMI2	Bacillus_phage	3.5e-19	52.0
WP_003468402.1\|2630490_2631789_-	uracil permease	Q9KX94	Enterobacteria_phage	3.1e-68	39.0
WP_003468328.1\|2631976_2633560_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	1.4e-43	25.4

DBSCAN-SWA_7

3376092 : 3431312

Clostridium_phage(20.0%)

protease,transposase,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003468202.1\|3376092_3376623_+\|protease	spore protease YyaC	G3M9W0	Bacillus_virus	1.0e-17	38.5
WP_003452335.1\|3376661_3377699_-	rod shape-determining protein	NA	NA	NA	NA
WP_003452341.1\|3377789_3378041_-	sporulation transcriptional regulator SpoIIID	M9Q261	Clostridium_phage	2.4e-17	58.7
WP_003457419.1\|3378117_3378888_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_003457347.1\|3378997_3380020_-	stage II sporulation protein D	Q2XU88	Pseudomonas_phage	3.0e-34	35.9
WP_003457368.1\|3380131_3381397_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003457349.1\|3381419_3382064_-	hypothetical protein	NA	NA	NA	NA
WP_003452358.1\|3382245_3382647_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_003452277.1\|3382662_3384060_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_003452288.1\|3384073_3384925_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_003452357.1\|3384989_3386498_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_003457416.1\|3386508_3387048_-	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_003452454.1\|3387050_3387530_-	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_003452423.1\|3387629_3387848_-	ATP synthase F0 subunit C	NA	NA	NA	NA
WP_003452429.1\|3387908_3388583_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_003478635.1\|3388638_3389004_-	hypothetical protein	NA	NA	NA	NA
WP_003457425.1\|3389685_3390864_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_003452343.1\|3391131_3392286_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	2.9e-25	25.5
WP_003452430.1\|3392349_3392979_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003457391.1\|3393023_3393473_-	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_003457388.1\|3393736_3394789_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	8.4e-48	36.7
WP_003452379.1\|3394811_3395402_-	hypothetical protein	NA	NA	NA	NA
WP_003452315.1\|3395480_3396563_-	peptide chain release factor 1	NA	NA	NA	NA
WP_003457428.1\|3396619_3398383_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003452353.1\|3398408_3399008_-	thymidine kinase	A0A249XXF6	Clostridium_phage	6.6e-50	48.7
WP_003452406.1\|3399163_3399370_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_003457423.1\|3399478_3400603_+	glycosyltransferase	NA	NA	NA	NA
WP_003452426.1\|3400645_3402106_-	transcription termination factor Rho	NA	NA	NA	NA
WP_003452392.1\|3402369_3403977_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	8.0e-159	53.4
WP_003452275.1\|3404317_3404737_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_011591068.1\|3404759_3405740_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_011591069.1\|3405785_3406415_-	stage II sporulation protein R	NA	NA	NA	NA
WP_003471015.1\|3406484_3407351_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_011591070.1\|3407486_3410111_-	cyanophycin synthetase	NA	NA	NA	NA
WP_025648404.1\|3410097_3410925_-	cyanophycinase	NA	NA	NA	NA
WP_003457329.1\|3411024_3412587_-	DUF3794 domain-containing protein	NA	NA	NA	NA
WP_003462688.1\|3412946_3413183_-	hypothetical protein	NA	NA	NA	NA
WP_110077275.1\|3413345_3414233_-	sporulation peptidase YabG	NA	NA	NA	NA
WP_003452387.1\|3414432_3415437_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_011010824.1\|3415545_3416673_+	glycosyltransferase family 4 protein	B6EFC4	Stygiolobus_rod-shaped_virus	1.4e-05	36.6
WP_011010825.1\|3416855_3417884_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_110034798.1\|3417899_3418583_-	hypothetical protein	NA	NA	NA	NA
WP_011010827.1\|3418590_3419598_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_025648406.1\|3419726_3420872_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003457337.1\|3421105_3421636_-	Gx transporter family protein	NA	NA	NA	NA
WP_025648407.1\|3421828_3422200_-	NusG domain II-containing protein	NA	NA	NA	NA
WP_003457393.1\|3422340_3422784_+	FMN-binding protein	NA	NA	NA	NA
WP_110083259.1\|3422818_3423847_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_110034797.1\|3423972_3425097_-	ethanolamine utilization protein EutH	NA	NA	NA	NA
WP_110034796.1\|3425259_3425589_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_057232011.1\|3425821_3427201_-\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-21	29.0
WP_110439914.1\|3427317_3428337_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_003452273.1\|3428351_3429371_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.9e-68	42.5
WP_078209964.1\|3429944_3431312_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP025502

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP025501

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection