CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	0 crisprs	csa3,RT	0	3
NZ_CP030081	Enterobacter hormaechei strain 20710 plasmid pVIM-20710, complete sequence	1 crisprs	DEDDh	2	2
NZ_CP030077	Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence	0 crisprs	DEDDh	0	1
NZ_CP030076	Enterobacter hormaechei strain 20710 chromosome, complete genome	1 crisprs	csa3,DinG,WYL,DEDDh,cas3	0	364
NZ_CP030079	Enterobacter hormaechei strain 20710 plasmid p5-20710, complete sequence	0 crisprs	cas14j	0	1
NZ_CP030078	Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence	1 crisprs	DEDDh	1	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

69555 : 111910

Acinetobacter_phage(22.22%)

transposase,protease,integrase

attL 95705:95764|attR 116687:117975

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000795949.1\|69555_70731_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_001285422.1\|70900_71113_+	hypothetical protein	NA	NA	NA	NA
WP_112777793.1\|71473_72556_+	hypothetical protein	NA	NA	NA	NA
WP_001284318.1\|72721_74221_-	kinase	NA	NA	NA	NA
WP_000081060.1\|74246_75884_-	protein phosphatase 2C domain-containing protein	NA	NA	NA	NA
WP_001253656.1\|75883_76924_-	VWA domain-containing protein	NA	NA	NA	NA
WP_001253658.1\|77008_77647_-	VWA domain-containing protein	NA	NA	NA	NA
WP_000116681.1\|77646_78288_-	TerD family protein	NA	NA	NA	NA
WP_001253657.1\|78310_78949_-	VWA domain-containing protein	NA	NA	NA	NA
WP_001176767.1\|79411_79879_-	tellurium resistance protein TerW	NA	NA	NA	NA
WP_011152964.1\|79896_81105_-	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_031942304.1\|81115_82072_-	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_001585166.1\|82071_83151_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	2.8e-38	34.1
WP_001040058.1\|83152_83926_-	hypothetical protein	NA	NA	NA	NA
WP_001280115.1\|83918_85061_-	phosphoribosyltransferase	A0A172Q0Y1	Acinetobacter_phage	6.5e-30	34.5
WP_012695441.1\|85070_86129_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_000254137.1\|86449_87031_+	tellurium resistance-associated protein TerZ	K4JRX3	Caulobacter_phage	6.3e-13	30.0
WP_001054786.1\|87030_88188_+	TerD family protein	NA	NA	NA	NA
WP_000007449.1\|88210_88666_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_000255079.1\|88688_89729_+	tellurium resistance membrane protein TerC	K7QKE8	Escherichia_phage	2.2e-77	48.0
WP_000116680.1\|89777_90356_+	tellurium resistance membrane protein TerD	A0A2P1N0L4	Streptomyces_phage	2.5e-06	40.0
WP_000301247.1\|90424_91000_+	TerD family protein	K4JRX3	Caulobacter_phage	8.7e-31	41.6
WP_001053340.1\|91428_92670_+	VWA domain-containing protein	NA	NA	NA	NA
WP_000374058.1\|92760_93216_+	hypothetical protein	NA	NA	NA	NA
WP_000398479.1\|93456_93648_-	hypothetical protein	NA	NA	NA	NA
WP_001151572.1\|93739_94081_-	hypothetical protein	NA	NA	NA	NA
WP_000880375.1\|95067_95322_+	hypothetical protein	NA	NA	NA	NA
95705:95764	attL	NA	NA	NA	NA
WP_000427623.1\|95981_96986_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_010791757.1\|97135_98818_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	3.7e-05	24.7
WP_000393453.1\|98820_99729_+	TniB family NTP-binding protein	NA	NA	NA	NA
WP_011405615.1\|99725_100943_+	TniQ family protein	NA	NA	NA	NA
WP_010981357.1\|101003_101618_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.1e-37	51.0
WP_010981356.1\|101656_101977_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_005413392.1\|101992_102229_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_031942307.1\|102225_102591_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000761850.1\|102702_103341_-	organomercurial lyase MerB	NA	NA	NA	NA
WP_077269372.1\|103355_103709_-	hypothetical protein	NA	NA	NA	NA
WP_010981353.1\|103638_104073_+	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_000427614.1\|104151_105156_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_072201471.1\|105729_105942_+	hypothetical protein	NA	NA	NA	NA
WP_021443905.1\|106032_106380_-	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
WP_058672289.1\|106376_107015_-	organomercurial lyase MerB	NA	NA	NA	NA
WP_112778030.1\|107095_107749_-	phenylmercury resistance protein MerG	NA	NA	NA	NA
WP_011405608.1\|107784_109494_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-34	27.1
WP_011405607.1\|109681_109957_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294663.1\|109970_110321_-	mercuric transport protein MerT	NA	NA	NA	NA
WP_032490487.1\|110392_110827_+	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_000427614.1\|110905_111910_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
116687:117975	attR	NA	NA	NA	NA

DBSCAN-SWA_2

115464 : 174982

Salmonella_phage(54.55%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000427623.1\|115464_116469_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_000211823.1\|118407_119394_-	hypothetical protein	NA	NA	NA	NA
WP_000341066.1\|120314_120707_+	hypothetical protein	NA	NA	NA	NA
WP_000462754.1\|121365_122022_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_101724158.1\|122224_122722_+	hypothetical protein	NA	NA	NA	NA
WP_000083579.1\|122726_124115_+	hypothetical protein	NA	NA	NA	NA
WP_012477377.1\|124515_124809_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000088044.1\|124813_126139_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_000134171.1\|126199_126406_+	hypothetical protein	NA	NA	NA	NA
WP_000985909.1\|126506_126917_+	hypothetical protein	NA	NA	NA	NA
WP_001641519.1\|126929_127745_+	HNH endonuclease	G0X580	Salmonella_phage	2.5e-15	37.2
WP_000278471.1\|127997_128423_+	hypothetical protein	NA	NA	NA	NA
WP_001224686.1\|128971_129280_+	hypothetical protein	NA	NA	NA	NA
WP_000784387.1\|129295_130153_+	HNH endonuclease	G0X580	Salmonella_phage	3.9e-11	34.2
WP_001287391.1\|130759_131164_-	H-NS histone family protein	NA	NA	NA	NA
WP_001100635.1\|131341_131635_-	hypothetical protein	NA	NA	NA	NA
WP_000175475.1\|131660_131897_-	hypothetical protein	NA	NA	NA	NA
WP_000916941.1\|131937_132393_-	hypothetical protein	NA	NA	NA	NA
WP_000490638.1\|132452_133118_-	hypothetical protein	NA	NA	NA	NA
WP_001371925.1\|133175_133556_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|137713_138418_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001120775.1\|139205_139481_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_000842119.1\|139539_140649_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.8e-32	30.3
WP_000070400.1\|140699_141098_+	VOC family protein	NA	NA	NA	NA
WP_000664785.1\|141255_142590_+	DUF3422 family protein	NA	NA	NA	NA
WP_000440264.1\|142637_143468_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_000233327.1\|143485_144796_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000038427.1\|144999_147651_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.1e-156	33.8
WP_000765646.1\|147842_148274_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_001141269.1\|148638_148914_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_007372360.1\|149599_150751_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_000859348.1\|150911_151058_-	DUF2474 domain-containing protein	NA	NA	NA	NA
WP_007372361.1\|151083_152094_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_022646510.1\|153357_153522_-	hypothetical protein	NA	NA	NA	NA
WP_000831397.1\|153579_153948_-	hypothetical protein	NA	NA	NA	NA
WP_000896835.1\|154631_155999_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_003026030.1\|155974_156643_-	response regulator	NA	NA	NA	NA
WP_001805638.1\|156728_157505_-	membrane protein	NA	NA	NA	NA
WP_001067855.1\|159168_159873_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_112777898.1\|159931_160057_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	6.4e-08	100.0
WP_000114860.1\|160216_161380_+	hypothetical protein	A0A1P8DTT7	Salmonella_phage	1.3e-17	32.1
WP_101724159.1\|161627_163319_+	DUF4942 domain-containing protein	J9Q747	Salmonella_phage	2.2e-66	31.0
WP_000070862.1\|163315_163492_+	hypothetical protein	NA	NA	NA	NA
WP_000502495.1\|163540_163996_+	hypothetical protein	NA	NA	NA	NA
WP_000535423.1\|163982_164264_+	hypothetical protein	NA	NA	NA	NA
WP_000966518.1\|164321_164948_-	hypothetical protein	NA	NA	NA	NA
WP_001232713.1\|165320_167777_+	DUF4165 domain-containing protein	NA	NA	NA	NA
WP_000159528.1\|168884_169973_+	IncHI-type plasmid replication initiator protein RepHI2	J9Q7H0	Salmonella_phage	2.8e-83	50.9
WP_000654804.1\|174013_174982_-\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-185	99.4

DBSCAN-SWA_3

237379 : 269701

uncultured_Caudovirales_phage(42.86%)

transposase,integrase

attL 267220:267233|attR 272442:272455

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100185530.1\|237379_238294_+\|transposase	IS5 family transposase	A0A077SK28	Escherichia_phage	3.6e-172	98.4
WP_000900745.1\|238459_238777_+	hypothetical protein	NA	NA	NA	NA
WP_001371904.1\|238827_239235_-	hypothetical protein	NA	NA	NA	NA
WP_000285959.1\|239692_240364_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_001100610.1\|240408_240714_-	hypothetical protein	NA	NA	NA	NA
WP_000785965.1\|240736_241054_-	hypothetical protein	NA	NA	NA	NA
WP_001567368.1\|241267_242671_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_001567369.1\|242699_243332_-	hypothetical protein	NA	NA	NA	NA
WP_065945190.1\|243528_244932_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_000130816.1\|244964_245669_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.8e-86	72.9
WP_000941305.1\|245755_246076_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.7e-20	53.7
WP_000922628.1\|246121_247411_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	9.9e-168	71.4
WP_000065802.1\|247423_247849_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	1.6e-50	70.7
WP_001066652.1\|247908_248736_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	4.9e-43	37.2
WP_000927306.1\|248754_250233_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	7.3e-199	74.4
WP_000864986.1\|250724_251000_-	hypothetical protein	NA	NA	NA	NA
WP_001371914.1\|251140_251338_-	hypothetical protein	NA	NA	NA	NA
WP_000637193.1\|252324_252582_-	hypothetical protein	NA	NA	NA	NA
WP_000975181.1\|253016_253913_-	hypothetical protein	NA	NA	NA	NA
WP_000464825.1\|253915_254431_-	thermonuclease family protein	A0A1X6WF84	Pacmanvirus	2.1e-07	38.6
WP_000833380.1\|254645_256073_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	3.4e-100	52.3
WP_000220758.1\|256133_256301_+	hypothetical protein	A0A2D2W2Z9	Escherichia_phage	7.3e-07	50.9
WP_000078513.1\|256323_257643_+	DUF1173 family protein	NA	NA	NA	NA
WP_000121164.1\|257655_257859_+	hypothetical protein	NA	NA	NA	NA
WP_001371952.1\|257922_259128_-	hypothetical protein	NA	NA	NA	NA
WP_000193207.1\|259124_259943_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_001572379.1\|260147_260315_+	hypothetical protein	NA	NA	NA	NA
WP_000019951.1\|260408_260681_-	Ni(II)/Co(II)-binding transcriptional repressor RcnR	NA	NA	NA	NA
WP_001572377.1\|260803_261919_+	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
WP_000723070.1\|262176_262611_-	hypothetical protein	NA	NA	NA	NA
WP_004248839.1\|262828_264175_-	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	8.8e-18	26.6
WP_016809156.1\|264213_265182_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-185	99.1
WP_001572373.1\|265370_266990_+	phosphoethanolamine--lipid A transferase MCR-9.1	NA	NA	NA	NA
WP_001572372.1\|267066_267543_+	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
267220:267233	attL	NA	NA	NA	NA
WP_001067855.1\|267708_268413_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000845039.1\|268687_269701_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
272442:272455	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP030081

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP030081_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP030081_1

27071-27221

Orphan

Consensus_repeat	Method
TGAGACAAGTCCGTGCGTATATC	CRISPRCasFinder

2 spacers

DEDDh

The CRISPR arrays of NZ_CP030081_1

>merge|NZ_CP030081|1|27071-27221|CRISPRCasFinder
TGAGACAAGTCCGTGCGTATATCAGGTCGCCAGAAGCCAATCTGGAGAATGAGACAAGTCCGTGCGTATTTCTAATGGCGAAGCCTCAGCGCCGGCCGAAGGCCAGGGGGTTTAGGAACGCCAGGTAGTGAGACAGGTCCGTGCGTATATC

>NZ_CP030081|1|1|27071-27221|CRISPRCasFinder
TGAGACAAGTCCGTGCGTATATC	AGGTCGCCAGAAGCCAATCTGGAGAA
TGAGACAAGTCCGTGCGTATTTC	TAATGGCGAAGCCTCAGCGCCGGCCGAAGGCCAGGGGGTTTAGGAACGCCAGGTAG
TGAGACAGGTCCGTGCGTATATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP030081.1\|WP_041692624.1\|27768_28191_+\|antirestriction-protein	unknown	unknown	gnl\|CDD\|377006
NZ_CP030081.1\|WP_000845039.1\|23973_24987_+\|class-1-integron-integrase-IntI1	unknown	unknown	gnl\|CDD\|185315
NZ_CP030081.1\|WP_012850366.1\|17702_17840_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030081.1\|WP_112777817.1\|30382_31135_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP030081.1\|WP_112777816.1\|31134_32352_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319256
NZ_CP030081.1\|WP_013263789.1\|23006_23807_-\|subclass-B1-metallo-beta-lactamase-VIM-1	unknown	unknown	gnl\|CDD\|293861
NZ_CP030081.1\|WP_112777819.1\|28300_29296_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|224117
NZ_CP030081.1\|WP_001389365.1\|21888_22653_-\|IS6-like-element-IS6100-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP030081.1\|WP_112777797.1\|20712_21579_-\|3'-5'-exonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP030081.1\|WP_112777823.1\|34171_34645_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030081.1\|WP_112777798.1\|19991_20723_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368639
NZ_CP030081.1\|WP_012850367.1\|17946_18270_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030081.1\|WP_012850387.1\|34650_35175_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	gnl\|CDD\|368576
NZ_CP030081.1\|WP_084852353.1\|25273_25585_+\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|225635
NZ_CP030081.1\|WP_112777799.1\|18279_19344_+\|phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|206754
NZ_CP030081.1\|WP_112777815.1\|33121_33835_-\|SprT-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|370932
NZ_CP030081.1\|WP_112777818.1\|29483_29864_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030081.1\|WP_069971684.1\|30064_30379_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|374591
NZ_CP030081.1\|WP_012850369.1\|19344_19992_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP030081.1\|WP_012850380.1\|32412_32967_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|377369

Protein	Function_ID	Function_description	E-value
NZ_CP030081.1\|WP_041692624.1\|27768_28191_+\|antirestriction-protein	gnl\|CDD\|377006	pfam03230, Antirestrict, Antirestriction protein. This family includes various protein that are involved in antirestriction. The ArdB protein efficiently inhibits restriction by members of the three known families of type I systems of E. coli.	2.45408e-38
NZ_CP030081.1\|WP_000845039.1\|23973_24987_+\|class-1-integron-integrase-IntI1	gnl\|CDD\|185315	PRK15417, PRK15417, integron integrase.	0
NZ_CP030081.1\|WP_112777817.1\|30382_31135_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.3015e-47
NZ_CP030081.1\|WP_112777816.1\|31134_32352_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319256	cd16398, KorB_N_like, ParB-like partition protein of low copy number plasmid RK2, N-terminal domain and related domains. KorB, a member of the ParB like family, is present on the low copy number, broad host range plasmid RK2. KorB encodes a gene product involved in segregation of RK2 and acts as a transcriptional regulator, down-regulating at least 6 RK2 operons. KorB binds RNA polymerase and acts cooperatively with several co-repressors in modulating transcription. KorB is comprised of 3 domains, including a beta-strand C-terminal domain similar to SH3 domains and an alpha helical central domain that interacts with operator DNA. In ParB of P1 and SopB of F, the N-terminal region is responsible for interaction with the parA component. However, korB interaction with the RK2 parA-equivalent IncC has been mapped to the central HTH motif. This family is related to the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	6.60299e-38
NZ_CP030081.1\|WP_013263789.1\|23006_23807_-\|subclass-B1-metallo-beta-lactamase-VIM-1	gnl\|CDD\|293861	cd16303, VIM_type_MBL-B1, VIM-type metallo-beta-lactamases, subclass B1; MBL-fold metallo-hydrolase domain. VIM (Verona integron-encoded metallo-beta-lactamase)-type MBLs are integron-associated and are widely distributed acquired MBLs. MBLs (class B of the Ambler beta-lactamase classification) have been divided into three subclasses B1, B2 and B3, based on sequence/structural relationships and substrates, with the B1 and B2 MBLs being most closely related to each other. This subgroup of VIM-type MBLs belongs to the B1 subclass. B1 enzymes are most active with two zinc ions bound in the active site, and have a broad-spectrum substrate profile.	2.17006e-139
NZ_CP030081.1\|WP_112777819.1\|28300_29296_+\|DNA-binding-protein	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	5.84802e-11
NZ_CP030081.1\|WP_001389365.1\|21888_22653_-\|IS6-like-element-IS6100-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.97603e-67
NZ_CP030081.1\|WP_112777797.1\|20712_21579_-\|3'-5'-exonuclease	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	5.63072e-34
NZ_CP030081.1\|WP_112777798.1\|19991_20723_-\|hypothetical-protein	gnl\|CDD\|368639	pfam05857, TraX, TraX protein. This family consists of several bacterial TraX proteins. TraX is responsible for the amino-terminal acetylation of F-pilin subunits.	6.20057e-17
NZ_CP030081.1\|WP_112777815.1\|33121_33835_-\|SprT-like-domain-containing-protein	gnl\|CDD\|370932	pfam10263, SprT-like, SprT-like family. This family represents a domain found in eukaryotes and prokaryotes. The domain contains a characteristic motif of the zinc metallopeptidases. This family includes the bacterial SprT protein.	7.07959e-11
NZ_CP030081.1\|WP_012850387.1\|34650_35175_+\|plasmid-mobilization-relaxosome-protein-MobC	gnl\|CDD\|368576	pfam05713, MobC, Bacterial mobilisation protein (MobC). This family consists of several bacterial MobC-like, mobilisation proteins. MobC proteins belong to the group of relaxases. Together with MobA and MobB they bind to a single cis-active site of a mobilising plasmid, the origin of transfer (oriT) region. The absence of MobC has several different effects on oriT DNA. Site- and strand-specific nicking by MobA protein is severely reduced, accounting for the lower frequency of mobilisation. The localized DNA strand separation required for this nicking is less affected, but becomes more sensitive to the level of active DNA gyrase in the cell. In addition, strand separation is not efficiently extended through the region containing the nick site. These effects suggest a model in which MobC acts as a molecular wedge for the relaxosome-induced melting of oriT DNA. The effect of MobC on strand separation may be partially complemented by the helical distortion induced by supercoiling. However, MobC extends the melted region through the nick site, thus providing the single-stranded substrate required for cleavage by MobA.	0.000685483
NZ_CP030081.1\|WP_084852353.1\|25273_25585_+\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|225635	COG3093, VapI, Plasmid maintenance system antidote protein [General function prediction only].	1.99537e-30
NZ_CP030081.1\|WP_112777799.1\|18279_19344_+\|phosphoribosyltransferase	gnl\|CDD\|206754	cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain. Phosphoribosyl transferase (PRT) domain. The type I PRTases are identified by a conserved PRPP binding motif which features two adjacent acidic residues surrounded by one or more hydrophobic residue. PRTases catalyze the displacement of the alpha-1'-pyrophosphate of 5-phosphoribosyl-alpha1-pyrophosphate (PRPP) by a nitrogen-containing nucleophile. The reaction products are an alpha-1 substituted ribose-5'-phosphate and a free pyrophosphate (PP). PRPP, an activated form of ribose-5-phosphate, is a key metabolite connecting nucleotide synthesis and salvage pathways. The type I PRTase family includes a range of diverse phosphoribosyl transferase enzymes and regulatory proteins of the nucleotide synthesis and salvage pathways, including adenine phosphoribosyltransferase EC:2.4.2.7., hypoxanthine-guanine-xanthine phosphoribosyltransferase, hypoxanthine phosphoribosyltransferase EC:2.4.2.8., ribose-phosphate pyrophosphokinase EC:2.7.6.1., amidophosphoribosyltransferase EC:2.4.2.14., orotate phosphoribosyltransferase EC:2.4.2.10., uracil phosphoribosyltransferase EC:2.4.2.9., and xanthine-guanine phosphoribosyltransferase EC:2.4.2.22.	7.90992e-08
NZ_CP030081.1\|WP_069971684.1\|30064_30379_+\|transcriptional-regulator	gnl\|CDD\|374591	pfam16509, KORA, TrfB plasmid transcriptional repressor. KORA is a family of Gram-negative bacterial proteins that act as global repressors of genes involved in plasmid replication, conjugative transfer and stable inheritance in the IncP group of plasmids. KORA operates as a symmetric dimer, and contacts the DNA via the helix-turn-helix region at the N-terminus.	1.4902e-16
NZ_CP030081.1\|WP_012850369.1\|19344_19992_-\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	3.10211e-54
NZ_CP030081.1\|WP_012850380.1\|32412_32967_+\|restriction-endonuclease	gnl\|CDD\|377369	pfam04471, Mrr_cat, Restriction endonuclease. Prokaryotic family found in type II restriction enzymes containing the hallmark (D/E)-(D/E)XK active site. Presence of catalytic residues implicates this region in the enzymatic cleavage of DNA.	4.99005e-27

>NZ_CP030081.1|WP_084852353.1|25273_25585_+|HigA-family-addiction-module-antidote-protein
MNMKRKPKAPGEVLETQFMQPNQITQKELASHTGWTRKHVNELCKGKARVTIDTALILGKAFGTGPDYWLELQQAVDIWDALHSEKRKERLESIVPLMKMVAA
>NZ_CP030081.1|WP_000845039.1|23973_24987_+|class-1-integron-integrase-IntI1
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLPTEQAYVHWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER
>NZ_CP030081.1|WP_013263789.1|23006_23807_-|subclass-B1-metallo-beta-lactamase-VIM-1
MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVHELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE
>NZ_CP030081.1|WP_001389365.1|21888_22653_-|IS6-like-element-IS6100-family-transposase
MTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEMLAERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREGKLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQARPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA
>NZ_CP030081.1|WP_112777797.1|20712_21579_-|3'-5'-exonuclease
MSDDLDKLRQDAIEADRCFSKSRLRDEFRMKPKPDAEPVKFYKNDFGRSFGVYRIADCIPMRQVKAARSEKQKASAQRLAVMAKLESKAAKAGKIASDWLADSCLVLDTETTGLGEDAQIIEIAICDIWGTVLVDHRVRPSVPIEPGAAEVHGITLEDLANSPTWPEVIDSIKECLTGRTVVIFNSDFDMAMLRNTCRAFGLDTDWLSTLNVKCAMELSVLAFGSTNQYGTISLADATYEAGVSWSGEAHSAKVDALATVDLLASIYRYYLDPAAELRNLTEGTNDVG
>NZ_CP030081.1|WP_112777798.1|19991_20723_-|hypothetical-protein
MLANSSAVLNRSTQSNAWVPAAQWLAVLTMTLEHVTKYVWPESAFVPWALAIGRIAFPVFAGMVAWHLLHNTRRPVRYGLRLLLIGAISQVPYAWVVTPDRLNICFTLAFGLLAVVLLDQVKDRRTRMATGVVLFLLAAVVSPFVEYQILGLLLVPAFVYAFRNNQRVTAMLPALALCAVINGGSPLHMAISCAAGCAVLLAPSLSFEGAAAPALPRGLRLSWYPLHLVAITVAIMAINQGAI
>NZ_CP030081.1|WP_012850369.1|19344_19992_-|recombinase-family-protein
MTVSTIKVARIYQRVSTKDQDLTRQAAIVQDAKAAGYHIAGVYREKASGASADRPELLRMIDDLQPGEVVISEKMDRISRLPLPEAEKLIEAIKGKGAKLAVPGVVDLSDLVEDATGVTRIVLESVQEMLLRVALQTARDDYEDRRERQRQGIELAKEAGRFTGRRPDSKMHARIVALRSRGESIADTAHLVGCGEATVKRVWAAHKAAKASEGE
>NZ_CP030081.1|WP_112777799.1|18279_19344_+|phosphoribosyltransferase
MSEGKRPERAPWNDFPPVIRNGDLKELEREPEYQAAKAGDQSAALDMAERLVRPETVEAIREVVGDRPAKIVPVLAREAAGNNKIPLATAEVLGDRLGLEVEYNIVQAEKVGRTNKGADHRLAMNPTFDGAVEPGRPYVLVDDTLSMGGTISSLRGYIENRGGQVLGAAVMTAHPGAVDLAVKPKMLADIERKHGHAMNNYWKEEFGYGIEQLTQGEAGHLRKAPTVDAIRDRITAARNAAGWAMDESRAGQTPATESEGVKRGPHQDKADAFKQLSSKELLEQYPNDPAIEAATAVQAVADKFALEQIPNKDNRDRFLEGVRDRIADNLEHGRENTAPRILDDRSQGHDDQER
>NZ_CP030081.1|WP_012850367.1|17946_18270_+|hypothetical-protein
MKATEQHKRRVGKPQTVKPEAPNLVSSWRAIVTRTGTLTEALETMNAALGMKLTHSRITEWEREEKAPSTRVVNYMLATVVPALLLDQGLNENKVRELAGKVRVPGL
>NZ_CP030081.1|WP_012850366.1|17702_17840_+|hypothetical-protein
MSKQTEQVLSAFQSGQRVKLGSMSGKAFGKLMNELREFRERQEAA
>NZ_CP030081.1|WP_041692624.1|27768_28191_+|antirestriction-protein
MNNAAQIETAVTANQIPTTSRINALPRHFGRHMMAVETVVFAYMRELVEAYQGGYWEFYDLSNGGFYMAPTGTQELRVSVSGNYFDGDMSPDAAGIVACLFAYGYLANSTGAAALSRHFHWLRDYALDHPEAGKILAAID
>NZ_CP030081.1|WP_112777819.1|28300_29296_+|DNA-binding-protein
MAQGIPTETYDRIVQVANELYEQNGREKMPTVDDVRRAAKADMNTTSAVMREWRKQQTSQAAPVAVPVPAAVQEVFQGALATAWTEAQALANEALSAAQKGWDEERGEADQLRAEMAEAFESQGLELEAVTQQLADEQKAHQATMESAQAAKQQIDELERETQELKTRLATAERQAADRGERAEELKAELAEARADAKEQRKEADRDRKAVEKQHQEEKRSLESQHRQELEKADATAGELRQRLDTLTGELAQVKARAEAQEAQHQEQRQKAEQEAEKAAERVAAAQQDREQARQELAECRERNATLNGELTAIKAQLAELKQAGKGSAKK
>NZ_CP030081.1|WP_112777818.1|29483_29864_+|hypothetical-protein
MSKQTLIDTLAREFQGETFTHFAVMTWASGAELATWKEAFRELVEAGALVAVEERPLGTVYKMAEKLVITASAYNAAPSDYRSVWTTERFDLANWSEVRDQYIGKRTLMDRSGLHIEGITMVILDD
>NZ_CP030081.1|WP_069971684.1|30064_30379_+|transcriptional-regulator
MKRRLTPSEFDQAVKRLPRAMKARNIQIARAILVEGRKQAELVRETGLSRTAIAAVVRKIREAHETYGQPPEGWERIEVCLPSEMVHLVRALEEEARRQHENED
>NZ_CP030081.1|WP_112777817.1|30382_31135_+|ParA-family-protein
MQIITVSNQKGGVGKSTVAVHQAMDIQEKGKRVLFLDLDPQANATKTLERIAPAANVTASQLFTESVEAVEPAEGITLIHADGAMADIERAEPSVLSTFKQNLDNLGEAFDYCVIDTPPTLGLRMTAALLVADHVLAPIELEEYSIDGITKMLQTIFGVKEKWNPDLNFLGMLPNRFNPRSLAQKETLTNLVKNYSHLLIKARIGIRSSIPEALSEGIPVWQLKKTSAREAGREFQEAFAIVYEKMGGLK
>NZ_CP030081.1|WP_112777816.1|31134_32352_+|ParB/RepB/Spo0J-family-partition-protein
MTDKTTPKSKGADLSGLDDFNLSSFLDGGKKGKAQEDAGNAAPAGAVSYAPLDHFHEDEDNARQEFDAQRLQELAESMTQVNPKTGEVRGILEPLSVKHHPDKPGHFIINGGARRYRAAKLAGLEQAPYIIKDELDDFDKFVLNDQREQLSPLEIAMFIKARLDEGYSKTEVAKALGRPASYVSDHVIFFDMAGAIRDLYDSERCRSMQALALLHRAHKKNPEPVEAFCQDANENDQELTTSQVRAFLESLKKPEGPKEKDEKPTAPTGDSKDQEPQAPKDEDDNQGDTTPASETQLGEGDTDEEPGDQFPDPSTRNEDQQPLTLDGEPLSGGTLEGQADQMLEQDEKADRIKKAIIQVKHDEREARLLTERRAAYGLAWIKYDDDGQEVEVDLNQVALVAVIEA
>NZ_CP030081.1|WP_012850380.1|32412_32967_+|restriction-endonuclease
MTEFLYDLPLPVLITGLVLLALLSNFGRPLLRLLGWRKPAHRRRERQARQSLAKLAEIPDPGRKFAFLRSINPFTFEEMILETFEQRGYKVKRNTRYTGDGGIDGRVWLDGDLFLIQAKRYAGHISAAHVQEFCRMVDAKGCKGFFIHTGKTGDASRLLANNQANVWIISGGKLLDLLDPDRRL
>NZ_CP030081.1|WP_112777815.1|33121_33835_-|SprT-like-domain-containing-protein
MKPTETTYEELQAAFDHFNDALFDSELPVCLITLQREKQTYGYFSAERFVSRDGGTTDEIAMNPAYFAVCPPEEIMQTLVHEMAHLWQHHFGKPGRRGYHNKEWAERMEEIGLMPSSTGKPGGAKTGDKMADYIIEGGPFEDACQELLTRNFRISWADKFPARERLQAAIADGTVDEMSEELAAWGVEIGEGGELVLETEHKQTRVKFTCPDCGANAWGKPSLNLICGDCDVALEAC
>NZ_CP030081.1|WP_112777823.1|34171_34645_+|hypothetical-protein
MESAAIEGAAFNQYRLSWLAYLRPLVLFGVMLFLAFLLGGIHVAVIYAGVALAVAVLVYKIMVLRSVVLFVNDEGVWVYSGVLPWSKGIGGVRWRDVEDARYNPGFLGWALKSYTVRVGHRFTRGNEIVLPSVKQGDKAVEQINALHGSYLRNGGGQ
>NZ_CP030081.1|WP_012850387.1|34650_35175_+|plasmid-mobilization-relaxosome-protein-MobC
MPRAETRLSEEEKQAWVDFCQFAGEPEAKMLRKMILKVSGGAEANPAASKREPKTGKVTVRLTESERVKLLEKVEREGYENPTKWTTALVRSALHREPVLTDDEVAALRESNRELAAIGRNLNQVARALNIEFRESDKLKREAIEKLAERIEQHKDQVAALLTRNMSRWEEDDG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP030081_1	1.1\|27094\|26\|NZ_CP030081\|CRISPRCasFinder	27094-27119	26	NZ_CP030081	Enterobacter hormaechei strain 20710 plasmid pVIM-20710, complete sequence	27094-27119	0	1.0
NZ_CP030081_1	1.2\|27143\|56\|NZ_CP030081\|CRISPRCasFinder	27143-27198	56	NZ_CP030081	Enterobacter hormaechei strain 20710 plasmid pVIM-20710, complete sequence	27143-27198	0	1.0
NZ_CP030081_1	1.2\|27143\|56\|NZ_CP030081\|CRISPRCasFinder	27143-27198	56	NZ_MG456577	Vibrio alginolyticus strain Vb1978 plasmid pVb1978, complete sequence	1368-1423	0	1.0
NZ_CP030081_1	1.1\|27094\|26\|NZ_CP030081\|CRISPRCasFinder	27094-27119	26	NZ_MG456577	Vibrio alginolyticus strain Vb1978 plasmid pVb1978, complete sequence	1319-1344	1	0.962
NZ_CP030081_1	1.2\|27143\|56\|NZ_CP030081\|CRISPRCasFinder	27143-27198	56	NZ_CP013800	Piscirickettsia salmonis strain AY6532B plasmid p4PS9, complete sequence	6454-6509	2	0.964
NZ_CP030081_1	1.2\|27143\|56\|NZ_CP030081\|CRISPRCasFinder	27143-27198	56	NZ_CP013819	Piscirickettsia salmonis strain AY3800B plasmid p3PS10, complete sequence	16380-16435	2	0.964
NZ_CP030081_1	1.2\|27143\|56\|NZ_CP030081\|CRISPRCasFinder	27143-27198	56	NZ_CP013795	Piscirickettsia salmonis strain AY6297B plasmid p4PS8, complete sequence	16380-16435	2	0.964
NZ_CP030081_1	1.2\|27143\|56\|NZ_CP030081\|CRISPRCasFinder	27143-27198	56	NC_013509	Edwardsiella tarda EIB202 plasmid pEIB202, complete sequence	20800-20855	2	0.964

1. spacer 1.1|27094|26|NZ_CP030081|CRISPRCasFinder matches to NZ_CP030081 (Enterobacter hormaechei strain 20710 plasmid pVIM-20710, complete sequence) position: , mismatch: 0, identity: 1.0

aggtcgccagaagccaatctggagaa	CRISPR spacer
aggtcgccagaagccaatctggagaa	Protospacer
**************************

2. spacer 1.2|27143|56|NZ_CP030081|CRISPRCasFinder matches to NZ_CP030081 (Enterobacter hormaechei strain 20710 plasmid pVIM-20710, complete sequence) position: , mismatch: 0, identity: 1.0

taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	CRISPR spacer
taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	Protospacer
********************************************************

3. spacer 1.2|27143|56|NZ_CP030081|CRISPRCasFinder matches to NZ_MG456577 (Vibrio alginolyticus strain Vb1978 plasmid pVb1978, complete sequence) position: , mismatch: 0, identity: 1.0

taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	CRISPR spacer
taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	Protospacer
********************************************************

4. spacer 1.1|27094|26|NZ_CP030081|CRISPRCasFinder matches to NZ_MG456577 (Vibrio alginolyticus strain Vb1978 plasmid pVb1978, complete sequence) position: , mismatch: 1, identity: 0.962

aggtcgccagaagccaatctggagaa	CRISPR spacer
aggccgccagaagccaatctggagaa	Protospacer
***.**********************

5. spacer 1.2|27143|56|NZ_CP030081|CRISPRCasFinder matches to NZ_CP013800 (Piscirickettsia salmonis strain AY6532B plasmid p4PS9, complete sequence) position: , mismatch: 2, identity: 0.964

taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	CRISPR spacer
taatggcgaagcctcagcgccggccgaaggccagggggtttcggaacgccaggcag	Protospacer
***************************************** ***********.**

6. spacer 1.2|27143|56|NZ_CP030081|CRISPRCasFinder matches to NZ_CP013819 (Piscirickettsia salmonis strain AY3800B plasmid p3PS10, complete sequence) position: , mismatch: 2, identity: 0.964

taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	CRISPR spacer
taatggcgaagcctcagcgccggccgaaggccagggggtttcggaacgccaggcag	Protospacer
***************************************** ***********.**

7. spacer 1.2|27143|56|NZ_CP030081|CRISPRCasFinder matches to NZ_CP013795 (Piscirickettsia salmonis strain AY6297B plasmid p4PS8, complete sequence) position: , mismatch: 2, identity: 0.964

taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	CRISPR spacer
taatggcgaagcctcagcgccggccgaaggccagggggtttcggaacgccaggcag	Protospacer
***************************************** ***********.**

8. spacer 1.2|27143|56|NZ_CP030081|CRISPRCasFinder matches to NC_013509 (Edwardsiella tarda EIB202 plasmid pEIB202, complete sequence) position: , mismatch: 2, identity: 0.964

taatggcgaagcctcagcgccggccgaaggccagggggtttaggaacgccaggtag	CRISPR spacer
taatggcgaagcctcagcgccggccgaaggccagggggtttcggaacgccaggcag	Protospacer
***************************************** ***********.**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 31135

Acanthamoeba_polyphaga_mimivirus(11.11%)

transposase,integrase

attL 9583:9601|attR 36998:37016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012850347.1\|2221_4159_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_112777808.1\|4124_5156_-	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_112777807.1\|5136_6363_-	type IV secretion system protein VirB10	NA	NA	NA	NA
WP_112777806.1\|6362_7199_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_012850352.1\|7200_7941_-	Type IV secretory pathway component	NA	NA	NA	NA
WP_112777805.1\|7940_8162_-	hypothetical protein	NA	NA	NA	NA
WP_112777804.1\|8322_9333_-	type IV secretion system protein	NA	NA	NA	NA
WP_112777803.1\|9344_9605_-	EexN family lipoprotein	NA	NA	NA	NA
9583:9601	attL	NA	NA	NA	NA
WP_112777802.1\|9614_10247_-	type IV secretion protein	NA	NA	NA	NA
WP_112777801.1\|10243_12802_-	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_112777822.1\|12699_13017_-	VirB3 family type IV secretion system protein	NA	NA	NA	NA
WP_012850360.1\|13029_13350_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_012850362.1\|13767_15738_-	type I DNA topoisomerase	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	1.2e-76	34.2
WP_112777800.1\|15734_16475_-	cell wall hydrolase	NA	NA	NA	NA
WP_012850364.1\|16484_16973_-	hypothetical protein	NA	NA	NA	NA
WP_012850365.1\|17397_17655_+	hypothetical protein	NA	NA	NA	NA
WP_012850366.1\|17702_17840_+	hypothetical protein	NA	NA	NA	NA
WP_012850367.1\|17946_18270_+	hypothetical protein	NA	NA	NA	NA
WP_112777799.1\|18279_19344_+	phosphoribosyltransferase	A0A0R6PHM5	Moraxella_phage	5.3e-34	34.9
WP_012850369.1\|19344_19992_-	recombinase family protein	NA	NA	NA	NA
WP_112777798.1\|19991_20723_-	hypothetical protein	A0A1D6ZIU7	Xanthomonas_phage	1.9e-06	33.9
WP_112777797.1\|20712_21579_-	3'-5' exonuclease	K7RFY5	Vibrio_phage	1.1e-26	40.9
WP_001389365.1\|21888_22653_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_013263789.1\|23006_23807_-	subclass B1 metallo-beta-lactamase VIM-1	NA	NA	NA	NA
WP_000845039.1\|23973_24987_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_084852353.1\|25273_25585_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_112777820.1\|25769_27122_+	replication protein	A0A1B1P892	Bacillus_phage	3.1e-10	25.4
WP_041692624.1\|27768_28191_+	antirestriction protein	A0A1S5R3R9	Pseudomonas_phage	1.6e-05	33.0
WP_112777819.1\|28300_29296_+	DNA-binding protein	NA	NA	NA	NA
WP_112777818.1\|29483_29864_+	hypothetical protein	NA	NA	NA	NA
WP_069971684.1\|30064_30379_+	transcriptional regulator	NA	NA	NA	NA
WP_112777817.1\|30382_31135_+	ParA family protein	H7BUL8	unidentified_phage	4.3e-14	29.9
36998:37016	attR	NA	NA	NA	NA

DBSCAN-SWA_2

37107 : 38637

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777811.1\|37107_38637_-	DUF1738 domain-containing protein	A0A1B1IRD0	uncultured_Mediterranean_phage	6.9e-35	33.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP030077

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30574 : 57241

Salmonella_phage(27.27%)

integrase,transposase

attL 40376:40390|attR 52279:52293

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|30574_31279_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_112777917.1\|32821_33691_-	23S ribosomal RNA methyltransferase Erm	NA	NA	NA	NA
WP_157159259.1\|34364_34559_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_112778027.1\|34621_34867_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	5.3e-06	41.0
WP_000412211.1\|35836_36496_+	type A-1 chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	8.4e-131	100.0
WP_000656305.1\|36696_37074_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000427623.1\|37384_38389_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001138064.1\|38467_41434_-\|transposase	Tn3-like element TnAs3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.6
40376:40390	attL	NA	NA	NA	NA
WP_000147567.1\|41436_41997_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
WP_000454193.1\|42122_42473_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000845039.1\|42675_43689_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001389366.1\|43846_44320_+	trimethoprim-resistant dihydrofolate reductase DfrA17	A0A1B2IAU3	Erwinia_phage	1.3e-16	34.6
WP_000503573.1\|44450_45239_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA5	NA	NA	NA	NA
WP_000679427.1\|45444_45792_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|45785_46625_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|47029_48571_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_112777913.1\|48748_48928_-	hypothetical protein	NA	NA	NA	NA
WP_043000434.1\|49005_49656_-	metal-binding protein ZinT	NA	NA	NA	NA
WP_043000433.1\|49821_50250_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	1.6e-26	47.9
WP_109740312.1\|50279_51140_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_044263728.1\|51331_52216_+	SED family class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	7.4e-106	70.6
WP_043000430.1\|52528_53158_-	transcriptional regulator	NA	NA	NA	NA
52279:52293	attR	NA	NA	NA	NA
WP_112778028.1\|53210_54224_-	threo-3-hydroxy-L-aspartate ammonia-lyase	NA	NA	NA	NA
WP_000679427.1\|54114_54462_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|54455_55295_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|55699_57241_+\|transposase	IS91 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP030076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP030076_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP030076_1

3871677-3871781

Orphan

Consensus_repeat	Method
TGTCCAGCCGATGTCCAGCCAGTGTCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP030076_1

>merge|NZ_CP030076|1|3871677-3871781|CRISPRCasFinder
AGTCAAATTTTTGTCCAGCCGATGTCCAGCCAGTGTCCAGCCCAAACGCAGTAGTTCCAATGCCTGTGGAGGTGGGGTGTCCAGCCGATGTCCAGCCAGTGTCCA

>NZ_CP030076|1|1|3871677-3871781|CRISPRCasFinder
AGTCAAATTTTTGTCCAGCCGATGTCCA	GCCAGTGTCCAGCCCAAACGCAGTAGTTCCAATGCCTGTGGAGGTGGGG
TGTCCAGCCGATGTCCAGCCAGTGTCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP030076.1\|WP_045142307.1\|3877123_3877762_+\|recombination-protein-NinG	unknown	unknown	gnl\|CDD\|368603
NZ_CP030076.1\|WP_176691860.1\|3872195_3873608_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274672
NZ_CP030076.1\|WP_058672863.1\|3876518_3876968_+\|recombination-protein-NinB	unknown	unknown	gnl\|CDD\|368607
NZ_CP030076.1\|WP_058672862.1\|3876960_3877131_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182029
NZ_CP030076.1\|WP_058688299.1\|3873607_3873952_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238042
NZ_CP030076.1\|WP_000102594.1\|3870272_3870506_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672865.1\|3875763_3876009_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_039269180.1\|3868249_3868687_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672871.1\|3867816_3868086_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_023622534.1\|3867455_3867659_-\|phage-encoded-cell-division-inhibitor-protein	unknown	unknown	gnl\|CDD\|236900
NZ_CP030076.1\|WP_045340889.1\|3870523_3871066_+\|toxin-YdaT-domain-containing-protein	unknown	unknown	gnl\|CDD\|368819
NZ_CP030076.1\|WP_058672864.1\|3876114_3876345_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672867.1\|3874816_3875098_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672872.1\|3867655_3867820_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672866.1\|3875101_3875764_+\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP030076.1\|WP_058672874.1\|3866717_3867002_-\|host-nuclease-inhibitor-GamL	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672860.1\|3877871_3878561_+\|antiterminator	unknown	unknown	gnl\|CDD\|368843
NZ_CP030076.1\|WP_015571544.1\|3871155_3871302_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_058672873.1\|3867136_3867451_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030076.1\|WP_045344955.1\|3869478_3870231_-\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224885

Protein	Function_ID	Function_description	E-value
NZ_CP030076.1\|WP_045340889.1\|3870523_3871066_+\|toxin-YdaT-domain-containing-protein	gnl\|CDD\|368819	pfam06254, YdaT_toxin, Putative bacterial toxin ydaT. YdaT_toxin is a family of putative bacterial toxins that are neutralized by the putative antitoxin YdaS, UniProtKB:P76063, family pfam144549.	2.03027e-40
NZ_CP030076.1\|WP_176691860.1\|3872195_3873608_+\|AAA-family-ATPase	gnl\|CDD\|274672	TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model. [Mobile and extrachromosomal element functions, Prophage functions].	3.21192e-156
NZ_CP030076.1\|WP_058672866.1\|3875101_3875764_+\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	1.70673e-09
NZ_CP030076.1\|WP_045142307.1\|3877123_3877762_+\|recombination-protein-NinG	gnl\|CDD\|368603	pfam05766, NinG, Bacteriophage Lambda NinG protein. NinG or Rap is involved in recombination. Rap (recombination adept with plasmid) increases lambda-by-plasmid recombination catalyzed by Escherichia coli's RecBCD pathway.	2.18587e-50
NZ_CP030076.1\|WP_058672862.1\|3876960_3877131_+\|hypothetical-protein	gnl\|CDD\|182029	PRK09689, PRK09689, prophage protein NinE; Provisional.	1.63009e-25
NZ_CP030076.1\|WP_058688299.1\|3873607_3873952_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	0.000245978
NZ_CP030076.1\|WP_058672860.1\|3877871_3878561_+\|antiterminator	gnl\|CDD\|368843	pfam06323, Phage_antiter_Q, Phage antitermination protein Q. This family consists of several phage antitermination protein Q and related bacterial sequences. Phage 82 gene Q encodes a phage-specific positive regulator of late gene expression, thought, by analogy to the corresponding gene of phage lambda, to be a transcription antiterminator.	4.23674e-87
NZ_CP030076.1\|WP_058672863.1\|3876518_3876968_+\|recombination-protein-NinB	gnl\|CDD\|368607	pfam05772, NinB, NinB protein. The ninR region of phage lambda contains two recombination genes, orf (ninB) and rap (ninG), that have roles when the RecF and RecBCD recombination pathways of E. coli, respectively, operate on phage lambda. NinB binds to single-stranded DNA.	1.01098e-50
NZ_CP030076.1\|WP_023622534.1\|3867455_3867659_-\|phage-encoded-cell-division-inhibitor-protein	gnl\|CDD\|236900	PRK11354, kil, FtsZ inhibitor protein; Reviewed.	1.99121e-13
NZ_CP030076.1\|WP_045344955.1\|3869478_3870231_-\|LexA-family-transcriptional-regulator	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	1.29825e-36

>NZ_CP030076.1|WP_015571544.1|3871155_3871302_+|hypothetical-protein
MAKNPRYYHTAVHKNITRDRFIRSVNPIVAEKMRAILEELKRKESGRG
>NZ_CP030076.1|WP_045340889.1|3870523_3871066_+|toxin-YdaT-domain-containing-protein
MHSLAYQHNTGIHPGAMINRAQHKAAPDHEKIRDAVRAWSSALDNQDVVSALIINEYREQGGTAISFPEDISRARQKLFRFLDNRFDSEQYRENVRQLTPAIMAVLPLEYRHRLLPEDSFMSRLARLEKETSEAKVAVAMNAPRHQKLKELSEGIVEMFRVDPDLTAPLMAMVTSMLGVM
>NZ_CP030076.1|WP_000102594.1|3870272_3870506_+|hypothetical-protein
MSTELHRWRKAATTDEWAQLAKLANTTPGYLDQIAYGNRRASPEMASAIEKGTKNFHRQAPVLKESLVFASPRDTAA
>NZ_CP030076.1|WP_045344955.1|3869478_3870231_-|LexA-family-transcriptional-regulator
MLNTTQASFSNLHIYHFAKSSNNAGMENKEIRKANLEALYEKRQHESGMTKAQFAELIETSPAALSQLLGPNPHRNIGDKMARKIETALDLPFGWMDVLHASEEPSNVAFRGLNETKGSYPVISWVSAGQWMEAVEPYHRRAIDRWYDTTVDCSEDSFWLDVKGDSMTSPAGLSIPEGAAILVDPEVEPRNGKLVVAKLEGDNEATFKKLVIDAGRRFLKPLNPAYPMLEVNGNCKIIGVVVDAKILNIP
>NZ_CP030076.1|WP_039269180.1|3868249_3868687_-|hypothetical-protein
MLGDGNTAISTAQETMILFWLDWKSLLGPPARGHFFGGCMFATDISLKYGTHQPETILETMPIEEASEIIKEKLRDEVRQELECEYGDRLYEAEEEASNWESRADDYESDATCLAKAIREAFESASFEDAKLILERAMRDHKDYF
>NZ_CP030076.1|WP_058672871.1|3867816_3868086_-|hypothetical-protein
MTIDFEVNATGIDVSTSGYRDHVNLEVRGVELSDLISEIEGKALFQEIDLDDYIDWAEAAGHIEDILERIDVDEVIAWLRSNGHLETES
>NZ_CP030076.1|WP_058672872.1|3867655_3867820_-|hypothetical-protein
MTVTHNGKQYSVKRCALNNNEWRLTSLTIPREQVTLNRWQMHVSGLLAQVEGKK
>NZ_CP030076.1|WP_023622534.1|3867455_3867659_-|phage-encoded-cell-division-inhibitor-protein
MMHHYGYVEVNRGAVRPGMLVKHKDGMWTASANKRGKLYLHRGCERTFTRELLVEVYLDGRGGGLSH
>NZ_CP030076.1|WP_058672873.1|3867136_3867451_+|hypothetical-protein
MLINKKCSSPMYSTKEMGKRSKRNHWFVREKGSDQPHDQSWYDWWKSRSLGLGKNGHIAWRSTCIARNAPDPFNPPDSFEVDFQAPDGKLYHLEFKLAPHGPNK
>NZ_CP030076.1|WP_058672874.1|3866717_3867002_-|host-nuclease-inhibitor-GamL
MNTYLTYDRIEDRLWVEQQLTDEKEKWIDDRAQQIIDMMPKEPSGLFHFSVPIDSSPYEGLRSDKAGEAYNDFISAVAYAQAEYDWEHRTGCPF
>NZ_CP030076.1|WP_176691860.1|3872195_3873608_+|AAA-family-ATPase
MTVPHSLEAEQSVLGGIMLDTGSDRCQKAMAMLKPESFYLRSHQVIFAEMRELVAKQQPVDLITLTESLEAKDLAETAGGFAYMAELSKNTPSAANIVHYAMVVREKAMERYGIDMTTKATELLYARNGMSTADKFEAIQSLFTEISDYARTGKKTGLRSFHDAVADWTEEFDERCKPNGRSRGLSSGLPSLDDLLGVKRIVRGSLFVIGARPKMGKTTLYTQMAVNCATVENEPALMFSLEMPEGQMVEKITAQQSRLTPNLFYPDMTKEDFGYRGDWDADLQKATGVMSALIDTNNLMIDDTPGIGLSHIVAEARRIKRERGKVGMVLVDYLTLMTADKAERNDLAYGLITKGLKMLAKELDCVVVLLTQLNRDLEKRTNKRPLPSDSRDTGQIEQDCDYWLAIYREGAYDETANQSETELLLRLNRHGETGVVYCQQRHGAIYDCDQEAASHRRREKEAKPAQRGGF
>NZ_CP030076.1|WP_058688299.1|3873607_3873952_+|helix-turn-helix-transcriptional-regulator
MTITIRGQILAALRNNPGLNSARIASMIGMTTKKISGPLSTLFADGLIEFEGKHGQRLYRLTSYGMKYAPETIPAMQKGNSKLVQRTEANVICQECRNSAAMKRVLMVWGRVGV
>NZ_CP030076.1|WP_058672867.1|3874816_3875098_+|hypothetical-protein
MAKFTEVHDLLTAYQKQARKIPAKGVYASKQRQKEVQAAHTRKVMRQRKRSVGKSNKLGFRRRAETTAALICEMNFWALVCRSNRKNAAKVEG
>NZ_CP030076.1|WP_058672866.1|3875101_3875764_+|DUF551-domain-containing-protein
MSTTLKEWLLKTIAELEEERDAVPGIVNEDAAMALAAMKLALASLEADVVAWTDEQELRDVEKYGCGYLFTANPVTPNADPHRVIKLYAAPPAPVSVPDEIRLLQSEVTIWKDRWELLRELFREVADALGCDLKDNQAMLDKIEMLQGAEPVSNRDELPDGWVACSERMPETAGNYWGWWSESKRQGPVWFIKSELQAQFQSSEITHWMPLPAAPQQEVK
>NZ_CP030076.1|WP_058672865.1|3875763_3876009_+|hypothetical-protein
MEIIQGTCSCGEPISIELNADPKSCGRTDRKRPFYPDENVEPEVIGQFVYSQDGVTVFRCRKCSGWIADTVPEAALEVQDA
>NZ_CP030076.1|WP_058672864.1|3876114_3876345_+|hypothetical-protein
MIIRLKATMVSDKHGFLNPVSERDIYINGDSISRFLEKEEGTLITLVDGFKTVVSEKPYEIYCKLNGIQDPTKAAY
>NZ_CP030076.1|WP_058672863.1|3876518_3876968_+|recombination-protein-NinB
MKQNFCIVNDTVKDNLIAFIRTIPVNPRAPMVVEAREETRTDKQNRLMWPLLKDLSDQVVWYGEKLTREEWKDLITVLVNQTQNQEQKSAPGINGGRVYFGVRTSKSSKRYMVDVIEAIYWFGTDRGVKFSEASSKRIAWAQEWRASRG
>NZ_CP030076.1|WP_058672862.1|3876960_3877131_+|hypothetical-protein
MGNPLARVITNHIFNVPARRKRKVAVNPSDIPTLKGYTARLVDQKWLRLAARRNHA
>NZ_CP030076.1|WP_045142307.1|3877123_3877762_+|recombination-protein-NinG
MRKPTRRTCKVCKEKFTATFDNVWWCCPEHGAIYALDLRAKQKVKEAAKRISEQKEAEKAGRKRRQEMRESLKSKSQWDKEAQSAFNRYIRIRDEGKECVSCGNPLLGKCNYLTGSAIDASHYRSRGAASHLKFNVFNVHSACTRCNRQLSGNAVEYRIRLIERIGLERVERLESDNEPRRFDIPYLQRIKSIFTRKARALEKRRARRQEAA
>NZ_CP030076.1|WP_058672860.1|3877871_3878561_+|antiterminator
MNSQQLEYVRQQLIVATADLSGATKGQLVAFAENAQFTATARSRGRKKITDPVTGRKVNPDGPPMSGSQSRAKGSSIALVGPVEFVTASWRRAVLSLEDHQKAWLLWNYSENVSFEHQVAIAQWAWAEFREQRGAKKVAGKTMERLKKLIWLAAQDVKAELAGRETYEYQALAELAGVAKSTWTETYLPHWLAMRNGFKRLDSGALISVTRSRSQQKATNLDVSLAKPN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14433

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650816.1\|124_625_+\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_044596273.1\|1034_2366_+	MFS transporter	NA	NA	NA	NA
WP_023315858.1\|2381_4418_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_003857881.1\|4524_4971_+	DUF441 domain-containing protein	NA	NA	NA	NA
WP_022650813.1\|4954_5746_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_022650812.1\|5845_7033_+	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_022650811.1\|7064_7772_-	CTP synthase	NA	NA	NA	NA
WP_003857886.1\|7922_8267_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_022650810.1\|8267_8573_-	hypothetical protein	NA	NA	NA	NA
WP_170970032.1\|8653_8917_-	DUF333 domain-containing protein	NA	NA	NA	NA
WP_023315855.1\|9220_10249_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	5.0e-13	32.1
WP_015570793.1\|10294_10393_+	YoaK family small membrane protein	NA	NA	NA	NA
WP_015570794.1\|10393_10468_+	protein YoaJ	NA	NA	NA	NA
WP_003857896.1\|10521_10770_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_071524166.1\|11140_11233_+	stress response membrane protein YncL	NA	NA	NA	NA
WP_045345722.1\|11357_12857_+	EAL domain-containing protein	NA	NA	NA	NA
WP_022650806.1\|12861_13107_-	YmjA family protein	NA	NA	NA	NA
WP_003857898.1\|13182_14433_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	7.9e-21	94.4

DBSCAN-SWA_2

17515 : 18886

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058673099.1\|17515_18886_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	8.5e-109	45.8

DBSCAN-SWA_3

24662 : 34775

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166726884.1\|24662_25811_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	6.6e-30	34.1
WP_112777650.1\|25794_26652_+	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	2.7e-12	24.8
WP_112777651.1\|26648_27440_+	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_022650796.1\|27436_28471_+	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
WP_003857915.1\|28505_29327_-	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	1.2e-22	34.6
WP_047653650.1\|29341_30253_-	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_003857918.1\|30307_31552_-	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_015570809.1\|31551_32253_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.4e-37	42.3
WP_017384712.1\|32245_33445_-	lipoprotein-releasing ABC transporter permease subunit LolC	NA	NA	NA	NA
WP_023315820.1\|33701_34775_+	acyltransferase family protein	A0A142KBN9	Gordonia_phage	1.1e-07	25.9

DBSCAN-SWA_4

39554 : 39812

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345718.1\|39554_39812_-	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	3.3e-06	38.6

DBSCAN-SWA_5

52056 : 53699

Erwinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857944.1\|52056_53061_-	DNA polymerase III subunit delta'	A0A2H4IBD4	Erwinia_phage	2.0e-06	28.4
WP_045336685.1\|53057_53699_-	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.1e-29	39.6

DBSCAN-SWA_6

56976 : 58102

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857954.1\|56976_57213_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	3.4e-10	45.2
WP_045345715.1\|57367_58102_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	8.5e-15	33.3

DBSCAN-SWA_7

72364 : 73318

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017384732.1\|72364_73318_-	flagellar assembly peptidoglycan hydrolase FlgJ	A0A160LKR7	Bacillus_phage	2.8e-10	38.0

DBSCAN-SWA_8

88418 : 88664

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858011.1\|88418_88664_+	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	4.5e-13	50.0

DBSCAN-SWA_9

93267 : 94194

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858019.1\|93267_94194_+	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	3.1e-54	41.5

DBSCAN-SWA_10

101855 : 102392

Red_sea_bream_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345703.1\|101855_102392_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	4.6e-26	41.9

DBSCAN-SWA_11

106543 : 107377

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858055.1\|106543_107377_+	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	2.3e-40	39.9

DBSCAN-SWA_12

114418 : 115207

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858070.1\|114418_115207_-	phosphate starvation-inducible protein PhoH	A0A1B2ICF6	Erwinia_phage	1.0e-90	69.5

DBSCAN-SWA_13

131821 : 134978

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858102.1\|131821_132316_+	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	1.6e-41	83.3
WP_039268798.1\|132337_133660_+	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	5.7e-211	89.0
WP_003858106.1\|133770_134691_-	DMT family transporter	NA	NA	NA	NA
WP_001273664.1\|134807_134978_-	general stress protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_14

143203 : 147844

uncultured_Caudovirales_phage(66.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777655.1\|143203_144235_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.0e-13	23.2
WP_023324419.1\|144231_144993_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.4e-12	30.4
WP_045345693.1\|145285_146914_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003858127.1\|147184_147844_+\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	2.0e-47	53.9

DBSCAN-SWA_15

152074 : 154129

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345690.1\|152074_154129_-	DNA helicase IV	A7KV33	Bacillus_phage	6.7e-17	27.8

DBSCAN-SWA_16

166618 : 171855

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006809352.1\|166618_168526_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	3.3e-50	28.5
WP_003858171.1\|168538_170647_-	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_003858174.1\|170745_171855_+	YcbX family protein	A0A0E3FP00	Synechococcus_phage	4.1e-05	35.1

DBSCAN-SWA_17

177290 : 183803

Bacillus_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858186.1\|177290_178061_+	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.5e-30	39.0
WP_022650731.1\|178164_180777_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.0e-18	21.8
WP_003858188.1\|181031_182234_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.8e-45	31.9
WP_003858191.1\|182402_183803_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	8.5e-80	37.3

DBSCAN-SWA_18

202664 : 207212

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858227.1\|202664_204413_-	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	6.7e-58	30.5
WP_045347159.1\|204449_206714_-	ComEC family protein	NA	NA	NA	NA
WP_003858233.1\|206924_207212_-	integration host factor subunit beta	A7KV42	Bacillus_phage	5.5e-10	40.2

DBSCAN-SWA_19

211388 : 212477

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858240.1\|211388_212477_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.5e-81	46.5

DBSCAN-SWA_20

216534 : 246284

Tetraselmis_virus(14.29%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858247.1\|216534_218817_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.1e-161	41.9
WP_058673083.1\|219020_219761_+	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.8e-20	26.1
WP_022650721.1\|219797_220319_-	hypothetical protein	NA	NA	NA	NA
WP_003858254.1\|220442_221591_-	MFS transporter	NA	NA	NA	NA
WP_003858256.1\|221865_222729_-	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003858259.1\|222730_223348_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.4e-74	59.1
WP_032657928.1\|223358_225803_-	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	8.9e-218	49.4
WP_003858266.1\|226014_227307_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.7e-93	45.2
WP_032608957.1\|227399_228743_-	replication-associated recombination protein RarA	G3MBE0	Bacillus_virus	1.6e-80	40.3
WP_003858270.1\|228752_229367_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_058672677.1\|229494_233160_-	DNA translocase FtsK 4TM domain-containing protein	S5VNE3	Mycobacterium_phage	2.6e-88	49.2
WP_000228469.1\|233295_233790_-	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_112777748.1\|234333_235302_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	7.9e-61	42.7
WP_045347134.1\|235416_237183_+	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	F2Y302	Organic_Lake_phycodnavirus	1.6e-11	27.4
WP_045347133.1\|237182_238904_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	F2Y2R6	Organic_Lake_phycodnavirus	1.0e-18	27.2
WP_032608953.1\|238949_239654_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_002211347.1\|239938_240157_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_045347136.1\|240228_240681_-	hypothetical protein	NA	NA	NA	NA
WP_022650716.1\|241156_243436_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.0
WP_006174393.1\|243463_243784_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	44.9
WP_006809408.1\|244051_244273_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_032608952.1\|244343_246284_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	3.8e-38	40.5

DBSCAN-SWA_21

263116 : 265819

Orgyia_leucostigma_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347125.1\|263116_265819_-	PKD domain-containing protein	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	2.6e-186	59.6

DBSCAN-SWA_22

282224 : 282953

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006809439.1\|282224_282953_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.8e-28	36.2

DBSCAN-SWA_23

286073 : 297293

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650691.1\|286073_287543_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.1e-24	30.1
WP_023324382.1\|287526_288234_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.4e-36	36.3
WP_045347176.1\|288355_289483_-	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	2.5e-29	27.2
WP_086527936.1\|289523_290021_-	YbjO family protein	NA	NA	NA	NA
WP_003858378.1\|290063_290909_-	putrescine ABC transporter permease PotI	NA	NA	NA	NA
WP_017384875.1\|290905_291859_-	putrescine ABC transporter permease PotH	NA	NA	NA	NA
WP_017693732.1\|291868_293002_-	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	6.5e-30	34.4
WP_022650689.1\|293145_294258_-	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
WP_003858385.1\|294608_295085_-	YbjN domain-containing protein	NA	NA	NA	NA
WP_045347178.1\|295148_296051_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	2.2e-36	33.6
WP_003858388.1\|296115_296838_-	nitroreductase NfsA	NA	NA	NA	NA
WP_006809455.1\|297023_297293_+	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	7.9e-27	71.8

DBSCAN-SWA_24

303650 : 305745

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038415737.1\|303650_303971_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-22	53.7
WP_045347186.1\|304011_305301_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	1.8e-169	71.7
WP_045347188.1\|305313_305745_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	9.0e-49	66.4

DBSCAN-SWA_25

311753 : 313804

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650678.1\|311753_312512_+	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	1.8e-12	26.1
WP_022650677.1\|312598_313804_-	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-98	47.2

DBSCAN-SWA_26

321289 : 323161

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324373.1\|321289_323161_-	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	4.5e-12	29.8

DBSCAN-SWA_27

326376 : 330503

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032624911.1\|326376_327039_-	fructose-6-phosphate aldolase	A0A0E3HJ81	Synechococcus_phage	2.8e-25	32.7
WP_008501194.1\|327166_328066_+	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_058672686.1\|328070_330503_+	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A076YHZ7	Citrobacter_phage	1.0e-08	49.1

DBSCAN-SWA_28

338078 : 339674

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858434.1\|338078_339674_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	9.4e-59	28.4

DBSCAN-SWA_29

344997 : 345366

Campylobacter_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032628178.1\|344997_345366_-	hypothetical protein	H6SUH4	Campylobacter_virus	4.0e-05	31.7

DBSCAN-SWA_30

353677 : 358817

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858450.1\|353677_354196_-	outer membrane protein OmpX	K7PJP9	Enterobacteria_phage	3.2e-16	31.4
WP_022650655.1\|354550_355438_+	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_000100801.1\|355736_356240_+	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	9.3e-05	24.4
WP_003858455.1\|356601_357345_+	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_003858462.1\|357438_358098_+	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_003858465.1\|358094_358817_+	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	4.7e-34	42.7

DBSCAN-SWA_31

362345 : 362999

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858470.1\|362345_362609_+	DUF1471 domain-containing protein	A0A142IIN6	Enterobacteria_phage	1.3e-05	43.8
WP_003858472.1\|362732_362999_+	DksA/TraR family C4-type zinc finger protein	E5E4B1	Acinetobacter_phage	4.9e-13	50.6

DBSCAN-SWA_32

370210 : 377474

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324351.1\|370210_372388_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	3.4e-43	26.1
WP_003858487.1\|372485_373868_-	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.7e-51	33.2
WP_003858489.1\|374072_374750_+	transcriptional regulator CecR	NA	NA	NA	NA
WP_023324350.1\|374746_375742_+	secretion protein HlyD	NA	NA	NA	NA
WP_032608898.1\|375734_377474_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.2e-20	30.5

DBSCAN-SWA_33

387092 : 388001

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023299636.1\|387092_388001_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	1.3e-25	29.3

DBSCAN-SWA_34

395225 : 398644

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052686873.1\|395225_396533_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	2.0e-19	30.2
WP_003858531.1\|396580_397057_+	kinase inhibitor	NA	NA	NA	NA
WP_045346785.1\|397123_398644_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.6e-84	39.6

DBSCAN-SWA_35

406912 : 413441

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777577.1\|406912_407971_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	3.1e-18	33.3
WP_003858545.1\|407970_408663_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_058672691.1\|408659_409436_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003858549.1\|409614_409767_-	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_112777578.1\|409894_410683_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_045346790.1\|410750_412223_+	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	2.3e-11	29.5
WP_023299622.1\|412424_413441_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	5.2e-79	45.4

DBSCAN-SWA_36

417764 : 421234

Edwardsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858564.1\|417764_418817_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	5.2e-82	48.3
WP_003858566.1\|419120_419480_+	hypothetical protein	NA	NA	NA	NA
WP_112777579.1\|419579_420518_+	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	4.4e-24	28.4
WP_022650623.1\|420514_421234_-	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	6.8e-25	36.4

DBSCAN-SWA_37

449887 : 450679

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858627.1\|449887_450679_-	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	2.0e-09	28.1

DBSCAN-SWA_38

453775 : 460139

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650613.1\|453775_455188_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	8.9e-61	33.1
WP_003858637.1\|455786_455993_-	YbfA family protein	NA	NA	NA	NA
WP_003858638.1\|456303_456393_+	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_112777581.1\|456392_458072_+	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_045345757.1\|458090_460139_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	8.4e-28	22.8

DBSCAN-SWA_39

463411 : 464089

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858643.1\|463411_464089_+	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.0e-26	29.7

DBSCAN-SWA_40

475656 : 479443

Escherichia_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315634.1\|475656_477324_-\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.0
WP_003858662.1\|477493_479443_-	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.9e-08	48.6

DBSCAN-SWA_41

484050 : 485715

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858669.1\|484050_485715_+	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	1.6e-85	39.0

DBSCAN-SWA_42

489641 : 490688

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858674.1\|489641_490688_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	6.4e-48	45.6

DBSCAN-SWA_43

496518 : 497244

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006809622.1\|496518_497244_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.1e-30	36.8

DBSCAN-SWA_44

500844 : 503427

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345767.1\|500844_503427_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.7e-182	42.1

DBSCAN-SWA_45

509818 : 512275

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032608855.1\|509818_510925_+	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	1.8e-08	51.6
WP_003858714.1\|511063_512275_+	D-alanyl-D-alanine carboxypeptidase DacA	B6DZZ7	Stx2-converting_phage	2.0e-101	49.4

DBSCAN-SWA_46

517065 : 517878

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017382474.1\|517065_517449_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.4e-24	54.6
WP_002439184.1\|517668_517878_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.2e-22	79.7

DBSCAN-SWA_47

537982 : 544346

Morganella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650588.1\|537982_538411_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	5.3e-17	36.4
WP_045345781.1\|538470_540036_-	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.4e-43	34.0
WP_003858764.1\|540278_540842_-	alkyl hydroperoxide reductase subunit C	NA	NA	NA	NA
WP_045345782.1\|542511_543735_+	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	2.6e-61	34.3
WP_022650584.1\|543719_544346_+	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	3.2e-55	51.3

DBSCAN-SWA_48

553720 : 558137

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345791.1\|553720_555223_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-17	26.5
WP_058659392.1\|555382_556471_+	oxidoreductase	NA	NA	NA	NA
WP_045345794.1\|556528_557272_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_022647393.1\|557455_557758_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_023324295.1\|557732_558137_+	helix-turn-helix transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	4.0e-06	34.1

DBSCAN-SWA_49

570066 : 574781

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650565.1\|570066_570867_+	iron-enterobactin ABC transporter ATP-binding protein	M1HQ77	Paramecium_bursaria_Chlorella_virus	8.4e-08	23.2
WP_058672697.1\|570923_574781_-	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	7.1e-60	28.7

DBSCAN-SWA_50

581055 : 589324

Brazilian_cedratvirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650559.1\|581055_581862_-	iron/manganese ABC transporter ATP-binding protein SitB	A0A2R8FG22	Brazilian_cedratvirus	1.1e-12	26.5
WP_003858820.1\|581864_582776_-	iron/manganese ABC transporter substrate-binding protein SitA	NA	NA	NA	NA
WP_032652913.1\|582987_583272_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_022650556.1\|583410_585444_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	3.4e-21	27.6
WP_003858827.1\|585572_586160_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_045345798.1\|586173_587646_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_045345799.1\|587659_589324_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	5.2e-60	31.4

DBSCAN-SWA_51

593804 : 595332

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858843.1\|593804_594641_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-13	32.0
WP_045332421.1\|594627_595332_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-21	34.8

DBSCAN-SWA_52

610452 : 613161

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045335869.1\|610452_613161_-	cation-transporting P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.7e-68	27.9

DBSCAN-SWA_53

621254 : 621542

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003858885.1\|621254_621542_-	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.9e-05	38.1

DBSCAN-SWA_54

625541 : 626513

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315563.1\|625541_626513_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.9e-25	32.6

DBSCAN-SWA_55

636897 : 637287

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345808.1\|636897_637287_-	DNA polymerase V	K7P6F7	Enterobacteria_phage	6.4e-46	65.6

DBSCAN-SWA_56

641550 : 680562

Erwinia_phage(43.64%)

integrase,terminase,capsid,plate

attL 636728:636774|attR 680576:680622

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
636728:636774	attL	NA	NA	NA	NA
WP_112777588.1\|641550_642192_-	hypothetical protein	E5AGC6	Erwinia_phage	9.3e-42	45.8
WP_112777589.1\|642191_642428_-	phosphoglycolate phosphatase	E5AGC5	Erwinia_phage	3.3e-29	81.6
WP_112777590.1\|642436_643207_-	hypothetical protein	E5AGC4	Erwinia_phage	9.3e-105	76.2
WP_111962787.1\|643184_644603_-\|plate	baseplate J/gp47 family protein	E5AGC3	Erwinia_phage	4.1e-207	77.8
WP_112777605.1\|644668_645010_-	hypothetical protein	E5AGC2	Erwinia_phage	1.3e-45	74.3
WP_112777591.1\|645077_645314_-	hypothetical protein	NA	NA	NA	NA
WP_063451575.1\|645323_645998_-	hypothetical protein	E5AGC1	Erwinia_phage	3.3e-106	83.5
WP_063451576.1\|645997_646933_-	hypothetical protein	E5AGC0	Erwinia_phage	4.1e-155	89.3
WP_006809747.1\|646907_647249_-	hypothetical protein	E5AGB9	Erwinia_phage	2.4e-52	80.5
WP_112777592.1\|647245_647962_-	hypothetical protein	E5AGB8	Erwinia_phage	8.4e-92	73.0
WP_112777593.1\|647963_649535_-	tape measure protein	E5AGB7	Erwinia_phage	3.4e-146	50.3
WP_112777594.1\|649696_650134_-	hypothetical protein	E5AGB6	Erwinia_phage	1.0e-47	67.8
WP_006809752.1\|650168_650615_-	DUF3277 family protein	E5AGB5	Erwinia_phage	1.3e-58	75.0
WP_112777595.1\|650617_651958_-	DUF3383 family protein	E5AGB4	Erwinia_phage	6.4e-194	77.1
WP_112777596.1\|651977_652517_-	hypothetical protein	E5AGB3	Erwinia_phage	6.4e-68	69.3
WP_006809755.1\|652509_652857_-	hypothetical protein	E5AGB2	Erwinia_phage	7.2e-49	82.3
WP_112777606.1\|652853_653315_-	hypothetical protein	E5AGB1	Erwinia_phage	1.1e-49	64.7
WP_112777597.1\|653305_653713_-	DUF4054 domain-containing protein	E5AGB0	Erwinia_phage	4.4e-53	75.4
WP_006809758.1\|653712_653916_-	hypothetical protein	E5AGA9	Erwinia_phage	2.9e-18	73.1
WP_112777598.1\|653948_654887_-	DUF2184 domain-containing protein	E5AGA8	Erwinia_phage	2.4e-131	75.0
WP_112777599.1\|654896_655406_-	hypothetical protein	E5AGA7	Erwinia_phage	4.8e-57	71.8
WP_112777600.1\|655405_656578_-	DUF2213 domain-containing protein	E5AGA6	Erwinia_phage	1.5e-122	59.9
WP_112777601.1\|656590_657397_-\|capsid	minor capsid protein	E5AGA5	Erwinia_phage	4.8e-96	63.5
WP_112777602.1\|657389_658646_-	DUF1073 domain-containing protein	E5AGA4	Erwinia_phage	9.1e-150	62.7
WP_112777603.1\|658654_660214_-\|terminase	phage terminase large subunit	E5AGA3	Erwinia_phage	1.7e-294	94.2
WP_045259831.1\|660210_660540_-	hypothetical protein	NA	NA	NA	NA
WP_112778006.1\|660805_661327_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.1e-92	97.7
WP_045347033.1\|661750_662128_-	DUF2570 domain-containing protein	A0A192Y6H8	Salmonella_phage	2.8e-14	39.6
WP_045347032.1\|662124_662613_-	lysozyme	A0A2H4FND7	Salmonella_phage	3.7e-83	92.6
WP_045347031.1\|662612_662885_-	hypothetical protein	A0A2H4FNF0	Salmonella_phage	2.0e-41	98.9
WP_045347030.1\|663108_663630_-	HNH endonuclease	A0A1V0E5R7	Salmonella_phage	7.0e-56	64.7
WP_045347029.1\|664220_664739_-	DUF1133 family protein	Q716B8	Shigella_phage	2.5e-85	89.5
WP_045347028.1\|664738_664921_-	hypothetical protein	C6ZR61	Salmonella_phage	3.2e-08	50.0
WP_045347027.1\|664908_665175_-	hypothetical protein	G0ZNC5	Cronobacter_phage	2.7e-27	72.6
WP_023216141.1\|665171_665567_-	RusA family crossover junction endodeoxyribonuclease	A0A0M4REJ2	Salmonella_phage	6.1e-68	94.7
WP_112777667.1\|665822_666005_-	NinF family protein	A0A0M4S6T3	Salmonella_phage	7.2e-16	66.0
WP_112777668.1\|665997_666372_-	DUF2591 family protein	A0A192Y677	Salmonella_phage	3.4e-12	36.2
WP_112777669.1\|666373_666589_-	hypothetical protein	NA	NA	NA	NA
WP_112777670.1\|666591_666768_-	NinE family protein	C6ZR57	Salmonella_phage	2.3e-19	74.1
WP_112777671.1\|666764_667175_-	recombination protein NinB	A0A0P0ZCW6	Stx2-converting_phage	3.6e-63	86.8
WP_176691847.1\|667146_667350_-	restriction alleviation protein, Lar family	NA	NA	NA	NA
WP_176691845.1\|667352_667658_-	hypothetical protein	E7C9R6	Salmonella_phage	1.6e-20	53.4
WP_176691848.1\|667904_668072_-	hypothetical protein	NA	NA	NA	NA
WP_176691849.1\|668068_668236_-	hypothetical protein	NA	NA	NA	NA
WP_112777674.1\|668539_668806_-	hypothetical protein	NA	NA	NA	NA
WP_112777675.1\|668802_670173_-	AAA family ATPase	Q9MCP7	Enterobacteria_phage	1.5e-193	75.3
WP_112777676.1\|670169_670976_-	replication protein	Q76H52	Enterobacteria_phage	3.2e-116	80.5
WP_088130987.1\|670968_671115_-	DUF2740 family protein	Q687G5	Enterobacteria_phage	8.0e-18	93.8
WP_045259811.1\|671149_671428_-	lambda phage CII family protein	A5VW96	Enterobacteria_phage	1.1e-34	82.4
WP_045347010.1\|671536_671722_-	Cro/Cl family transcriptional regulator	Q5G8T3	Enterobacteria_phage	7.8e-26	95.1
WP_045347008.1\|671805_672456_+	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	2.9e-115	93.1
WP_176691850.1\|673059_673230_+	hypothetical protein	NA	NA	NA	NA
WP_116484368.1\|673414_673639_+	DUF551 domain-containing protein	NA	NA	NA	NA
WP_176691851.1\|673845_674016_+	hypothetical protein	A0A192Y6R1	Salmonella_phage	6.5e-11	60.7
WP_176691852.1\|674012_674177_+	hypothetical protein	NA	NA	NA	NA
WP_112777678.1\|674258_674567_+	hypothetical protein	K7PJM4	Enterobacteria_phage	8.4e-25	52.9
WP_112777679.1\|674563_675454_+	recombinase RecT	K7PKG9	Enterobacteria_phage	7.4e-130	78.3
WP_112777680.1\|675453_675936_+	siphovirus Gp157 family protein	G8C7S9	Escherichia_phage	4.3e-68	84.4
WP_112777681.1\|675945_676224_+	hypothetical protein	A0A0M4R304	Salmonella_phage	1.1e-15	55.6
WP_112777682.1\|676220_676394_+	DUF2737 family protein	A0A2H4FUQ1	Salmonella_phage	1.2e-17	70.2
WP_112778007.1\|676390_676879_+	hypothetical protein	B1GS42	Salmonella_phage	8.7e-16	41.3
WP_112777684.1\|676875_677076_+	hypothetical protein	NA	NA	NA	NA
WP_112777685.1\|677072_677408_+	ead/Ea22-like family protein	NA	NA	NA	NA
WP_112777694.1\|677555_678119_+	hypothetical protein	G8C7V0	Escherichia_phage	1.9e-43	53.8
WP_112777695.1\|678326_678527_+	hypothetical protein	G8C7S1	Escherichia_phage	5.0e-10	50.0
WP_112777686.1\|678539_679169_+	Eac protein	A0A220NQT7	Salmonella_phage	6.0e-102	85.2
WP_112777688.1\|679398_680562_+\|integrase	site-specific integrase	B9UDL9	Salmonella_phage	2.9e-211	91.5
680576:680622	attR	NA	NA	NA	NA

DBSCAN-SWA_57

690170 : 691037

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006809817.1\|690170_691037_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	5.0e-30	34.5

DBSCAN-SWA_58

694775 : 696161

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045337209.1\|694775_696161_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-44	34.8

DBSCAN-SWA_59

704268 : 704955

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315548.1\|704268_704955_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-32	35.9

DBSCAN-SWA_60

708087 : 708759

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015571235.1\|708087_708759_-	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	2.7e-23	33.3

DBSCAN-SWA_61

711789 : 714288

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777689.1\|711789_714288_+	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	5.9e-108	37.2

DBSCAN-SWA_62

724265 : 729810

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324248.1\|724265_726140_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	8.6e-112	36.1
WP_006809843.1\|726250_726856_-	recombination protein RecR	NA	NA	NA	NA
WP_003858972.1\|726855_727188_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_112777691.1\|727241_729170_-	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	7.9e-44	42.9
WP_000127359.1\|729258_729810_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	45.9

DBSCAN-SWA_63

736579 : 743633

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650497.1\|736579_739726_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.4e-52	23.1
WP_006809850.1\|740236_740611_+	Hha toxicity modulator TomB	NA	NA	NA	NA
WP_015571250.1\|740638_740857_+	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_022650496.1\|741065_741617_+	maltose O-acetyltransferase	NA	NA	NA	NA
WP_022650495.1\|741733_742201_+	hypothetical protein	NA	NA	NA	NA
WP_032608667.1\|742172_743633_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.0e-15	26.8

DBSCAN-SWA_64

746672 : 750936

Herpes_simplex_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346370.1\|746672_749762_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	66.1
WP_112777692.1\|749865_750936_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.2e-88	53.4

DBSCAN-SWA_65

758084 : 761613

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346367.1\|758084_759866_-	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	4.0e-42	28.0
WP_022650483.1\|759858_761613_-	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-48	30.2

DBSCAN-SWA_66

765991 : 767357

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015571271.1\|765991_766687_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	9.3e-88	68.4
WP_022650480.1\|766690_767020_-	addiction module antidote protein	NA	NA	NA	NA
WP_045346366.1\|767006_767357_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	1.0e-13	47.6

DBSCAN-SWA_67

770513 : 775561

Sodalis_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002444653.1\|770513_770786_-	DNA-binding protein HU-beta	A3E2K9	Sodalis_phage	8.5e-21	61.8
WP_006809878.1\|770996_773351_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.7
WP_006809879.1\|773535_774810_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-132	56.8
WP_006809880.1\|774937_775561_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.2e-64	63.9

DBSCAN-SWA_68

796439 : 798101

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859098.1\|796439_796910_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.0e-29	48.0
WP_022650459.1\|796997_798101_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	2.9e-51	33.7

DBSCAN-SWA_69

801712 : 806052

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859105.1\|801712_802684_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.5e-46	40.2
WP_045346363.1\|802694_804542_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_003859109.1\|804569_804902_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
WP_003859110.1\|804924_806052_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.2e-89	46.3

DBSCAN-SWA_70

817869 : 826856

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315505.1\|817869_819165_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.2e-26	30.3
WP_003859122.1\|819186_819876_-	phosphate response regulator transcription factor PhoB	W8CYM9	Bacillus_phage	9.7e-37	37.6
WP_058673161.1\|820063_821269_+	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	1.5e-08	24.9
WP_045346357.1\|821265_824397_+	exonuclease subunit SbcC	M1U9H5	Synechococcus_phage	2.3e-08	30.1
WP_003859127.1\|824912_825818_-	fructokinase	NA	NA	NA	NA
WP_003859129.1\|825941_826856_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.2e-100	62.4

DBSCAN-SWA_71

830463 : 831567

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347337.1\|830463_831567_-	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	9.5e-18	31.4

DBSCAN-SWA_72

839480 : 840641

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859164.1\|839480_840641_+	D-alanyl-D-alanine- carboxypeptidase/endopeptidase AmpH	A0A2H4JAN9	uncultured_Caudovirales_phage	6.7e-06	22.9

DBSCAN-SWA_73

849154 : 849922

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863171.1\|849154_849922_-	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	4.7e-24	38.0

DBSCAN-SWA_74

854769 : 856554

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032608617.1\|854769_856554_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.9e-18	33.9

DBSCAN-SWA_75

860767 : 916198

Escherichia_phage(43.28%)

holin,coat,tail,integrase,lysis,transposase,terminase

attL 863907:863952|attR 912285:912330

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112778008.1\|860767_861966_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	5.1e-166	88.8
WP_071785715.1\|861958_862150_+	hypothetical protein	NA	NA	NA	NA
WP_032608610.1\|862172_862529_-	hypothetical protein	NA	NA	NA	NA
WP_032608608.1\|862531_863074_-	type IV secretion protein Rhs	NA	NA	NA	NA
WP_023315491.1\|863179_863338_-	hypothetical protein	NA	NA	NA	NA
863907:863952	attL	NA	NA	NA	NA
WP_112777927.1\|864092_864416_-	hypothetical protein	K7PGV5	Enterobacterial_phage	4.9e-23	51.4
WP_154818950.1\|864403_864643_+	hypothetical protein	NA	NA	NA	NA
WP_112778009.1\|864737_866039_-\|tail	phage tail protein	G8C7R8	Escherichia_phage	1.7e-119	55.5
WP_112777844.1\|866098_867064_-	hypothetical protein	G1CSU0	Cronobacter_virus	1.3e-58	40.2
WP_112777843.1\|867065_870965_-\|tail	phage tail protein	G8C7R4	Escherichia_phage	0.0e+00	76.3
WP_022651619.1\|871020_871620_-\|tail	tail assembly protein	G8C7R3	Escherichia_phage	3.1e-100	95.0
WP_023295179.1\|871607_872339_-	C40 family peptidase	G8C7R2	Escherichia_phage	5.3e-150	96.7
WP_176691853.1\|872351_873122_-\|tail	phage minor tail protein L	G8C7R1	Escherichia_phage	3.0e-143	94.5
WP_112777841.1\|873121_873472_-\|tail	phage tail protein	G8C7R0	Escherichia_phage	7.5e-54	91.4
WP_127341916.1\|873557_873944_-	hypothetical protein	NA	NA	NA	NA
WP_112777840.1\|874000_877174_-\|tail	phage tail tape measure protein	G8C7Q6	Escherichia_phage	0.0e+00	83.6
WP_016247126.1\|877173_877461_-	DUF1799 domain-containing protein	I6PD79	Cronobacter_phage	1.2e-17	61.5
WP_023330244.1\|877478_877817_-	hypothetical protein	G8C7Q5	Escherichia_phage	9.5e-54	92.9
WP_112777839.1\|877884_878793_-	DUF1983 domain-containing protein	G8C7Q4	Escherichia_phage	7.0e-51	66.5
WP_106105980.1\|878936_879869_-\|tail	phage tail protein	G8C7Q3	Escherichia_phage	7.9e-167	99.0
WP_112777838.1\|879915_880365_-	DUF4128 domain-containing protein	G8C7Q2	Escherichia_phage	4.6e-72	89.9
WP_048218122.1\|880354_880954_-	hypothetical protein	G8C7Q1	Escherichia_phage	2.3e-98	87.9
WP_022651630.1\|880956_881310_-	hypothetical protein	G8C7Q0	Escherichia_phage	5.4e-52	90.5
WP_048218125.1\|881311_881794_-	hypothetical protein	G8C7P9	Escherichia_phage	4.3e-84	95.6
WP_112777837.1\|881796_882054_-	hypothetical protein	G8C7P8	Escherichia_phage	9.5e-14	52.9
WP_044704670.1\|882093_883230_-\|coat	coat protein	G8C7P7	Escherichia_phage	1.1e-194	92.3
WP_112777836.1\|883246_883999_-	hypothetical protein	G8C7P6	Escherichia_phage	4.8e-130	96.0
WP_022651635.1\|884106_884316_-	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	1.0e-13	48.5
WP_109963102.1\|884319_885426_-	hypothetical protein	G8C7P5	Escherichia_phage	2.0e-185	89.4
WP_109963103.1\|885427_886831_-	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	6.8e-255	95.7
WP_109963104.1\|886835_888320_-\|terminase	terminase	A0A1W6JNY3	Morganella_phage	2.0e-252	83.3
WP_059287857.1\|888319_888835_-	hypothetical protein	A0A0H5AUE2	Pseudomonas_phage	6.7e-51	62.2
WP_105322456.1\|888838_889045_-	hypothetical protein	NA	NA	NA	NA
WP_058673082.1\|889374_889893_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.1e-92	98.8
WP_058672914.1\|890179_890662_-\|lysis	lysis protein	M9NYX9	Enterobacteria_phage	2.7e-38	57.2
WP_112777895.1\|890658_891135_-	lysozyme	K7PKX1	Enterobacterial_phage	6.0e-78	90.3
WP_001514184.1\|891138_891414_-\|holin	phage holin family protein	S4TNV9	Salmonella_phage	5.8e-09	41.0
WP_001514183.1\|891410_891812_-	hypothetical protein	NA	NA	NA	NA
WP_112777894.1\|892308_892998_-	antiterminator	I6PDF8	Cronobacter_phage	1.4e-56	51.9
WP_112777893.1\|893107_893713_-	recombination protein NinG	A0A0M4RU10	Salmonella_phage	2.2e-40	69.8
WP_112777892.1\|893705_893870_-	NinE family protein	G8C7V4	Escherichia_phage	6.1e-14	73.2
WP_112777891.1\|893862_894300_-	recombination protein NinB	Q5G8S5	Enterobacteria_phage	6.8e-44	59.2
WP_112777890.1\|894484_894766_-	hypothetical protein	NA	NA	NA	NA
WP_112777889.1\|894910_895096_-	hypothetical protein	NA	NA	NA	NA
WP_112777888.1\|895095_895377_-	hypothetical protein	A0A2D2W302	Escherichia_phage	1.6e-06	40.8
WP_112777887.1\|895376_896108_-	DUF551 domain-containing protein	A5LH60	Enterobacteria_phage	1.9e-14	36.8
WP_112777886.1\|896315_896702_-	ead/Ea22-like family protein	A0A2H4FRZ0	Salmonella_phage	6.7e-11	46.2
WP_112777885.1\|896714_897134_-	hypothetical protein	NA	NA	NA	NA
WP_112777884.1\|897130_897631_-	hypothetical protein	A0A0A6Z565	Enterobacter_phage	2.0e-07	37.6
WP_112777883.1\|897627_897909_-	hypothetical protein	S4TW48	Salmonella_phage	3.2e-15	55.3
WP_112777882.1\|897991_898336_-	transcriptional regulator	G8C7U7	Escherichia_phage	4.2e-41	73.0
WP_112777881.1\|898332_899034_-	Replication protein P	A0A0M3ULE2	Salmonella_phage	3.7e-92	70.8
WP_112777880.1\|899030_899963_-	replication protein	A5VW95	Enterobacteria_phage	1.5e-53	79.4
WP_112777879.1\|900148_900691_-	toxin YdaT domain-containing protein	M9NZI6	Enterobacteria_phage	3.3e-88	92.2
WP_001514164.1\|900721_900973_-	helix-turn-helix domain-containing protein	G8C7U2	Escherichia_phage	9.0e-17	54.7
WP_112777878.1\|901100_901793_+	helix-turn-helix transcriptional regulator	G8C7U1	Escherichia_phage	1.8e-59	52.9
WP_112777877.1\|901828_902305_+	hypothetical protein	Q5G8W9	Enterobacteria_phage	1.1e-50	64.7
WP_112777876.1\|903166_903358_+	hypothetical protein	A0A2H4FQS9	Salmonella_phage	8.3e-15	57.8
WP_112777875.1\|903403_903664_+	hypothetical protein	NA	NA	NA	NA
WP_112777874.1\|903805_904003_+	hypothetical protein	NA	NA	NA	NA
WP_176691846.1\|903999_904161_+	hypothetical protein	G8C7T3	Escherichia_phage	5.9e-22	96.2
WP_006809788.1\|904157_904367_+	cell division protein FtsZ	M9NZE2	Enterobacteria_phage	6.7e-34	95.7
WP_058659112.1\|904413_904923_+	HNH endonuclease	A0A1W6DY33	Salmonella_phage	1.3e-35	44.7
WP_045892125.1\|904919_905204_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	2.2e-48	94.7
WP_112777873.1\|905222_905969_+	phage recombination protein Bet	A0A0M4RD39	Salmonella_phage	1.8e-65	65.8
WP_112777872.1\|905965_906583_+	YqaJ viral recombinase family protein	A0A0S2SY31	Pseudomonas_phage	6.2e-59	60.2
WP_063945346.1\|906579_907008_+	hypothetical protein	M9NYX4	Enterobacteria_phage	4.9e-71	93.0
WP_165592604.1\|907004_907172_+	hypothetical protein	G8C7S7	Escherichia_phage	5.6e-23	94.5
WP_058672877.1\|907168_907720_+	phage N-6-adenine-methyltransferase	E5AGF8	Erwinia_phage	5.2e-57	60.0
WP_032652770.1\|907716_907935_+	hypothetical protein	NA	NA	NA	NA
WP_080399866.1\|907931_908204_+	DUF5405 family protein	K7P7M4	Enterobacteria_phage	4.2e-20	57.5
WP_047716558.1\|908200_908401_+	hypothetical protein	NA	NA	NA	NA
WP_058672879.1\|908397_908934_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	9.2e-35	51.0
WP_112777776.1\|909000_909222_+	TraR/DksA family transcriptional regulator	M1FQT7	Enterobacteria_phage	1.0e-16	61.1
WP_112777777.1\|909417_909657_+	DUF4222 domain-containing protein	M1FPC8	Enterobacteria_phage	5.4e-27	73.1
WP_062932837.1\|909666_909852_+	hypothetical protein	A0A1B0V7L5	Salmonella_phage	1.1e-06	52.0
WP_112777778.1\|910043_910244_+	hypothetical protein	G8C7S1	Escherichia_phage	2.2e-26	84.8
WP_112777779.1\|910254_910584_+	hypothetical protein	G9L655	Escherichia_phage	3.5e-21	52.1
WP_176691854.1\|910620_910785_+	hypothetical protein	NA	NA	NA	NA
WP_112777780.1\|911109_912270_+\|integrase	site-specific integrase	K7P7R5	Enterobacteria_phage	3.1e-213	92.7
WP_045347085.1\|912471_913725_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.2e-96	46.1
912285:912330	attR	NA	NA	NA	NA
WP_045347084.1\|913736_914840_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-59	39.9
WP_003863199.1\|915145_916198_+	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.6e-118	60.9

DBSCAN-SWA_76

929401 : 929980

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863232.1\|929401_929980_-	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.5e-14	31.4

DBSCAN-SWA_77

935739 : 937989

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315468.1\|935739_937989_+	type I secretion system permease/ATPase	F2Y2R6	Organic_Lake_phycodnavirus	5.2e-23	33.5

DBSCAN-SWA_78

947235 : 947943

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347081.1\|947235_947943_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-32	36.6

DBSCAN-SWA_79

957715 : 961588

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777781.1\|957715_961588_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	4.3e-25	35.5

DBSCAN-SWA_80

981525 : 985730

Bradyrhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006810012.1\|981525_982266_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.0e-39	39.5
WP_160840538.1\|982210_982789_+	ribonuclease HI	J9Q745	Salmonella_phage	6.4e-50	58.4
WP_048209360.1\|982789_983506_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_022650425.1\|983538_984297_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_022650424.1\|984365_985730_+	murein transglycosylase D	A0A2H4J9N7	uncultured_Caudovirales_phage	9.9e-09	36.0

DBSCAN-SWA_81

989786 : 990590

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315437.1\|989786_990590_-	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	2.7e-38	35.8

DBSCAN-SWA_82

997256 : 998288

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856124.1\|997256_998288_+	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_83

1010252 : 1014370

Saccharomonospora_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777536.1\|1010252_1013735_-	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.7e-207	36.5
WP_003856158.1\|1013773_1014370_-	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	4.6e-27	40.8

DBSCAN-SWA_84

1023196 : 1023955

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856176.1\|1023196_1023955_-	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	1.4e-25	43.0

DBSCAN-SWA_85

1035313 : 1036747

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856219.1\|1035313_1036747_-\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.5e-26	29.2

DBSCAN-SWA_86

1040682 : 1041027

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856230.1\|1040682_1041027_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.5e-27	51.4

DBSCAN-SWA_87

1046933 : 1047731

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856242.1\|1046933_1047731_-	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	4.6e-14	27.4

DBSCAN-SWA_88

1052899 : 1059673

Acanthamoeba_polyphaga_mimivirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346806.1\|1052899_1055329_-	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	5.3e-37	30.6
WP_003856249.1\|1055402_1055957_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_003856251.1\|1055946_1056651_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_001155232.1\|1056827_1057283_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_023324171.1\|1057342_1058233_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_086527962.1\|1058248_1059673_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	1.6e-25	31.5

DBSCAN-SWA_89

1072244 : 1078785

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856300.1\|1072244_1073171_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-22	32.3
WP_003856301.1\|1073278_1073941_+	carbonate dehydratase	NA	NA	NA	NA
WP_003856303.1\|1074005_1074542_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.3e-17	33.1
WP_045346602.1\|1074748_1077139_+	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
WP_045346601.1\|1077225_1078785_-	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	3.2e-19	57.6

DBSCAN-SWA_90

1087026 : 1088451

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856313.1\|1087026_1088451_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.5e-41	27.3

DBSCAN-SWA_91

1099391 : 1099955

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059291335.1\|1099391_1099955_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	6.7e-12	33.1

DBSCAN-SWA_92

1104146 : 1105190

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017383777.1\|1104146_1105190_-	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.1e-103	56.6

DBSCAN-SWA_93

1131141 : 1132866

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856373.1\|1131141_1132866_-	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	4.9e-37	26.7

DBSCAN-SWA_94

1145651 : 1146353

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032608486.1\|1145651_1146353_+	thiamine ABC transporter ATP-binding protein ThiQ	G9BWD6	Planktothrix_phage	1.1e-22	34.5

DBSCAN-SWA_95

1152626 : 1158018

Yellowstone_lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324143.1\|1152626_1154984_+	DNA polymerase II	A0A0P0YM26	Yellowstone_lake_phycodnavirus	1.4e-29	25.7
WP_045346581.1\|1155111_1158018_+	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	4.9e-21	36.6

DBSCAN-SWA_96

1165656 : 1167024

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324139.1\|1165656_1166505_+	bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH	A0A0A0YWI7	Pseudomonas_phage	4.9e-06	42.3
WP_032608478.1\|1166544_1167024_-	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	1.2e-28	42.5

DBSCAN-SWA_97

1176560 : 1177709

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346579.1\|1176560_1177709_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	5.4e-48	31.9

DBSCAN-SWA_98

1181208 : 1195036

Megavirus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347306.1\|1181208_1184025_-\|tRNA	isoleucine--tRNA ligase	K7YVP8	Megavirus	3.8e-79	25.5
WP_003856456.1\|1184070_1184997_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_003856458.1\|1185325_1185589_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_045347307.1\|1185647_1186547_-	transcriptional activator NhaR	NA	NA	NA	NA
WP_023315366.1\|1186605_1187781_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	4.7e-84	53.7
WP_008502040.1\|1187954_1189100_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.1e-24	35.3
WP_045347309.1\|1189187_1191101_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.8e-147	50.6
WP_003856474.1\|1191396_1191963_+	acetate uptake transporter	NA	NA	NA	NA
WP_045347310.1\|1191939_1193262_-	MFS transporter	NA	NA	NA	NA
WP_003856479.1\|1193384_1193972_-	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_003856481.1\|1194082_1195036_-	transaldolase	A0A127KNC6	Cyanophage	5.7e-11	32.1

DBSCAN-SWA_99

1208436 : 1215699

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347322.1\|1208436_1210374_-	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	3.6e-12	36.2
WP_003856515.1\|1210600_1212268_+	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	1.1e-41	26.6
WP_022650376.1\|1212359_1213259_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045344267.1\|1213367_1214369_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_003856522.1\|1214466_1215699_-	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.4e-88	44.4

DBSCAN-SWA_100

1224646 : 1225969

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777528.1\|1224646_1225969_-	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.2e-78	39.8

DBSCAN-SWA_101

1231428 : 1234227

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856556.1\|1231428_1231590_-	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	3.0e-13	69.8
WP_003856559.1\|1231715_1232333_-	molecular chaperone OsmY	NA	NA	NA	NA
WP_003856562.1\|1232637_1234227_-	peptide chain release factor 3	D0R0F5	Streptococcus_phage	7.0e-30	26.0

DBSCAN-SWA_102

1237965 : 1239030

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777527.1\|1237965_1239030_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.4e-20	36.9

DBSCAN-SWA_103

1246294 : 1247574

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856579.1\|1246294_1246840_+	primosomal protein DnaT	T1SA92	Salmonella_phage	4.4e-24	56.4
WP_003856580.1\|1246836_1247574_+	DNA replication protein DnaC	A0A1W6JP39	Morganella_phage	7.1e-62	48.1

DBSCAN-SWA_104

1251305 : 1252970

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856589.1\|1251305_1252970_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-14	30.4

DBSCAN-SWA_105

1292121 : 1299234

Bacillus_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863062.1\|1292121_1292727_-\|protease	ATP-dependent Clp protease proteolytic subunit	G3M9Z8	Bacillus_virus	7.2e-28	39.8
WP_003863061.1\|1293027_1293645_+	response regulator transcription factor	NA	NA	NA	NA
WP_045345970.1\|1293648_1299234_-	AAA family ATPase	Q67624	IC4_retrovirus	3.4e-07	33.3

DBSCAN-SWA_106

1305019 : 1307925

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345967.1\|1305019_1305841_+	alpha/beta hydrolase	A0A249XMC3	Mycobacterium_phage	4.3e-15	28.4
WP_022650329.1\|1305972_1307925_+	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	2.6e-26	30.2

DBSCAN-SWA_107

1320875 : 1322171

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777524.1\|1320875_1321319_-	antirestriction protein	A9J566	Pseudomonas_phage	5.1e-15	30.1
WP_112777523.1\|1321349_1322171_-	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	8.8e-45	37.3

DBSCAN-SWA_108

1329780 : 1332243

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777517.1\|1329780_1332243_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	7.9e-73	35.7

DBSCAN-SWA_109

1337053 : 1344699

Liberibacter_phage(33.33%)

integrase

attL 1323586:1323599|attR 1346052:1346065

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1323586:1323599	attL	NA	NA	NA	NA
WP_112777513.1\|1337053_1340149_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	4.2e-55	28.5
WP_112777512.1\|1340148_1340862_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_112777511.1\|1340907_1342389_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	5.6e-58	33.1
WP_102014686.1\|1342381_1342984_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_001003202.1\|1343000_1343189_-	hypothetical protein	NA	NA	NA	NA
WP_102014685.1\|1343451_1344699_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	2.1e-82	43.5
1346052:1346065	attR	NA	NA	NA	NA

DBSCAN-SWA_110

1363071 : 1373248

Paramecium_bursaria_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863368.1\|1363071_1364004_+	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-52	40.2
WP_003863370.1\|1364016_1364478_+	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
WP_003863373.1\|1364551_1364938_+	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
WP_045345904.1\|1365076_1366525_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.1e-21	36.1
WP_045345903.1\|1366619_1369004_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_112777537.1\|1369204_1371913_-	magnesium-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	2.6e-37	25.1
WP_023315291.1\|1372300_1373248_+	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	1.2e-13	22.1

DBSCAN-SWA_111

1378455 : 1381199

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863406.1\|1378455_1380594_+	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.7e-268	64.9
WP_003856093.1\|1380734_1381199_+	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	2.3e-50	55.2

DBSCAN-SWA_112

1394609 : 1402766

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856070.1\|1394609_1395608_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	3.7e-69	43.0
WP_044704215.1\|1395648_1397217_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.4e-08	27.4
WP_023302976.1\|1397310_1398312_-	sugar ABC transporter permease YjfF	NA	NA	NA	NA
WP_161353898.1\|1398298_1399324_-	ABC transporter permease	NA	NA	NA	NA
WP_017383923.1\|1399334_1400837_-	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.0e-10	28.8
WP_017383924.1\|1400969_1401926_-	galactofuranose ABC transporter substrate-binding protein YtfQ	NA	NA	NA	NA
WP_006810347.1\|1402235_1402766_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.6e-55	62.7

DBSCAN-SWA_113

1419375 : 1421025

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856047.1\|1419375_1421025_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-10	30.7

DBSCAN-SWA_114

1437031 : 1438963

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058672828.1\|1437031_1438963_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	36.2

DBSCAN-SWA_115

1442938 : 1455924

Lactococcus_phage(20.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315260.1\|1442938_1445380_-	ribonuclease R	Q0GXV6	Lactococcus_phage	8.4e-67	32.2
WP_003855998.1\|1445418_1445844_-	nitric oxide-sensing transcriptional repressor NsrR	NA	NA	NA	NA
WP_003855997.1\|1446036_1447335_-	adenylosuccinate synthase	W5S5V7	Pithovirus	6.4e-66	35.4
WP_003855996.1\|1447439_1447637_-	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_003855994.1\|1447708_1448713_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_003855992.1\|1448715_1449975_-\|protease	FtsH protease activity modulator HflK	A0A1L2CVV0	Pectobacterium_phage	3.6e-05	25.5
WP_003855991.1\|1450031_1451312_-	GTPase HflX	NA	NA	NA	NA
WP_003855990.1\|1451386_1451698_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_058672827.1\|1451783_1452734_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_022650252.1\|1452726_1454571_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.2e-59	30.4
WP_023315257.1\|1454580_1455924_-	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	2.6e-17	30.1

DBSCAN-SWA_116

1459840 : 1460386

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347143.1\|1459840_1460386_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-29	41.0

DBSCAN-SWA_117

1467669 : 1468647

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003855960.1\|1467669_1468647_-	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	5.8e-27	28.8

DBSCAN-SWA_118

1474592 : 1475123

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003855945.1\|1474592_1475123_+	lipocalin family protein	A0A1W6JNX6	Morganella_phage	3.3e-45	51.6

DBSCAN-SWA_119

1481413 : 1483394

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003855930.1\|1481413_1483060_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	6.9e-190	69.3
WP_003855929.1\|1483100_1483394_-	co-chaperone GroES	K4F9I2	Cronobacter_phage	2.1e-12	43.3

DBSCAN-SWA_120

1500231 : 1501734

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860199.1\|1500231_1501734_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	5.9e-55	32.0

DBSCAN-SWA_121

1508250 : 1509039

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860210.1\|1508250_1509039_+	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.9e-14	28.7

DBSCAN-SWA_122

1514589 : 1516035

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860225.1\|1514589_1515345_+	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	6.1e-16	26.7
WP_003860227.1\|1515354_1516035_+	phosphonate C-P lyase system protein PhnL	F2Y1V6	Organic_Lake_phycodnavirus	3.5e-07	26.0

DBSCAN-SWA_123

1521818 : 1523333

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860238.1\|1521818_1523333_+	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	7.2e-08	24.0

DBSCAN-SWA_124

1527908 : 1531044

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860246.1\|1527908_1528640_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-26	37.7
WP_080339333.1\|1528896_1531044_+	formate dehydrogenase subunit alpha	A0A077SK27	Escherichia_phage	3.2e-30	24.2

DBSCAN-SWA_125

1534134 : 1536093

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346543.1\|1534134_1536093_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.0e-91	41.1

DBSCAN-SWA_126

1542111 : 1543461

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860271.1\|1542111_1543461_-	guanine/hypoxanthine transporter GhxP	A0A0R6PHV4	Moraxella_phage	3.0e-159	72.0

DBSCAN-SWA_127

1549648 : 1553247

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860284.1\|1549648_1550173_-	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	5.1e-54	96.3
WP_045346547.1\|1550424_1553247_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.8

DBSCAN-SWA_128

1556411 : 1558920

Yellowstone_lake_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032608247.1\|1556411_1557491_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.6e-30	28.6
WP_003860298.1\|1557507_1558920_-	replicative DNA helicase	O80281	Escherichia_phage	8.2e-200	78.3

DBSCAN-SWA_129

1565980 : 1566589

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346553.1\|1565980_1566589_-	repressor LexA	Q9G0C2	Lactococcus_phage	2.7e-14	40.7

DBSCAN-SWA_130

1573688 : 1574798

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860329.1\|1573688_1574798_-	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_131

1589546 : 1595571

Brucella_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315213.1\|1589546_1589849_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.9e-22	53.8
WP_022650216.1\|1589855_1590143_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.2e-12	44.3
WP_003860350.1\|1590139_1591771_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_045346557.1\|1591887_1595571_-	methionine synthase	A0A140XBC7	Dickeya_phage	2.2e-26	91.8

DBSCAN-SWA_132

1608173 : 1613585

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347373.1\|1608173_1609763_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.4e-67	48.4
WP_022650211.1\|1609778_1611071_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_045347371.1\|1611118_1611811_-	DUF1481 domain-containing protein	NA	NA	NA	NA
WP_002445246.1\|1611822_1612095_-	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	1.2e-19	56.7
WP_003862310.1\|1612281_1612872_-	YjaG family protein	NA	NA	NA	NA
WP_003862312.1\|1612913_1613585_-	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	1.3e-22	30.1

DBSCAN-SWA_133

1622005 : 1632738

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058672882.1\|1622005_1623547_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.3e-12	34.4
WP_010425948.1\|1623727_1624036_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003862327.1\|1624035_1624353_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_022650200.1\|1624409_1628633_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	4.5e-68	27.4
WP_008503453.1\|1628709_1632738_-	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	3.6e-22	29.4

DBSCAN-SWA_134

1636727 : 1641776

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023323999.1\|1636727_1637912_-	elongation factor Tu	A0A2K9L516	Tupanvirus	2.6e-13	26.5
WP_015569977.1\|1638789_1639740_+	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.1e-27	32.0
WP_022650198.1\|1639782_1640796_-	dipeptide ABC transporter ATP binding subunit DppF	G3M9Y6	Bacillus_virus	4.3e-17	29.4
WP_022650197.1\|1640792_1641776_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-14	28.9

DBSCAN-SWA_135

1651322 : 1653692

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345998.1\|1651322_1653692_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	2.4e-71	30.2

DBSCAN-SWA_136

1658870 : 1663346

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315194.1\|1658870_1659845_+	glyoxylate/hydroxypyruvate reductase GhrB	M1HTA3	Paramecium_bursaria_Chlorella_virus	2.8e-21	27.7
WP_003860775.1\|1659903_1660116_-	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	1.2e-22	74.3
WP_017383576.1\|1660359_1661070_-	DUF3053 domain-containing protein	NA	NA	NA	NA
WP_003860776.1\|1661400_1661688_+	HTH-type transcriptional regulator	NA	NA	NA	NA
WP_045345999.1\|1661726_1663346_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	4.0e-25	26.1

DBSCAN-SWA_137

1667281 : 1670572

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777618.1\|1667281_1668052_-	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.9e-25	31.3
WP_112777617.1\|1668054_1668597_-	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_003860787.1\|1668600_1668855_-	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_022650180.1\|1668931_1670572_-	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	1.7e-42	28.4

DBSCAN-SWA_138

1682917 : 1684747

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860800.1\|1682917_1684747_-	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	1.3e-83	37.4

DBSCAN-SWA_139

1688673 : 1692534

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017383586.1\|1688673_1690836_-	DNA helicase II	A7KV33	Bacillus_phage	2.5e-115	37.2
WP_003860811.1\|1690915_1691632_-	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
WP_015570006.1\|1691631_1692534_-	tyrosine recombinase XerC	A0A1B1IQT7	uncultured_Mediterranean_phage	2.0e-18	29.4

DBSCAN-SWA_140

1710283 : 1714482

uncultured_marine_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032608214.1\|1710283_1711414_-	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	5.1e-19	33.5
WP_022650165.1\|1711418_1712096_-	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
WP_022650164.1\|1712092_1713355_-	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	1.5e-22	26.4
WP_006812390.1\|1713351_1714482_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.4e-27	30.2

DBSCAN-SWA_141

1718545 : 1730471

Indivirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006812392.1\|1718545_1718875_-	thioredoxin TrxA	A0A1V0SD63	Indivirus	2.5e-14	38.5
WP_003860827.1\|1719019_1720288_+	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	2.2e-42	31.4
WP_032661064.1\|1720294_1721779_+	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
WP_003860830.1\|1721829_1723854_-	DNA helicase Rep	A7KV33	Bacillus_phage	5.8e-114	37.5
WP_006812396.1\|1723939_1724221_+	peptidylprolyl isomerase PpiC	NA	NA	NA	NA
WP_022646641.1\|1724275_1725097_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_006812398.1\|1725172_1726192_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003860835.1\|1726191_1726659_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_112777616.1\|1726690_1726942_-	glutaredoxin 3	A0A141ZMK2	Faustovirus	3.8e-07	38.2
WP_003860840.1\|1726953_1727385_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_045346009.1\|1727633_1729178_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_045346010.1\|1729187_1730471_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	4.6e-08	35.4

DBSCAN-SWA_142

1734587 : 1737968

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017383610.1\|1734587_1735616_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8
WP_045346016.1\|1735625_1736822_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	4.6e-34	27.8
WP_045332960.1\|1737035_1737968_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	2.9e-36	36.4

DBSCAN-SWA_143

1747660 : 1755259

Catovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058659935.1\|1747660_1748650_+	glycosyltransferase	A0A1V0SAH6	Catovirus	7.2e-09	27.3
WP_003860874.1\|1748716_1749991_+	lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_003860875.1\|1749990_1750761_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_023315165.1\|1750764_1751244_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.4e-26	43.9
WP_003860879.1\|1751246_1752056_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	1.2e-25	32.6
WP_003024094.1\|1752128_1752296_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002436699.1\|1752318_1752555_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_006812419.1\|1752772_1753438_-	DNA repair protein RadC	NA	NA	NA	NA
WP_086532025.1\|1753611_1754823_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	5.1e-41	32.6
WP_015570042.1\|1754800_1755259_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	1.2e-48	60.8

DBSCAN-SWA_144

1767725 : 1772734

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058673178.1\|1767725_1769396_-	NAD-dependent DNA ligase LigB	A0A218MKC8	uncultured_virus	1.1e-20	23.3
WP_006177710.1\|1769646_1770270_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	9.7e-20	35.0
WP_000135058.1\|1770324_1770600_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_003860921.1\|1770619_1772734_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5

DBSCAN-SWA_145

1776944 : 1778336

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015570053.1\|1776944_1778336_+	xanthine/proton symporter XanP	H9YQ34	environmental_Halophage	2.3e-69	95.9

DBSCAN-SWA_146

1784500 : 1793657

uncultured_Caudovirales_phage(60.0%)

integrase

attL 1776281:1776294|attR 1786526:1786539

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1776281:1776294	attL	NA	NA	NA	NA
WP_044599767.1\|1784500_1785724_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	5.5e-160	69.4
WP_044599768.1\|1785819_1787445_-	ATP-dependent helicase	Q331U3	Clostridium_botulinum_C_phage	1.1e-09	21.9
1786526:1786539	attR	NA	NA	NA	NA
WP_112777615.1\|1787446_1789147_-	AAA family ATPase	NA	NA	NA	NA
WP_039272869.1\|1789352_1789703_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	1.8e-23	50.9
WP_044599769.1\|1789750_1790113_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_046377360.1\|1790130_1791882_+	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_044599770.1\|1791929_1793219_+	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.6e-170	73.8
WP_044599771.1\|1793231_1793657_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	1.0e-52	73.6

DBSCAN-SWA_147

1797122 : 1800369

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023305188.1\|1797122_1797836_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	9.5e-96	72.6
WP_044599782.1\|1797837_1798161_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_108454447.1\|1798291_1798687_-	hypothetical protein	NA	NA	NA	NA
WP_044599776.1\|1798795_1799815_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_023315141.1\|1800165_1800369_-	AlpA family phage regulatory protein	A0A1V0E8E5	Vibrio_phage	7.5e-06	41.1

DBSCAN-SWA_148

1804256 : 1805078

Yersinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044599778.1\|1804256_1805078_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.8e-45	38.0

DBSCAN-SWA_149

1809265 : 1810294

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072021525.1\|1809265_1810294_+	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	8.7e-74	44.0

DBSCAN-SWA_150

1821792 : 1825967

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860954.1\|1821792_1822317_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	9.9e-50	58.9
WP_023323942.1\|1822434_1823160_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	5.2e-41	42.7
WP_045346043.1\|1823259_1823670_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_022650125.1\|1823772_1824732_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_006812462.1\|1824878_1825967_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	3.9e-125	62.2

DBSCAN-SWA_151

1831260 : 1833357

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017383654.1\|1831260_1833357_-	peptidase domain-containing ABC transporter	F2Y1V5	Organic_Lake_phycodnavirus	3.9e-12	23.9

DBSCAN-SWA_152

1859747 : 1860905

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346062.1\|1859747_1860905_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.3e-28	26.6

DBSCAN-SWA_153

1871872 : 1872877

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315093.1\|1871872_1872877_-	alpha/beta hydrolase	A0A2K9KZN8	Tupanvirus	2.6e-06	28.4

DBSCAN-SWA_154

1878334 : 1880023

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861056.1\|1878334_1880023_-	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	2.6e-59	31.5

DBSCAN-SWA_155

1883263 : 1884448

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861070.1\|1883263_1884448_+	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	1.6e-15	25.6

DBSCAN-SWA_156

1895834 : 1896810

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861091.1\|1895834_1896263_-	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	1.1e-14	37.3
WP_003861094.1\|1896399_1896810_-	heat shock chaperone IbpA	A0A218MKI2	uncultured_virus	5.4e-19	39.2

DBSCAN-SWA_157

1900254 : 1901403

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861103.1\|1900254_1901403_-	galactonate dehydratase	Q6A202	Oenococcus_phage	9.4e-53	33.1

DBSCAN-SWA_158

1906825 : 1914213

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861119.1\|1906825_1909237_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.1e-114	34.2
WP_112778010.1\|1909265_1910339_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003861122.1\|1910338_1911439_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.5e-52	35.0
WP_003861124.1\|1911443_1912838_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_000831330.1\|1913475_1913616_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_003861126.1\|1913632_1913992_+	ribonuclease P protein component	NA	NA	NA	NA
WP_001307474.1\|1913955_1914213_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7

DBSCAN-SWA_159

1921081 : 1927935

Moraxella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139156836.1\|1921081_1922419_-	adenine permease AdeP	A0A0R6PHV4	Moraxella_phage	4.3e-65	37.6
WP_003861151.1\|1922584_1923250_+	6-phosphogluconate phosphatase	NA	NA	NA	NA
WP_003861153.1\|1923344_1924070_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_003861154.1\|1924096_1924870_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
WP_003861156.1\|1924917_1925808_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003861158.1\|1925807_1926767_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_022652104.1\|1926894_1927935_-	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.3e-48	38.7

DBSCAN-SWA_160

1933567 : 1937008

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023323908.1\|1933567_1935397_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.2e-131	42.9
WP_022652099.1\|1935637_1937008_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	2.9e-32	33.2

DBSCAN-SWA_161

1948791 : 1949784

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862385.1\|1948791_1949784_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	3.5e-48	37.0

DBSCAN-SWA_162

1952948 : 1960897

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862390.1\|1952948_1954817_+	low affinity potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	2.3e-64	29.7
WP_003862392.1\|1955042_1955462_+	D-ribose pyranase	NA	NA	NA	NA
WP_003862393.1\|1955469_1956975_+	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	7.6e-18	21.7
WP_003862395.1\|1956979_1957945_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_003862397.1\|1957972_1958863_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	3.3e-05	23.7
WP_003862399.1\|1958971_1959901_+	ribokinase	NA	NA	NA	NA
WP_003862402.1\|1959904_1960897_+	ribose operon transcriptional repressor RbsR	C6ZCU4	Enterobacteria_phage	1.1e-36	33.7

DBSCAN-SWA_163

1973032 : 1975825

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346518.1\|1973032_1975825_+	DNA polymerase I	A0A1B1IWN2	uncultured_Mediterranean_phage	8.4e-55	27.6

DBSCAN-SWA_164

1979696 : 1982170

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861919.1\|1979696_1981109_-	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	1.1e-05	27.9
WP_003861923.1\|1981120_1982170_-	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	3.4e-09	26.1

DBSCAN-SWA_165

1993875 : 1996653

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861941.1\|1993875_1994766_-	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	2.1e-63	94.6
WP_045346523.1\|1994921_1995818_+	sugar kinase	NA	NA	NA	NA
WP_003861944.1\|1995852_1996653_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.1e-23	30.5

DBSCAN-SWA_166

2017757 : 2019260

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861985.1\|2017757_2019260_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-11	25.7

DBSCAN-SWA_167

2027440 : 2030923

Bacillus_thuringiensis_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861999.1\|2027440_2028061_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	2.2e-64	59.8
WP_003862001.1\|2028127_2028802_+	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
WP_015569937.1\|2028854_2030228_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	7.2e-15	25.6
WP_058672770.1\|2030224_2030923_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	2.4e-06	30.3

DBSCAN-SWA_168

2042780 : 2047244

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862030.1\|2042780_2043626_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	7.5e-15	28.7
WP_003862031.1\|2044025_2044265_+	septal ring assembly protein ZapB	NA	NA	NA	NA
WP_003862032.1\|2044345_2044831_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_086531981.1\|2044923_2045850_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_003862035.1\|2045912_2047244_-	HslU--HslV peptidase ATPase subunit	A0A173GE36	Erwinia_phage	1.9e-44	29.7

DBSCAN-SWA_169

2062576 : 2065755

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315033.1\|2062576_2063239_-	fructose-6-phosphate aldolase	A0A0E3FJJ0	Synechococcus_phage	2.2e-30	34.6
WP_045346529.1\|2063253_2065755_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.9e-11	25.9

DBSCAN-SWA_170

2084738 : 2086589

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346533.1\|2084738_2086589_+	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	1.0e-11	28.4

DBSCAN-SWA_171

2096669 : 2098316

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346812.1\|2096669_2098316_+	acetolactate synthase 2 catalytic subunit	A0A0P0CRC5	Ostreococcus_lucimarinus_virus	1.5e-64	31.9

DBSCAN-SWA_172

2124118 : 2125957

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023315017.1\|2124118_2125957_+	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	6.9e-13	25.1

DBSCAN-SWA_173

2149218 : 2150760

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015572746.1\|2149218_2150760_-	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-15	29.3

DBSCAN-SWA_174

2155085 : 2156081

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346826.1\|2155085_2156081_-	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	1.8e-12	24.3

DBSCAN-SWA_175

2164808 : 2165423

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023323863.1\|2164808_2165423_+	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	6.2e-19	34.0

DBSCAN-SWA_176

2211792 : 2213835

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032608085.1\|2211792_2213835_+	oligopeptidase A	A0A1V0SD92	Indivirus	5.2e-46	22.9

DBSCAN-SWA_177

2218811 : 2219837

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015571505.1\|2218811_2219837_+	TerC/Alx family metal homeostasis membrane protein	K7QKE8	Escherichia_phage	2.1e-75	47.7

DBSCAN-SWA_178

2239027 : 2240105

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861274.1\|2239027_2239693_-	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	3.3e-58	55.3
WP_000130627.1\|2239862_2240105_+	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	6.0e-10	80.6

DBSCAN-SWA_179

2243219 : 2246094

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023323839.1\|2243219_2245391_-	Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA	E4ZFI9	Streptococcus_phage	9.9e-120	37.3
WP_003861515.1\|2245467_2246094_-	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	2.9e-32	63.7

DBSCAN-SWA_180

2249098 : 2253322

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861525.1\|2249098_2249770_+	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	3.9e-14	26.6
WP_003861527.1\|2249756_2250812_+	cell division protein FtsX	NA	NA	NA	NA
WP_000159624.1\|2251062_2251920_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	9.2e-45	42.3
WP_023323836.1\|2252056_2253322_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	3.7e-26	27.8

DBSCAN-SWA_181

2258898 : 2260378

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861544.1\|2258898_2259663_+	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	W6JKT0	Anomala_cuprea_entomopoxvirus	2.8e-13	26.0
WP_022651964.1\|2259664_2260378_+	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	1.1e-14	31.2

DBSCAN-SWA_182

2263779 : 2265587

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861554.1\|2263779_2264850_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.2e-21	32.5
WP_022651961.1\|2264846_2265587_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	9.2e-09	24.1

DBSCAN-SWA_183

2282707 : 2285155

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345656.1\|2282707_2285155_+	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	1.2e-33	83.3

DBSCAN-SWA_184

2288232 : 2288991

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861593.1\|2288232_2288991_+	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.8e-21	30.3

DBSCAN-SWA_185

2292331 : 2294725

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058659682.1\|2292331_2294725_+	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	4.7e-14	41.4

DBSCAN-SWA_186

2299877 : 2300660

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861604.1\|2299877_2300660_+	pimeloyl-ACP methyl ester esterase BioH	A0A0M3UKI8	Mycobacterium_phage	3.1e-07	32.0

DBSCAN-SWA_187

2306897 : 2310677

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001157751.1\|2306897_2307617_+	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	3.5e-29	34.7
WP_003861615.1\|2307613_2308960_+	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	2.5e-12	24.1
WP_003861616.1\|2309057_2310677_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	5.5e-139	51.7

DBSCAN-SWA_188

2327459 : 2328272

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861633.1\|2327459_2328272_+	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	2.7e-70	50.2

DBSCAN-SWA_189

2338520 : 2345066

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861654.1\|2338520_2339084_+	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	5.1e-60	56.5
WP_003861656.1\|2339171_2340392_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_045345633.1\|2340388_2342476_-	FUSC family protein	H9YQA8	environmental_Halophage	2.0e-64	84.8
WP_000242758.1\|2342533_2343166_-	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_045345632.1\|2343476_2343881_+	OsmC family protein	NA	NA	NA	NA
WP_003861663.1\|2343947_2344817_-	phosphoribulokinase	NA	NA	NA	NA
WP_014171926.1\|2344847_2345066_-	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	1.1e-05	39.1

DBSCAN-SWA_190

2350884 : 2356252

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314938.1\|2350884_2351844_+	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	9.9e-56	93.5
WP_003861679.1\|2351846_2352464_+	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
WP_003861680.1\|2352463_2353360_+	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
WP_112777665.1\|2353399_2354332_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003861684.1\|2354347_2356252_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	5.9e-76	33.5

DBSCAN-SWA_191

2364059 : 2367428

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651946.1\|2364059_2366174_+	elongation factor G	E4ZFJ7	Streptococcus_phage	1.8e-57	27.5
WP_022651945.1\|2366243_2367428_+	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1

DBSCAN-SWA_192

2387314 : 2391639

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045344242.1\|2387314_2388262_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	8.4e-07	30.5
WP_006812188.1\|2388286_2388796_-	peptide deformylase	E3SLL2	Synechococcus_phage	3.3e-18	40.3
WP_045347425.1\|2388923_2390048_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_000460665.1\|2390019_2390493_+	DUF494 domain-containing protein	NA	NA	NA	NA
WP_022651940.1\|2390519_2391074_+	topoisomerase DNA-binding C4 zinc finger domain-containing protein	NA	NA	NA	NA
WP_003863353.1\|2391066_2391639_+	L-threonylcarbamoyladenylate synthase type 1 TsaC	S4VW33	Pandoravirus	1.9e-09	25.7

DBSCAN-SWA_193

2405052 : 2407137

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860371.1\|2405052_2407137_-	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	7.0e-22	34.8

DBSCAN-SWA_194

2420391 : 2421435

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000913396.1\|2420391_2421435_+	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_195

2440292 : 2441660

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860431.1\|2440292_2441660_-\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-21	26.4

DBSCAN-SWA_196

2445623 : 2449625

Pseudomonas_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026080566.1\|2445623_2446121_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	3.8e-27	54.6
WP_022651924.1\|2446223_2447006_+	transcriptional regulator NanR	NA	NA	NA	NA
WP_022651923.1\|2447128_2448022_+	N-acetylneuraminate lyase	NA	NA	NA	NA
WP_022651922.1\|2448134_2449625_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.4e-08	21.3

DBSCAN-SWA_197

2457615 : 2484105

Staphylococcus_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777629.1\|2457615_2458557_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	1.5e-16	33.6
WP_045346567.1\|2458536_2460039_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	4.8e-81	43.4
WP_045346566.1\|2460176_2461823_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_003861889.1\|2461970_2462990_-	NAD(P)-dependent alcohol dehydrogenase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	5.4e-44	30.7
WP_003861887.1\|2463073_2463577_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017382726.1\|2463700_2466556_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.6e-141	36.9
WP_003861884.1\|2466555_2466999_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_003861882.1\|2467067_2468579_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.2e-47	36.2
WP_003861881.1\|2468844_2469945_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_001147540.1\|2469944_2471027_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_000809803.1\|2471164_2473498_+	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	8.4e-40	30.7
WP_003861876.1\|2473730_2474384_+	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_003861874.1\|2474380_2475106_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_003861872.1\|2475145_2475418_-	PTS phosphocarrier protein NPr	NA	NA	NA	NA
WP_003861870.1\|2475414_2476269_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
WP_003861869.1\|2476314_2476806_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003861866.1\|2476888_2477176_-	ribosome hibernation promoting factor	NA	NA	NA	NA
WP_112777628.1\|2477198_2478632_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003861862.1\|2478679_2479405_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	27.4
WP_003861860.1\|2479411_2479966_-	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_003861858.1\|2479934_2480510_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003861856.1\|2480506_2481073_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	8.5e-55	75.6
WP_003861853.1\|2481087_2482074_-	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.1e-38	31.7
WP_022651914.1\|2482087_2483065_-	calcium/sodium antiporter	NA	NA	NA	NA
WP_003861850.1\|2483292_2484105_+	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	2.4e-18	29.8

DBSCAN-SWA_198

2488149 : 2489637

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017382732.1\|2488149_2488437_-	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	1.0e-16	69.8
WP_023314908.1\|2488665_2489637_-	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	3.5e-08	26.2

DBSCAN-SWA_199

2492768 : 2494471

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346564.1\|2492768_2493812_-	two-component system sensor histidine kinase PmrB	W8CYF6	Bacillus_phage	1.6e-11	23.0
WP_003861819.1\|2493808_2494471_-	two-component system response regulator PmrA	W8CYM9	Bacillus_phage	9.0e-32	38.1

DBSCAN-SWA_200

2497913 : 2509575

Micromonas_pusilla_virus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861810.1\|2497913_2499848_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	2.0e-116	43.5
WP_045346561.1\|2499946_2500795_+	dihydropteroate synthase	S4W084	Pandoravirus	7.5e-23	29.0
WP_003861804.1\|2500787_2502125_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_003861803.1\|2502347_2502680_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_022649518.1\|2502962_2504309_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	9.6e-65	94.4
WP_014833432.1\|2504879_2505332_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003861798.1\|2505360_2506863_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003861796.1\|2506887_2509575_+	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	1.9e-27	27.0

DBSCAN-SWA_201

2515016 : 2516912

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347163.1\|2515016_2516912_+	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	5.4e-53	31.5

DBSCAN-SWA_202

2522597 : 2530389

Invertebrate_iridovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861768.1\|2522597_2522927_-	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	8.8e-12	46.8
WP_003861766.1\|2522941_2523376_+	YhbP family protein	NA	NA	NA	NA
WP_015571965.1\|2523355_2523874_-	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.8e-11	29.3
WP_023304489.1\|2524002_2524647_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_058691683.1\|2524687_2525725_+	permease	NA	NA	NA	NA
WP_003861756.1\|2525775_2526351_-	divisome-associated lipoprotein YraP	NA	NA	NA	NA
WP_003861754.1\|2526360_2526951_-	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	4.1e-12	31.8
WP_003861751.1\|2526972_2527368_-	YraN family protein	NA	NA	NA	NA
WP_045347167.1\|2527325_2529464_-	penicillin-binding protein activator	NA	NA	NA	NA
WP_003861747.1\|2529525_2530389_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.3e-50	44.2

DBSCAN-SWA_203

2547768 : 2548914

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862672.1\|2547768_2548914_+	glycerate 2-kinase	W6LM47	Streptococcus_phage	4.1e-48	39.0

DBSCAN-SWA_204

2554598 : 2556893

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032660421.1\|2554598_2556893_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.5e-158	41.7

DBSCAN-SWA_205

2574080 : 2575046

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862625.1\|2574080_2575046_-	TerC family protein	A0A291LBC5	Escherichia_phage	5.2e-36	33.4

DBSCAN-SWA_206

2583058 : 2584546

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345575.1\|2583058_2584546_+	autoinducer 2 ABC transporter ATP-binding protein LsrA	W5SAS9	Pithovirus	4.9e-09	28.6

DBSCAN-SWA_207

2590258 : 2595381

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651884.1\|2590258_2591638_-	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	3.8e-32	27.4
WP_045345578.1\|2592060_2593581_+	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.1e-32	37.1
WP_022651882.1\|2593821_2595381_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-08	31.9

DBSCAN-SWA_208

2598977 : 2604301

Vibrio_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006812010.1\|2598977_2600822_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
WP_112777625.1\|2600974_2602720_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.9e-76	39.0
WP_001144069.1\|2602835_2603051_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_022651877.1\|2603287_2604301_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.3e-109	58.9

DBSCAN-SWA_209

2613620 : 2614862

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862543.1\|2613620_2614862_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	6.1e-90	50.1

DBSCAN-SWA_210

2619999 : 2622834

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862540.1\|2619999_2621430_+	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	1.5e-39	29.0
WP_003862539.1\|2621507_2621804_-	accessory factor UbiK family protein	NA	NA	NA	NA
WP_003862538.1\|2622180_2622834_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.4e-45	45.5

DBSCAN-SWA_211

2629818 : 2637928

Ralstonia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314866.1\|2629818_2630979_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	5.9e-87	43.4
WP_045332893.1\|2630981_2631647_-	DUF1190 family protein	A0A173GEW8	Erwinia_phage	1.2e-39	47.5
WP_112777623.1\|2631837_2633316_-	outer membrane channel protein TolC	NA	NA	NA	NA
WP_003862517.1\|2633519_2634152_+	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	1.5e-20	36.2
WP_003862516.1\|2634148_2634571_+	DUF1249 family protein	NA	NA	NA	NA
WP_023314864.1\|2634598_2635426_+	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
WP_023314863.1\|2635425_2636007_+	esterase YqiA	NA	NA	NA	NA
WP_003862513.1\|2636035_2637928_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.8e-91	34.8

DBSCAN-SWA_212

2647707 : 2656079

Stx_converting_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777620.1\|2647707_2648109_+	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	2.8e-20	44.4
WP_022651867.1\|2648227_2650486_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.2e-85	35.1
WP_003862497.1\|2650648_2651386_+	1-acylglycerol-3-phosphate O-acyltransferase	NA	NA	NA	NA
WP_003862496.1\|2651447_2652860_+	cell division protein FtsP	NA	NA	NA	NA
WP_162184624.1\|2652927_2655165_+	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	3.2e-105	71.7
WP_045345600.1\|2655251_2656079_-	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.9e-63	44.9

DBSCAN-SWA_213

2665190 : 2672294

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058673060.1\|2665190_2666738_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9
WP_023314843.1\|2666740_2667490_-	L-fucose operon activator	NA	NA	NA	NA
WP_023314842.1\|2667566_2668433_-	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_003862464.1\|2668616_2670479_+	bifunctional glutathionylspermidine amidase/synthase	Q56ES0	Aeromonas_virus	5.9e-20	23.8
WP_003862463.1\|2670531_2670966_-	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
WP_023314840.1\|2670962_2672294_-	poly-beta-1,6 N-acetyl-D-glucosamine synthase	B9UDL7	Salmonella_phage	8.5e-05	34.8

DBSCAN-SWA_214

2682240 : 2684025

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345607.1\|2682240_2684025_+	hybrid sensor histidine kinase/response regulator	A0A2K9L0Z8	Tupanvirus	1.8e-13	23.3

DBSCAN-SWA_215

2725582 : 2726737

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860037.1\|2725582_2726737_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.1e-128	63.2

DBSCAN-SWA_216

2739507 : 2741056

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345619.1\|2739507_2740278_+	alpha/beta hydrolase	A0A249XTU1	Mycobacterium_phage	1.6e-08	35.7
WP_045345620.1\|2740261_2741056_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-05	25.5

DBSCAN-SWA_217

2756430 : 2757663

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017692705.1\|2756430_2757663_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.1e-102	47.6

DBSCAN-SWA_218

2765451 : 2768325

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032667305.1\|2765451_2768325_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	4.1e-262	51.1

DBSCAN-SWA_219

2772777 : 2774211

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863430.1\|2772777_2774211_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	5.7e-31	26.2

DBSCAN-SWA_220

2778627 : 2786216

Brevibacillus_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863442.1\|2778627_2779524_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.5e-29	29.3
WP_003863443.1\|2779552_2780266_+	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
WP_045346666.1\|2780271_2782005_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	9.2e-60	28.5
WP_096147815.1\|2782095_2783193_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.1e-05	39.0
WP_003863452.1\|2783203_2784721_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	7.7e-87	37.5
WP_003863454.1\|2784769_2785312_-	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_022651807.1\|2785475_2786216_+	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	2.2e-10	35.7

DBSCAN-SWA_221

2792928 : 2795829

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346660.1\|2792928_2794911_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	1.6e-153	46.0
WP_022651800.1\|2794944_2795829_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	4.5e-79	56.3

DBSCAN-SWA_222

2813879 : 2818879

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862835.1\|2813879_2814641_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	3.5e-19	32.1
WP_045346654.1\|2814953_2816369_+	sugar porter family MFS transporter	O13311	Aichi_virus	7.1e-26	26.5
WP_003862832.1\|2816451_2817738_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_045332840.1\|2817751_2818879_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.8e-11	24.5

DBSCAN-SWA_223

2825816 : 2826854

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862814.1\|2825816_2826854_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.8e-27	27.0

DBSCAN-SWA_224

2832832 : 2834992

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346649.1\|2832832_2834992_+	bifunctional acyl-ACP--phospholipid O-acyltransferase/long-chain-fatty-acid--ACP ligase	A0A2H4PQU7	Staphylococcus_phage	2.9e-18	26.5

DBSCAN-SWA_225

2839710 : 2843861

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862789.1\|2839710_2841957_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	5.4e-12	23.9
WP_003862787.1\|2842184_2843060_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_003862785.1\|2843066_2843861_+	thymidylate synthase	R4IFY1	Cronobacter_phage	2.0e-118	62.9

DBSCAN-SWA_226

2849290 : 2864740

Klosneuvirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314767.1\|2849290_2852173_+	pitrilysin	A0A1V0SJA4	Klosneuvirus	1.1e-60	23.9
WP_045346645.1\|2852169_2855712_+	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	3.3e-11	21.0
WP_045346644.1\|2855708_2857529_+	exodeoxyribonuclease V subunit alpha	A0A2P0VMS9	Tetraselmis_virus	3.3e-23	27.1
WP_003862767.1\|2857562_2858894_-	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_003862766.1\|2859121_2860375_+	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.4e-12	28.0
WP_003862765.1\|2861118_2862216_+	murein transglycosylase A	NA	NA	NA	NA
WP_006811804.1\|2862291_2863098_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.1e-15	33.7
WP_045332272.1\|2863088_2863535_-	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
WP_022651789.1\|2863534_2864740_-	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	3.5e-74	38.0

DBSCAN-SWA_227

2868012 : 2868768

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862753.1\|2868012_2868768_-	flap endonuclease Xni	F8WQ40	Bacillus_phage	2.7e-08	28.1

DBSCAN-SWA_228

2873585 : 2874428

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023323687.1\|2873585_2874428_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.8e-40	36.4

DBSCAN-SWA_229

2878914 : 2886997

Oenococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862733.1\|2878914_2880255_+	glucarate dehydratase	Q6A202	Oenococcus_phage	4.5e-06	24.0
WP_003862731.1\|2880270_2881608_+	glucarate dehydratase	NA	NA	NA	NA
WP_045346846.1\|2881685_2882831_+	glycerate kinase	W6LM47	Streptococcus_phage	3.3e-50	41.8
WP_003862726.1\|2882881_2885641_-	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.3e-55	29.7
WP_003862724.1\|2885698_2886997_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.0e-38	28.0

DBSCAN-SWA_230

2890362 : 2893381

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862718.1\|2890362_2892000_+	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	50.9
WP_006811784.1\|2892082_2893381_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.4e-129	57.9

DBSCAN-SWA_231

2896745 : 2897417

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006811780.1\|2896745_2897417_+	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	1.1e-11	31.4

DBSCAN-SWA_232

2911586 : 2913616

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346842.1\|2911586_2913011_+	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	1.0e-35	28.4
WP_023314740.1\|2913010_2913616_+	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	5.0e-29	38.6

DBSCAN-SWA_233

2916627 : 2920302

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017382816.1\|2916627_2917389_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.9e-55	47.2
WP_015571709.1\|2917382_2918009_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.7e-36	50.0
WP_022651772.1\|2918125_2919250_+	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	3.8e-06	35.1
WP_013098493.1\|2919309_2920302_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6

DBSCAN-SWA_234

2925845 : 2931270

Cafeteria_roenbergensis_virus(33.33%)

integrase

attL 2923371:2923383|attR 2930977:2930989

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2923371:2923383	attL	NA	NA	NA	NA
WP_112777547.1\|2925845_2928413_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	4.9e-33	21.1
WP_042937604.1\|2928572_2930027_+\|integrase	integrase	A0A0R6PHE0	Moraxella_phage	5.8e-23	28.3
WP_042937603.1\|2930038_2930614_+	hypothetical protein	NA	NA	NA	NA
WP_112777548.1\|2930703_2931270_-	helix-turn-helix domain-containing protein	M1PL54	Cellulophaga_phage	4.7e-37	44.4
2930977:2930989	attR	NA	NA	NA	NA

DBSCAN-SWA_235

2940792 : 2946852

Liberibacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777557.1\|2940792_2944032_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	5.2e-64	28.4
WP_112016344.1\|2944090_2945308_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_112777558.1\|2945304_2946852_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	2.5e-48	28.2

DBSCAN-SWA_236

2950215 : 2951937

Bdellovibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777570.1\|2950215_2951937_+	ATP-dependent helicase	H9C0J4	Bdellovibrio_phage	1.3e-08	24.9

DBSCAN-SWA_237

2956474 : 2957236

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651751.1\|2956474_2957236_-	ABC transporter ATP-binding protein	R4TX06	Phaeocystis_globosa_virus	3.7e-13	29.8

DBSCAN-SWA_238

2976357 : 2977371

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346949.1\|2976357_2977371_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.4e-28	28.0

DBSCAN-SWA_239

2985698 : 2986664

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015571677.1\|2985698_2986664_-	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	2.0e-35	33.8

DBSCAN-SWA_240

2992227 : 3000162

Bodo_saltans_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651726.1\|2992227_2992881_+	ATP-binding cassette domain-containing protein	A0A2H4UU96	Bodo_saltans_virus	4.0e-08	25.7
WP_015571669.1\|2992877_2993738_+	metal ABC transporter permease	NA	NA	NA	NA
WP_058662885.1\|2993752_2994631_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003862172.1\|2994761_2995259_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	9.1e-29	47.1
WP_015571667.1\|2995348_2996407_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.5e-113	63.1
WP_017382782.1\|2996475_2996976_+	recombination regulator RecX	NA	NA	NA	NA
WP_022651724.1\|2997107_2999735_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.2
WP_000906486.1\|2999976_3000162_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7

DBSCAN-SWA_241

3014414 : 3019684

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651720.1\|3014414_3015617_-	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	3.2e-27	38.3
WP_032660089.1\|3015951_3016911_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	1.3e-135	72.1
WP_022651719.1\|3016920_3019065_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	7.8e-202	48.8
WP_003862188.1\|3019037_3019448_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	3.0e-17	44.3
WP_017382770.1\|3019444_3019684_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.7e-12	41.9

DBSCAN-SWA_242

3024542 : 3025148

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651715.1\|3024542_3025148_+	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	1.6e-06	25.2

DBSCAN-SWA_243

3040934 : 3045215

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346164.1\|3040934_3041282_-	HigA family addiction module antidote protein	A0A222YWD7	Escherichia_phage	1.6e-32	63.3
WP_015571638.1\|3041292_3041592_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	6.1e-28	61.7
WP_100154277.1\|3041842_3043003_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_058672812.1\|3043022_3045215_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.6e-32	30.7

DBSCAN-SWA_244

3060030 : 3066117

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003862234.1\|3060030_3060753_+	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	2.0e-08	27.1
WP_045346155.1\|3061253_3063452_-	glycoside hydrolase family 2	NA	NA	NA	NA
WP_045346154.1\|3063420_3066117_-	response regulator	A0A1V0SGX0	Hokovirus	2.3e-65	34.4

DBSCAN-SWA_245

3093130 : 3097456

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080399865.1\|3093130_3093730_+	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	4.4e-09	36.5
WP_045346140.1\|3093947_3095303_-	McrC family protein	NA	NA	NA	NA
WP_112777563.1\|3095299_3097456_-	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	5.2e-36	41.7

DBSCAN-SWA_246

3103685 : 3105194

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346132.1\|3103685_3105194_-	DUF4041 domain-containing protein	Q5G8X0	Enterobacteria_phage	2.3e-51	46.3

DBSCAN-SWA_247

3111382 : 3111658

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346125.1\|3111382_3111658_-	transcriptional regulator	A0A2I7S995	Vibrio_phage	1.4e-18	62.5

DBSCAN-SWA_248

3114827 : 3125141

Staphylococcus_phage(50.0%)

integrase

attL 3115068:3115080|attR 3130785:3130797

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058672802.1\|3114827_3116897_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.5e-72	34.8
3115068:3115080	attL	NA	NA	NA	NA
WP_045346118.1\|3116932_3117148_-	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_058672803.1\|3117510_3121983_-	ATP-binding protein	A0A2H4PQT3	Staphylococcus_phage	7.4e-69	27.0
WP_045346115.1\|3122145_3122790_-	hypothetical protein	NA	NA	NA	NA
WP_058672804.1\|3122791_3124039_-\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	8.5e-140	62.0
WP_003863115.1\|3124658_3125141_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.8e-29	46.8
3130785:3130797	attR	NA	NA	NA	NA

DBSCAN-SWA_249

3138126 : 3141687

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023323614.1\|3138126_3139347_-	diguanylate cyclase DgcN	A0A2K8I9Y5	Pseudomonas_phage	1.2e-05	39.8
WP_023323613.1\|3139339_3139876_-	YfiR family protein	NA	NA	NA	NA
WP_003863151.1\|3140029_3140404_-	DUF2799 domain-containing protein	NA	NA	NA	NA
WP_006811632.1\|3140616_3141687_+	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	4.5e-89	51.5

DBSCAN-SWA_250

3148485 : 3151059

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863168.1\|3148485_3151059_+	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	2.6e-127	35.5

DBSCAN-SWA_251

3156704 : 3157157

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006811623.1\|3156704_3157157_+	DUF4385 domain-containing protein	M4QHR1	Cyanophage	3.9e-34	50.0

DBSCAN-SWA_252

3163914 : 3180974

Achromobacter_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860733.1\|3163914_3164334_-	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	1.2e-13	37.2
WP_022651671.1\|3164538_3165624_+\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_003860729.1\|3165663_3166353_-	uracil-DNA glycosylase	A0A076JX67	Equid_alphaherpesvirus	7.9e-55	48.8
WP_003860727.1\|3166668_3167052_+	autonomous glycyl radical cofactor GrcA	A0A193GZ98	Escherichia_phage	2.1e-33	71.8
WP_003860725.1\|3167104_3168433_-	ATP-dependent RNA helicase SrmB	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.7e-48	33.5
WP_003860724.1\|3168565_3169303_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003860722.1\|3169287_3170907_-	L-aspartate oxidase	NA	NA	NA	NA
WP_006176728.1\|3171334_3171910_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	8.2e-05	28.1
WP_003860719.1\|3171941_3172592_+	anti-sigma-E factor RseA	NA	NA	NA	NA
WP_003860717.1\|3172591_3173545_+	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
WP_003860716.1\|3173541_3174018_+	SoxR-reducing system protein RseC	NA	NA	NA	NA
WP_112777492.1\|3174203_3176009_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.5e-23	25.7
WP_003860712.1\|3176024_3176999_+	signal peptidase I	NA	NA	NA	NA
WP_003860711.1\|3177222_3177903_+	ribonuclease III	A0A2P0VNZ5	Tetraselmis_virus	9.6e-21	39.0
WP_003860709.1\|3177899_3178805_+	GTPase Era	NA	NA	NA	NA
WP_003860708.1\|3178822_3179530_+	DNA repair protein RecO	NA	NA	NA	NA
WP_023314662.1\|3179605_3180337_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_003860706.1\|3180336_3180717_+	holo-ACP synthase	NA	NA	NA	NA
WP_003860704.1\|3180713_3180974_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-17	51.2

DBSCAN-SWA_253

3187176 : 3198357

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777493.1\|3187176_3191064_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	7.7e-131	59.0
WP_032610263.1\|3191596_3193030_+	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	6.8e-16	27.9
WP_003860689.1\|3193026_3193779_+	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_045345466.1\|3193775_3195113_+	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	8.8e-10	33.0
WP_003860685.1\|3195193_3195532_+	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_023325074.1\|3195608_3196799_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_003860678.1\|3197103_3198357_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.0e-100	53.4

DBSCAN-SWA_254

3205706 : 3212012

Faustovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003860663.1\|3205706_3206921_+	cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6
WP_003860661.1\|3206945_3207332_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	77.3
WP_003860659.1\|3207345_3207669_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	4.5e-21	46.7
WP_003860657.1\|3207745_3208261_+	co-chaperone HscB	NA	NA	NA	NA
WP_003860654.1\|3208275_3210126_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.0e-105	41.1
WP_003860652.1\|3210127_3210463_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003860650.1\|3210464_3210665_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003860647.1\|3210725_3212012_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	4.9e-34	39.4

DBSCAN-SWA_255

3225143 : 3230374

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086531987.1\|3225143_3227549_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	9.0e-138	38.1
WP_045345478.1\|3227545_3228175_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	3.0e-61	55.4
WP_045345479.1\|3228167_3228947_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003860625.1\|3229942_3230374_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.4e-19	39.4

DBSCAN-SWA_256

3239196 : 3245442

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314644.1\|3239196_3240738_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	4.4e-162	57.8
WP_003860607.1\|3240796_3241018_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_003860606.1\|3241014_3241365_-	hypothetical protein	NA	NA	NA	NA
WP_023325046.1\|3241364_3242384_-	peptidase M4 family protein	NA	NA	NA	NA
WP_045345481.1\|3242442_3243816_-	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.9e-39	34.0
WP_003860601.1\|3243975_3245442_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.0e-88	39.1

DBSCAN-SWA_257

3259672 : 3259843

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017383512.1\|3259672_3259843_-	DUF2633 family protein	G9L6F2	Escherichia_phage	3.6e-17	75.9

DBSCAN-SWA_258

3266287 : 3274178

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006811493.1\|3266287_3266929_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.6e-28	40.0
WP_003860563.1\|3266925_3267963_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	7.4e-73	45.1
WP_003860562.1\|3268229_3269660_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_003860560.1\|3269876_3270503_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003860558.1\|3270585_3271875_+	uracil permease	Q9KX94	Enterobacteria_phage	4.1e-65	36.9
WP_071524135.1\|3271956_3272673_+	DnaA inactivator Hda	NA	NA	NA	NA
WP_045345534.1\|3272759_3274178_-	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	2.3e-40	33.8

DBSCAN-SWA_259

3283908 : 3284622

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001171626.1\|3283908_3284622_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	9.1e-38	35.2

DBSCAN-SWA_260

3306115 : 3325886

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345542.1\|3306115_3306991_-	N-acetylmuramoyl-L-alanine amidase AmiA	E5DV68	Deep-sea_thermophilic_phage	1.6e-12	26.9
WP_003861292.1\|3307203_3307629_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_112777497.1\|3307615_3308065_+	DUF2919 domain-containing protein	NA	NA	NA	NA
WP_045345545.1\|3308128_3308704_+	RpoE-regulated lipoprotein	NA	NA	NA	NA
WP_112777498.1\|3308796_3309696_+	Dyp-type peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
WP_045349827.1\|3309871_3310885_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_045330438.1\|3310884_3311718_+	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
WP_003861305.1\|3311717_3312593_+	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
WP_032659702.1\|3312582_3313677_+	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	1.6e-30	38.9
WP_045345549.1\|3313744_3314656_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.7e-55	42.0
WP_003861313.1\|3314661_3315498_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
WP_003861316.1\|3315542_3316052_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_112777499.1\|3316092_3317820_-	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	3.3e-17	31.6
WP_000487600.1\|3317865_3318123_-	phosphocarrier protein Hpr	NA	NA	NA	NA
WP_003861321.1\|3318440_3319412_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	5.1e-76	51.3
WP_003861323.1\|3319575_3320337_-	sulfate transporter CysZ	NA	NA	NA	NA
WP_003861325.1\|3320566_3321562_+	cell division protein ZipA	NA	NA	NA	NA
WP_045337258.1\|3321630_3323646_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	9.1e-152	43.3
WP_045337259.1\|3323647_3323863_+	DUF3820 family protein	NA	NA	NA	NA
WP_003861330.1\|3323859_3324855_-	bile acid:sodium symporter	NA	NA	NA	NA
WP_003861331.1\|3324944_3325886_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.1e-06	24.9

DBSCAN-SWA_261

3340628 : 3341360

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023325009.1\|3340628_3341360_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	2.2e-15	25.5

DBSCAN-SWA_262

3345182 : 3348841

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086527955.1\|3345182_3346103_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	4.9e-76	54.7
WP_003861362.1\|3346371_3347751_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-15	37.0
WP_003861364.1\|3347911_3348841_-	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	4.4e-141	83.9

DBSCAN-SWA_263

3358010 : 3359096

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314595.1\|3358010_3359096_+	chorismate synthase	A0A291AU41	Pandoravirus	1.5e-87	46.6

DBSCAN-SWA_264

3367451 : 3368588

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314591.1\|3367451_3368588_+	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	3.0e-19	27.3

DBSCAN-SWA_265

3375018 : 3376536

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008502595.1\|3375018_3376536_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.4e-88	43.8

DBSCAN-SWA_266

3380771 : 3381545

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861426.1\|3380771_3381545_+	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	3.6e-08	28.2

DBSCAN-SWA_267

3386229 : 3387249

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861441.1\|3386229_3387249_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.5e-20	26.8

DBSCAN-SWA_268

3396385 : 3399606

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003861463.1\|3396385_3397045_+	sugar phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.7e-06	26.6
WP_045345833.1\|3397120_3398953_+	SLC13 family permease	NA	NA	NA	NA
WP_003861468.1\|3399006_3399606_-	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	1.5e-06	38.6

DBSCAN-SWA_269

3418548 : 3419553

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859465.1\|3418548_3419553_-	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	7.5e-30	26.5

DBSCAN-SWA_270

3441325 : 3453022

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324988.1\|3441325_3442378_+	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	7.7e-09	50.9
WP_003859419.1\|3442401_3442656_-	2Fe-2S ferredoxin-like protein	G9IAA2	Pseudomonas_phage	2.6e-27	66.7
WP_023314567.1\|3442655_3443786_-	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	1.0e-176	79.1
WP_003859415.1\|3443894_3446180_-	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	3.8e-287	64.3
WP_003859413.1\|3446528_3447257_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_058672963.1\|3447403_3450040_+	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	9.6e-93	31.0
WP_022651523.1\|3450175_3453022_+	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	8.9e-44	26.4

DBSCAN-SWA_271

3457216 : 3465818

Tupanvirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859401.1\|3457216_3458311_+	porin OmpC	Q1MVN1	Enterobacteria_phage	5.2e-117	60.1
WP_023314564.1\|3458425_3459481_+	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_045345848.1\|3459553_3460612_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A2K9L698	Tupanvirus	3.7e-19	48.0
WP_023324984.1\|3460611_3461262_+	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	4.9e-06	32.4
WP_017383408.1\|3461338_3462982_+	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	8.3e-10	23.0
WP_006811337.1\|3463123_3464560_+	magnesium transporter	NA	NA	NA	NA
WP_052686851.1\|3464522_3465818_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.5e-80	49.3

DBSCAN-SWA_272

3471120 : 3478638

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017383403.1\|3471120_3472128_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	1.0e-82	48.6
WP_003859376.1\|3472179_3472464_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_045345853.1\|3472589_3474350_-	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	4.9e-101	42.0
WP_023314557.1\|3474501_3475209_+	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_003859373.1\|3475224_3476424_+	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	9.9e-21	23.0
WP_003859372.1\|3476700_3477045_+	hypothetical protein	NA	NA	NA	NA
WP_045345854.1\|3477048_3478638_-	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	2.1e-18	32.1

DBSCAN-SWA_273

3484330 : 3488639

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859364.1\|3484330_3484900_-	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	1.8e-12	36.8
WP_003859363.1\|3485315_3486029_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_045331129.1\|3486062_3487049_-	GTP-binding protein	NA	NA	NA	NA
WP_045345859.1\|3487172_3488639_-	fructuronate reductase	E5EQS6	Micromonas_sp._RCC1109_virus	1.7e-38	28.6

DBSCAN-SWA_274

3496495 : 3497353

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045345861.1\|3496495_3497353_-	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	4.8e-25	32.7

DBSCAN-SWA_275

3501122 : 3506261

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859334.1\|3501122_3503108_-	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	2.2e-09	31.9
WP_045345862.1\|3503376_3504204_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_045337658.1\|3504341_3505490_+	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_003859328.1\|3505592_3506261_+	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	9.0e-56	56.3

DBSCAN-SWA_276

3509988 : 3511509

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859320.1\|3509988_3511509_+	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	2.6e-10	33.0

DBSCAN-SWA_277

3523655 : 3524210

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859289.1\|3523655_3524210_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	7.3e-19	37.2

DBSCAN-SWA_278

3530773 : 3538620

Enterobacteria_phage(60.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039270368.1\|3530773_3531724_+	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	5.9e-08	29.0
WP_045345868.1\|3531707_3532445_+	ABC transporter permease	NA	NA	NA	NA
WP_022648678.1\|3532419_3532533_-	protein YohO	NA	NA	NA	NA
WP_003859273.1\|3532602_3533343_-	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	4.6e-93	82.9
WP_003859271.1\|3533561_3535247_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.3e-270	88.2
WP_022648676.1\|3535240_3535960_+	two-component system response regulator BtsR	NA	NA	NA	NA
WP_003859267.1\|3536006_3536477_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	9.8e-65	78.7
WP_023324959.1\|3536586_3538620_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	2.1e-55	28.2

DBSCAN-SWA_279

3546515 : 3549461

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015572345.1\|3546515_3547892_-	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-26	26.4
WP_045345872.1\|3548203_3548647_-	hypothetical protein	NA	NA	NA	NA
WP_176691859.1\|3548831_3549461_-	YadA-like family protein	S4TRP0	Salmonella_phage	7.3e-07	32.1

DBSCAN-SWA_280

3560948 : 3565039

Bacillus_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651495.1\|3560948_3562310_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.7e-200	91.0
WP_045346758.1\|3562916_3563639_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	3.2e-30	32.4
WP_006811258.1\|3563635_3565039_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	2.5e-31	27.9

DBSCAN-SWA_281

3580062 : 3589393

Catovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000130320.1\|3580062_3580704_+	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	38.3
WP_013097886.1\|3580795_3581377_+	dCTP deaminase	I4AZP2	Saccharomonospora_phage	1.4e-33	43.2
WP_045346752.1\|3581400_3583251_+	outer membrane assembly protein AsmA	NA	NA	NA	NA
WP_023314474.1\|3583364_3584948_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.2e-39	44.9
WP_003862079.1\|3585641_3586778_+	polysaccharide export protein	NA	NA	NA	NA
WP_003862078.1\|3586784_3587228_+	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
WP_015572374.1\|3587230_3589393_+	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	3.2e-17	29.8

DBSCAN-SWA_282

3594639 : 3601351

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003863514.1\|3594639_3595761_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	66.3
WP_015572377.1\|3595763_3596729_+	GDP-L-fucose synthase	D1LW79	Prochlorococcus_phage	1.4e-86	50.6
WP_003863519.1\|3596731_3597211_+	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
WP_003863520.1\|3597207_3598431_+	colanic acid biosynthesis fucosyltransferase WcaI	NA	NA	NA	NA
WP_003863522.1\|3598434_3599871_+	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	1.4e-53	31.6
WP_022648631.1\|3599980_3601351_+	colanic acid biosynthesis phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	1.5e-33	27.5

DBSCAN-SWA_283

3606872 : 3610567

Klebsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346743.1\|3606872_3608264_+	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	4.4e-20	33.2
WP_058671405.1\|3608453_3609449_+	NAD-dependent epimerase/dehydratase family protein	A0A0K1L6Z1	Scale_drop_disease_virus	1.1e-09	28.1
WP_045346740.1\|3609664_3610567_+	GalU regulator GalF	A0A127AW70	Bacillus_phage	1.8e-43	42.6

DBSCAN-SWA_284

3615082 : 3625426

Catovirus(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346734.1\|3615082_3615769_+	hypothetical protein	A0A1V0SBR5	Catovirus	1.6e-10	36.0
WP_072050855.1\|3615770_3616784_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.2e-83	48.3
WP_045346733.1\|3616797_3617544_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.2e-11	35.8
WP_006811221.1\|3617680_3619087_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	5.2e-37	28.3
WP_045346732.1\|3619176_3620262_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	9.7e-100	52.9
WP_017693099.1\|3620262_3621144_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	9.0e-104	62.7
WP_045346730.1\|3621383_3622550_+	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	3.1e-112	54.0
WP_112777507.1\|3622598_3623603_-	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	1.9e-33	28.7
WP_045346728.1\|3623794_3624775_+	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
WP_003859480.1\|3624814_3625426_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	2.1e-14	29.3

DBSCAN-SWA_285

3630936 : 3631836

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346717.1\|3630936_3631836_-	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_286

3637379 : 3638552

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139156834.1\|3637379_3638552_+	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	1.6e-196	85.9

DBSCAN-SWA_287

3647595 : 3655388

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346634.1\|3647595_3650658_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	4.2e-23	20.6
WP_045346633.1\|3650657_3651743_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003859525.1\|3652215_3652647_+	universal stress protein	NA	NA	NA	NA
WP_045346632.1\|3652694_3655388_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.5e-69	26.5

DBSCAN-SWA_288

3671210 : 3672512

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346625.1\|3671210_3672512_-	MFS transporter	Q6JIH2	Burkholderia_virus	7.4e-62	36.5

DBSCAN-SWA_289

3678876 : 3681657

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777709.1\|3678876_3681657_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.1e-65	29.1

DBSCAN-SWA_290

3686062 : 3694185

Burkholderia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032659241.1\|3686062_3687229_-	porin OmpC	Q1MVN1	Enterobacteria_phage	3.0e-115	57.3
WP_023324909.1\|3687513_3688215_+	phosphohydrolase	S4W232	Pandoravirus	1.1e-06	28.5
WP_057979973.1\|3688258_3689692_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.2e-102	55.9
WP_023324908.1\|3689672_3690164_+	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	1.0e-32	47.6
WP_003859569.1\|3690135_3691050_-	drug/metabolite exporter YedA	NA	NA	NA	NA
WP_169803262.1\|3691225_3692140_+	DUF808 family protein	NA	NA	NA	NA
WP_003859574.1\|3692217_3692400_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_045346619.1\|3692484_3694185_+	cellulose biosynthesis regulator YedQ	A0A127AWB9	Bacillus_phage	2.1e-16	32.8

DBSCAN-SWA_291

3718849 : 3719602

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859634.1\|3718849_3719602_+	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	2.2e-26	35.4

DBSCAN-SWA_292

3727219 : 3727936

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017384431.1\|3727219_3727936_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-12	28.5

DBSCAN-SWA_293

3743813 : 3745328

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859688.1\|3743813_3745328_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A285PWH2	Cedratvirus	3.1e-11	28.7

DBSCAN-SWA_294

3757056 : 3834510

Enterobacteria_phage(30.0%)

tRNA,holin,coat,portal,head,tail,capsid,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859701.1\|3757056_3757629_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_112777712.1\|3757636_3758185_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_112777713.1\|3758201_3758963_+	molecular chaperone	NA	NA	NA	NA
WP_112777714.1\|3758938_3761323_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_022651452.1\|3761319_3762282_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_022651451.1\|3762367_3764035_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-11	34.7
WP_022651450.1\|3764079_3765681_+	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-07	77.3
WP_003859714.1\|3765700_3766567_+	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_003859716.1\|3766563_3767613_+	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	2.3e-05	32.0
WP_000763862.1\|3767630_3768020_+	chemotaxis response regulator CheY	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3
WP_045347101.1\|3768030_3768675_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_045347100.1\|3768823_3769972_+	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_003859723.1\|3769964_3772043_+	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_003859725.1\|3772042_3772435_+	flagellar protein FlhE	NA	NA	NA	NA
WP_023324881.1\|3772696_3774280_+	MFS transporter	NA	NA	NA	NA
WP_045347114.1\|3774284_3775424_+	glycoside hydrolase family 105 protein	NA	NA	NA	NA
WP_058672945.1\|3775458_3777192_-\|tRNA	arginine--tRNA ligase	A0A1V0SIS8	Klosneuvirus	4.0e-87	37.0
WP_032609525.1\|3777430_3777991_+	VOC family protein	NA	NA	NA	NA
WP_023324878.1\|3778069_3778813_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_003859733.1\|3779073_3780045_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_003859735.1\|3780041_3780785_-	carboxy-S-adenosyl-L-methionine synthase CmoA	A0A1S6L2V9	Erwinia_phage	6.1e-29	30.2
WP_003859737.1\|3780825_3781221_-	MAPEG family protein	NA	NA	NA	NA
WP_058659449.1\|3781272_3782046_-	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	8.6e-58	80.3
WP_112777715.1\|3782024_3783338_-	DUF3596 domain-containing protein	Q8W658	Enterobacteria_phage	1.1e-222	86.2
WP_023294930.1\|3783393_3783630_-	excisionase family protein	Q8W657	Enterobacteria_phage	4.8e-36	85.9
WP_157845143.1\|3783637_3783787_-	hypothetical protein	A0A1B5FPC2	Escherichia_phage	5.7e-19	81.2
WP_072050225.1\|3783783_3783981_-	hypothetical protein	NA	NA	NA	NA
WP_112777716.1\|3784013_3784283_-	hypothetical protein	K7PKM4	Enterobacterial_phage	2.6e-30	73.0
WP_112777717.1\|3784343_3784628_-	DUF4752 family protein	Q76H46	Enterobacteria_phage	1.8e-21	48.3
WP_112777718.1\|3784627_3785464_-	hypothetical protein	M9NZE4	Enterobacteria_phage	1.4e-26	34.4
WP_112778013.1\|3785460_3786288_-	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	8.1e-123	85.9
WP_112778026.1\|3786287_3786701_-	hypothetical protein	K7PJS4	Enterobacterial_phage	1.4e-54	83.9
WP_065131662.1\|3786971_3787196_-	hypothetical protein	NA	NA	NA	NA
WP_176691856.1\|3787711_3788371_-	helix-turn-helix domain-containing protein	H9C160	Pectobacterium_phage	2.9e-75	62.7
WP_016530206.1\|3788463_3788661_+	Cro/Cl family transcriptional regulator	H9C161	Pectobacterium_phage	2.7e-16	66.1
WP_112777911.1\|3788686_3789157_+	hypothetical protein	K7PJS5	Enterobacterial_phage	1.2e-75	94.9
WP_072044687.1\|3789397_3789583_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	5.2e-14	69.2
WP_112778014.1\|3789566_3790520_+	conserved phage C-terminal domain-containing protein	K7PLZ7	Enterobacterial_phage	1.4e-171	93.7
WP_059443610.1\|3790516_3791011_+	hypothetical protein	NA	NA	NA	NA
WP_112777908.1\|3791353_3792010_+	phage antirepressor KilAC domain-containing protein	G0ZND1	Cronobacter_phage	3.4e-55	52.7
WP_112778015.1\|3792006_3792996_+	DUF968 domain-containing protein	K7PJS6	Enterobacterial_phage	8.7e-164	83.6
WP_053504488.1\|3793008_3793839_+	antitermination protein	K7P7B9	Enterobacteria_phage	3.9e-56	46.9
WP_017145563.1\|3794038_3794434_+\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	2.6e-63	98.5
WP_049019334.1\|3794420_3794702_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	1.9e-44	95.7
WP_112778016.1\|3794701_3795331_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	3.0e-101	87.6
WP_112777914.1\|3795548_3795821_+	hypothetical protein	G8C7W1	Escherichia_phage	1.1e-07	42.9
WP_045347727.1\|3795830_3796451_+	hypothetical protein	A0A1B0VMI8	Pseudomonas_phage	9.6e-44	42.7
WP_112777916.1\|3796491_3796683_+	hypothetical protein	K7PM01	Enterobacterial_phage	1.4e-17	83.3
WP_045345419.1\|3796712_3796937_+	hypothetical protein	A0A2H4J182	uncultured_Caudovirales_phage	8.6e-19	56.8
WP_023303625.1\|3797031_3797193_+	hypothetical protein	NA	NA	NA	NA
WP_058685152.1\|3797175_3797640_-\|protease	aspartyl protease family protein	NA	NA	NA	NA
WP_072201968.1\|3798148_3798796_+	DUF1983 domain-containing protein	G8C7Q4	Escherichia_phage	2.0e-60	74.8
WP_112777829.1\|3798807_3800265_+	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	1.2e-273	92.2
WP_112777830.1\|3800308_3800827_+	HNH endonuclease	K7PJS8	Enterobacterial_phage	5.0e-46	53.2
WP_112777831.1\|3800807_3801398_+	hypothetical protein	S4TR53	Salmonella_phage	4.6e-104	90.3
WP_032659098.1\|3801397_3801748_+	HNH endonuclease	K7PHK9	Enterobacteria_phage	1.0e-50	81.0
WP_045332660.1\|3801905_3802379_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	1.3e-85	98.7
WP_063137109.1\|3802378_3804115_+\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	99.8
WP_063137110.1\|3804114_3805419_+\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	1.9e-211	84.1
WP_063137111.1\|3805427_3806279_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	1.1e-90	63.5
WP_063137112.1\|3806288_3807497_+\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	2.0e-162	74.6
WP_032667407.1\|3807540_3807867_+\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	9.5e-51	88.0
WP_063137113.1\|3807875_3808214_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	2.1e-40	74.1
WP_063855693.1\|3808210_3808660_+	HK97 gp10 family phage protein	K7P6X4	Enterobacteria_phage	5.8e-75	98.7
WP_022650851.1\|3808656_3809004_+	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	1.6e-48	82.6
WP_022650852.1\|3809063_3809507_+	hypothetical protein	K7PHL2	Enterobacterial_phage	6.0e-72	93.8
WP_022650853.1\|3809515_3809899_+\|tail	phage tail assembly chaperone	K7PKV6	Enterobacterial_phage	1.7e-62	92.9
WP_032645834.1\|3809907_3810186_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	9.9e-41	93.4
WP_022650855.1\|3810206_3810626_-	hypothetical protein	NA	NA	NA	NA
WP_112777832.1\|3810712_3814177_+\|tail	phage tail tape measure protein	A0A2H4JHR1	uncultured_Caudovirales_phage	0.0e+00	87.8
WP_022648882.1\|3814179_3814518_+\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	7.3e-38	59.8
WP_016240208.1\|3814514_3815273_+\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	3.9e-95	63.6
WP_022650858.1\|3815275_3815986_+	C40 family peptidase	F1C573	Cronobacter_phage	8.6e-97	69.4
WP_059509693.1\|3815985_3816570_+\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	4.3e-54	53.1
WP_112777833.1\|3816623_3820505_+	DUF1983 domain-containing protein	Q9MCR7	Enterobacteria_phage	0.0e+00	61.0
WP_112777834.1\|3820506_3821472_+	hypothetical protein	G1CSU0	Cronobacter_virus	6.3e-58	39.6
WP_112778017.1\|3821532_3822810_+\|tail	phage tail protein	K7P6I4	Enterobacteria_phage	4.5e-120	53.9
WP_045347766.1\|3823133_3823511_-	hypothetical protein	NA	NA	NA	NA
WP_063137103.1\|3823850_3824114_-	DinI family protein	K7P797	Enterobacteria_phage	2.2e-37	92.0
WP_032609519.1\|3824478_3825045_-	hydrolase	NA	NA	NA	NA
WP_003859743.1\|3825307_3827080_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_003859745.1\|3827081_3827525_+	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_003859747.1\|3827552_3828293_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003859749.1\|3828327_3828849_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
WP_003859751.1\|3828929_3829544_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003859753.1\|3829552_3830563_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	2.4e-07	29.9
WP_003859755.1\|3830615_3831401_-	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_003859757.1\|3831397_3832153_-	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-15	30.2
WP_032610246.1\|3832230_3833175_+	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_003859762.1\|3833190_3834510_+	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	40.9

DBSCAN-SWA_295

3838425 : 3839901

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859771.1\|3838425_3839901_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	6.0e-76	36.2

DBSCAN-SWA_296

3842960 : 3851146

Ralstonia_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058672917.1\|3842960_3845474_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.2e-14	27.8
WP_058659732.1\|3845470_3847585_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	3.9e-20	29.5
WP_088567057.1\|3847609_3848302_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	3.4e-05	58.1
WP_039264793.1\|3848305_3849013_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	3.5e-05	29.7
WP_039264792.1\|3849016_3849724_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	5.9e-05	29.7
WP_039267600.1\|3849727_3850435_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	1.1e-06	31.1
WP_032659013.1\|3850438_3851146_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	1.8e-06	31.1

DBSCAN-SWA_297

3858455 : 3908579

Salmonella_phage(24.14%)

holin,head,tail,integrase,terminase

attL 3857386:3857400|attR 3870386:3870400

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3857386:3857400	attL	NA	NA	NA	NA
WP_112777795.1\|3858455_3858686_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.0e-15	60.3
WP_023314337.1\|3858823_3859195_+	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_112777796.1\|3859196_3860066_+	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_003859787.1\|3860082_3860421_+	YebY family protein	NA	NA	NA	NA
WP_023300431.1\|3860743_3861829_-\|integrase	phage integrase Arm DNA-binding domain-containing protein	A0A2H4IYC8	uncultured_Caudovirales_phage	1.6e-147	68.4
WP_023300430.1\|3861797_3862070_-	hypothetical protein	A0A2H4J5E1	uncultured_Caudovirales_phage	2.9e-29	64.4
WP_058672881.1\|3862258_3862915_+	DUF4145 domain-containing protein	V5URE2	Shigella_phage	8.0e-57	49.1
WP_058672880.1\|3862946_3863165_-	TraR/DksA family transcriptional regulator	M1FQT7	Enterobacteria_phage	2.3e-16	63.6
WP_058672879.1\|3863231_3863768_-	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	9.2e-35	51.0
WP_047716558.1\|3863764_3863965_-	hypothetical protein	NA	NA	NA	NA
WP_080399866.1\|3863961_3864234_-	DUF5405 family protein	K7P7M4	Enterobacteria_phage	4.2e-20	57.5
WP_032652770.1\|3864230_3864449_-	hypothetical protein	NA	NA	NA	NA
WP_058672877.1\|3864445_3864997_-	phage N-6-adenine-methyltransferase	E5AGF8	Erwinia_phage	5.2e-57	60.0
WP_165592604.1\|3864993_3865161_-	hypothetical protein	G8C7S7	Escherichia_phage	5.6e-23	94.5
WP_058672876.1\|3865157_3865586_-	hypothetical protein	M9NYX4	Enterobacteria_phage	2.2e-71	93.7
WP_058672875.1\|3865582_3866206_-	YqaJ viral recombinase family protein	S0A2A9	Cellulophaga_phage	7.2e-47	49.5
WP_162184608.1\|3866202_3866511_-	hypothetical protein	A0A0F7L7F5	uncultured_marine_virus	3.8e-09	33.3
WP_058672874.1\|3866717_3867002_-	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.9e-47	94.7
WP_058672873.1\|3867136_3867451_+	hypothetical protein	NA	NA	NA	NA
WP_023622534.1\|3867455_3867659_-	phage encoded cell division inhibitor protein	K7P6H3	Enterobacteria_phage	4.4e-22	76.6
WP_058672872.1\|3867655_3867820_-	hypothetical protein	G8C7T3	Escherichia_phage	3.6e-14	67.9
WP_058672871.1\|3867816_3868086_-	hypothetical protein	NA	NA	NA	NA
WP_039269180.1\|3868249_3868687_-	hypothetical protein	K7P7N6	Enterobacteria_phage	3.9e-76	97.2
WP_045344955.1\|3869478_3870231_-	LexA family transcriptional regulator	A0A286S2B2	Klebsiella_phage	7.0e-73	64.0
WP_000102594.1\|3870272_3870506_+	hypothetical protein	A0A0P0ZDD7	Stx2-converting_phage	2.6e-18	62.3
3870386:3870400	attR	NA	NA	NA	NA
WP_045340889.1\|3870523_3871066_+	toxin YdaT domain-containing protein	M9NZI6	Enterobacteria_phage	4.6e-74	78.9
WP_015571544.1\|3871155_3871302_+	hypothetical protein	NA	NA	NA	NA
WP_112777896.1\|3871294_3872191_+	DNA replication protein	F1C5C3	Cronobacter_phage	2.6e-98	60.1
WP_176691860.1\|3872195_3873608_+	AAA family ATPase	Q9MCT4	Escherichia_phage	7.5e-169	62.6
WP_058688299.1\|3873607_3873952_+	helix-turn-helix transcriptional regulator	G8C7U7	Escherichia_phage	1.9e-54	94.7
WP_058672867.1\|3874816_3875098_+	hypothetical protein	A0A077KAZ4	Edwardsiella_phage	2.7e-30	79.3
WP_058672866.1\|3875101_3875764_+	DUF551 domain-containing protein	M9NZE4	Enterobacteria_phage	9.4e-21	47.3
WP_058672865.1\|3875763_3876009_+	hypothetical protein	A0A1I9KF90	Aeromonas_phage	7.0e-14	51.4
WP_058672864.1\|3876114_3876345_+	hypothetical protein	NA	NA	NA	NA
WP_058672863.1\|3876518_3876968_+	recombination protein NinB	I6R9D0	Salmonella_phage	4.7e-32	45.1
WP_058672862.1\|3876960_3877131_+	hypothetical protein	G8C7V4	Escherichia_phage	7.2e-18	78.6
WP_045142307.1\|3877123_3877762_+	recombination protein NinG	S4TSR3	Salmonella_phage	8.0e-86	75.5
WP_058672860.1\|3877871_3878561_+	antiterminator	I6PDF8	Cronobacter_phage	1.1e-56	52.7
WP_072204427.1\|3878633_3878921_-	hypothetical protein	NA	NA	NA	NA
WP_048961198.1\|3879234_3879606_+\|holin	phage holin family protein	A0A2D1GNJ3	Pseudomonas_phage	1.3e-06	32.4
WP_058673080.1\|3879589_3880234_+	glycoside hydrolase family 19 protein	F1C5D2	Cronobacter_phage	1.5e-36	43.3
WP_058673081.1\|3880221_3880698_+	hypothetical protein	NA	NA	NA	NA
WP_058673082.1\|3881151_3881670_+	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.1e-92	98.8
WP_063137118.1\|3881999_3882218_+	hypothetical protein	NA	NA	NA	NA
WP_058673028.1\|3882283_3882508_-	hypothetical protein	NA	NA	NA	NA
WP_058673027.1\|3882530_3883103_+\|terminase	terminase small subunit	G0ZND3	Cronobacter_phage	2.2e-71	72.6
WP_058673026.1\|3883089_3884568_+	DNA-packaging protein	G0ZND4	Cronobacter_phage	1.5e-257	87.6
WP_058673025.1\|3884583_3885933_+	DUF1073 domain-containing protein	A0A1V0E5Q5	Salmonella_phage	7.8e-232	87.3
WP_058673024.1\|3885892_3886819_+\|head	phage head morphogenesis protein	Q5G8Y3	Enterobacteria_phage	4.0e-163	92.9
WP_112778018.1\|3886821_3888090_+	hypothetical protein	Q5G8Y2	Enterobacteria_phage	2.2e-220	91.9
WP_020838514.1\|3888102_3888564_+	hypothetical protein	G0ZND8	Cronobacter_phage	2.6e-62	81.1
WP_022651010.1\|3888576_3889674_+	hypothetical protein	G0ZND9	Cronobacter_phage	8.7e-181	84.4
WP_020838516.1\|3889684_3889969_+	hypothetical protein	A0A1V0E5P8	Salmonella_phage	1.7e-32	75.3
WP_112777871.1\|3890031_3890433_+	hypothetical protein	I6S619	Salmonella_phage	2.7e-55	75.9
WP_020838521.1\|3890432_3890612_+	DUF551 domain-containing protein	Q5G8X7	Enterobacteria_phage	2.6e-26	89.8
WP_112777870.1\|3890604_3890967_+	hypothetical protein	Q5G8X6	Enterobacteria_phage	2.7e-62	92.5
WP_023205067.1\|3890956_3891448_-	HNH endonuclease	J7HXG5	Pseudomonas_phage	1.6e-46	57.1
WP_063153212.1\|3891569_3891965_+	hypothetical protein	I6RSK8	Salmonella_phage	1.5e-66	96.2
WP_047720618.1\|3891961_3892348_+	hypothetical protein	A0A1V0E5P4	Salmonella_phage	2.1e-65	94.5
WP_047720620.1\|3892365_3893100_+	immunoglobulin domain-containing protein	H6WRU1	Salmonella_phage	2.1e-114	85.6
WP_063216497.1\|3893137_3893791_+	hypothetical protein	I6R0Q2	Salmonella_phage	7.9e-113	92.2
WP_000735926.1\|3894404_3894680_+	hypothetical protein	Q5G8V7	Enterobacteria_phage	1.8e-26	72.5
WP_042889550.1\|3894797_3895202_+	hypothetical protein	NA	NA	NA	NA
WP_112777869.1\|3895266_3898671_+	tape measure protein	R9TMK1	Aeromonas_phage	5.6e-186	50.4
WP_047653432.1\|3898699_3898927_-	hypothetical protein	NA	NA	NA	NA
WP_058672788.1\|3899002_3899350_+\|tail	phage tail protein	H6WRV8	Salmonella_phage	5.9e-59	93.0
WP_158606049.1\|3899371_3899527_+	hypothetical protein	NA	NA	NA	NA
WP_022651024.1\|3899505_3899703_-	hypothetical protein	NA	NA	NA	NA
WP_023296451.1\|3899868_3900573_+\|tail	phage minor tail protein L	A0A1V0E5N2	Salmonella_phage	1.9e-136	99.1
WP_048982705.1\|3900572_3901292_+	C40 family peptidase	A0A1V0E5M9	Salmonella_phage	6.0e-122	82.7
WP_048982701.1\|3901234_3901768_+\|tail	tail assembly protein	H6WRW3	Salmonella_phage	4.0e-54	67.6
WP_112777868.1\|3901777_3905605_+	DUF1983 domain-containing protein	I6R9B3	Salmonella_phage	0.0e+00	60.5
WP_063251055.1\|3905606_3906572_+	hypothetical protein	G1CSU0	Cronobacter_virus	3.3e-59	40.2
WP_112778019.1\|3906632_3907934_+\|tail	phage tail protein	G8C7R8	Escherichia_phage	5.4e-121	56.2
WP_154232874.1\|3908028_3908268_-	hypothetical protein	NA	NA	NA	NA
WP_058672784.1\|3908255_3908579_+	hypothetical protein	K7PGV5	Enterobacterial_phage	2.2e-23	51.4

DBSCAN-SWA_298

3917451 : 3919446

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857557.1\|3917451_3918750_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	3.6e-16	24.5
WP_003857554.1\|3919074_3919446_-	anti-adapter protein IraM	Q20GJ2	Phage_258-320	2.5e-15	38.9

DBSCAN-SWA_299

3931086 : 3931602

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857532.1\|3931086_3931602_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.2e-24	56.9

DBSCAN-SWA_300

3937963 : 3946769

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346502.1\|3937963_3939625_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-09	63.3
WP_045142525.1\|3939770_3940637_+	aldo/keto reductase family oxidoreductase	NA	NA	NA	NA
WP_003857516.1\|3940683_3940884_-	hypothetical protein	NA	NA	NA	NA
WP_003857514.1\|3941209_3941629_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	6.7e-33	54.3
WP_032609077.1\|3941976_3944406_+	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
WP_045346503.1\|3944492_3946769_-	pyrroloquinoline quinone biosynthesis protein PqqF	A0A2P1EIE5	Megavirus	5.0e-05	26.6

DBSCAN-SWA_301

3951249 : 3952515

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346507.1\|3951249_3952515_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	5.3e-206	81.5

DBSCAN-SWA_302

3966358 : 3967507

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857446.1\|3966358_3967507_-	osmoprotectant ABC transporter ATP-binding protein OsmV	G9BWD6	Planktothrix_phage	8.3e-25	32.6

DBSCAN-SWA_303

3971835 : 3975242

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045351135.1\|3971835_3972513_+	type A chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	4.2e-77	63.1
WP_003857437.1\|3972688_3973000_-	YebG family protein	NA	NA	NA	NA
WP_015570619.1\|3973109_3973724_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	1.9e-28	34.7
WP_032609102.1\|3973768_3974623_-	dimethyl sulfoxide reductase anchor subunit family protein	A0A077SK59	Escherichia_phage	7.6e-23	34.6
WP_017384545.1\|3974624_3975242_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.0e-74	59.1

DBSCAN-SWA_304

3982840 : 4001765

Escherichia_phage(10.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777744.1\|3982840_3984310_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	7.2e-122	50.5
WP_003857424.1\|3984440_3984746_-	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_003857421.1\|3984848_3985703_-	benzoate transporter	M1I711	Paramecium_bursaria_Chlorella_virus	8.1e-25	33.2
WP_003857419.1\|3985895_3986606_+	YnfC family lipoprotein	NA	NA	NA	NA
WP_003857416.1\|3986623_3987184_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_003857414.1\|3987183_3987522_-	DUF1283 family protein	NA	NA	NA	NA
WP_003857412.1\|3987672_3987999_+	YnfA family protein	A0A218MNG8	uncultured_virus	7.1e-22	54.5
WP_003857410.1\|3988110_3989325_+	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	3.3e-48	30.0
WP_003857408.1\|3989339_3990359_+	Zn-dependent oxidoreductase	NA	NA	NA	NA
WP_045346320.1\|3990432_3991812_+	MHS family MFS transporter	NA	NA	NA	NA
WP_112777743.1\|3992035_3993499_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	2.2e-46	30.5
WP_003857405.1\|3993543_3993747_-	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	4.4e-14	56.7
WP_045333004.1\|3994034_3994466_+	universal stress protein	A0A1W6JNV4	Morganella_phage	4.5e-16	34.5
WP_003857403.1\|3994501_3995188_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_045346319.1\|3995278_3996025_-	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
WP_045346318.1\|3996168_3998202_+	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	1.3e-20	21.1
WP_032645704.1\|3998328_3999120_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_039268873.1\|3999229_4000033_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003857394.1\|4000141_4000633_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_003857392.1\|4000692_4001376_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.4e-80	60.0
WP_003857390.1\|4001525_4001765_-	DinI family protein	K7PKM2	Enterobacterial_phage	5.0e-33	91.1

DBSCAN-SWA_305

4009458 : 4010448

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857375.1\|4009458_4010448_-	2-hydroxyacid dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	1.6e-69	44.7

DBSCAN-SWA_306

4035400 : 4037377

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777739.1\|4035400_4037377_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	2.4e-157	45.2

DBSCAN-SWA_307

4041771 : 4042992

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857310.1\|4041771_4042992_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	4.1e-38	31.6

DBSCAN-SWA_308

4049198 : 4054687

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045336212.1\|4049198_4049885_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	8.5e-09	31.1
WP_023324612.1\|4049975_4050581_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_112777738.1\|4050784_4054687_+	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	5.0e-53	29.4

DBSCAN-SWA_309

4061640 : 4064036

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857288.1\|4061640_4062171_+	cytochrome b561	A0A0U2QLA7	Escherichia_phage	1.0e-17	43.0
WP_045346296.1\|4062211_4063279_-	oxidoreductase	NA	NA	NA	NA
WP_045346295.1\|4063292_4064036_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	8.6e-15	28.1

DBSCAN-SWA_310

4084460 : 4086626

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045336224.1\|4084460_4086626_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.0e-31	27.4

DBSCAN-SWA_311

4094431 : 4095550

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112778020.1\|4094431_4095550_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	4.7e-33	29.1

DBSCAN-SWA_312

4099979 : 4101473

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777785.1\|4099979_4101473_+	carboxylesterase/lipase family protein	S4VZJ7	Pandoravirus	2.2e-33	30.6

DBSCAN-SWA_313

4109581 : 4110811

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058673127.1\|4109581_4110811_-	peptidase T	A0A0K2CPK3	Brevibacillus_phage	2.1e-05	39.1

DBSCAN-SWA_314

4117150 : 4122841

Phage_TP(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346277.1\|4117150_4119115_+	U32 family peptidase	Q6DW11	Phage_TP	2.7e-23	28.5
WP_015570548.1\|4119111_4119345_-	DUF2554 family protein	NA	NA	NA	NA
WP_003857209.1\|4119588_4119951_+	hypothetical protein	NA	NA	NA	NA
WP_045346322.1\|4120098_4121097_-	transcriptional regulator FtrA	NA	NA	NA	NA
WP_003857206.1\|4121170_4121581_+	rhodanese	NA	NA	NA	NA
WP_045346275.1\|4121737_4122841_+	cobalamin-independent methionine synthase II family protein	A0A218MNE0	uncultured_virus	2.4e-101	48.1

DBSCAN-SWA_315

4126982 : 4128488

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015570541.1\|4126982_4127780_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.2e-11	26.8
WP_032609186.1\|4127789_4128488_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	5.2e-14	25.7

DBSCAN-SWA_316

4131821 : 4132202

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001303241.1\|4131821_4132202_-	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	2.1e-09	33.3

DBSCAN-SWA_317

4142099 : 4143065

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032609205.1\|4142099_4143065_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.9e-12	30.9

DBSCAN-SWA_318

4149312 : 4151345

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651194.1\|4149312_4150053_+	response regulator	W8CYM9	Bacillus_phage	2.5e-30	35.5
WP_045346258.1\|4150049_4151345_+	ATP-binding protein	W8CYF6	Bacillus_phage	3.0e-15	24.2

DBSCAN-SWA_319

4188238 : 4189123

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651207.1\|4188238_4189123_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.7e-82	56.5

DBSCAN-SWA_320

4197326 : 4201424

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346213.1\|4197326_4198877_-	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-06	21.8
WP_045349982.1\|4198972_4199989_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_045346215.1\|4200017_4201424_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	4.4e-12	23.2

DBSCAN-SWA_321

4213499 : 4216151

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651223.1\|4213499_4214486_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	31.6
WP_003857074.1\|4214478_4215405_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-14	29.3
WP_003857073.1\|4215401_4216151_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.2e-17	33.7

DBSCAN-SWA_322

4222989 : 4225916

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777705.1\|4222989_4224699_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	9.4e-41	25.3
WP_045346225.1\|4224905_4225916_+	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	1.7e-26	25.8

DBSCAN-SWA_323

4236370 : 4238980

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314189.1\|4236370_4237444_+	porin OmpD	Q1MVN1	Enterobacteria_phage	6.6e-149	70.4
WP_112777703.1\|4237489_4238980_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	5.7e-34	31.3

DBSCAN-SWA_324

4245073 : 4246618

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857031.1\|4245073_4246618_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_325

4249718 : 4257773

Acinetobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072050846.1\|4249718_4250081_+	CHAP domain-containing protein	I3WW63	Acinetobacter_phage	3.0e-05	30.0
WP_058673144.1\|4250080_4250506_+	DUF3828 domain-containing protein	NA	NA	NA	NA
WP_045346233.1\|4250573_4252676_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.4e-62	27.0
WP_045346235.1\|4252837_4253137_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023324686.1\|4253129_4253771_-	hypothetical protein	NA	NA	NA	NA
WP_023314194.1\|4253862_4254864_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	3.3e-54	40.2
WP_032609265.1\|4255050_4255281_-	tautomerase PptA	NA	NA	NA	NA
WP_045346236.1\|4255318_4255936_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_003857009.1\|4256102_4256990_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003857007.1\|4256999_4257773_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-20	31.5

DBSCAN-SWA_326

4263720 : 4264260

Leuconostoc_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856993.1\|4263720_4264260_-	adenylate kinase	A0A097BYE2	Leuconostoc_phage	3.4e-13	34.7

DBSCAN-SWA_327

4268958 : 4271076

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023314203.1\|4268958_4271076_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	6.7e-137	67.4

DBSCAN-SWA_328

4297030 : 4338785

Escherichia_phage(20.0%)

integrase,tRNA,transposase,plate

attL 4295781:4295797|attR 4348660:4348676

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4295781:4295797	attL	NA	NA	NA	NA
WP_112777697.1\|4297030_4298158_+	porin OmpC	Q1MVN1	Enterobacteria_phage	3.0e-120	60.6
WP_022651250.1\|4298192_4298615_-	GFA family protein	NA	NA	NA	NA
WP_003856931.1\|4298618_4298816_-	hypothetical protein	NA	NA	NA	NA
WP_071785691.1\|4299236_4299437_+\|integrase	tyrosine-type recombinase/integrase	A0A0U2JGI6	Escherichia_phage	1.1e-20	71.7
WP_045346248.1\|4299764_4300436_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	4.2e-77	59.5
WP_023314222.1\|4300524_4301409_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023314223.1\|4301511_4302606_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_045346249.1\|4302643_4303525_+	arginase family protein	NA	NA	NA	NA
WP_112778021.1\|4303868_4304925_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	4.8e-128	74.7
WP_003856923.1\|4305442_4306378_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.0e-142	95.7
WP_045337431.1\|4306421_4307795_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.6e-51	31.9
WP_163270243.1\|4307852_4308005_-	hypothetical protein	NA	NA	NA	NA
WP_023314230.1\|4308279_4309263_-	zinc transporter ZntB	NA	NA	NA	NA
WP_080339342.1\|4309353_4310484_-	chemoreceptor protein	NA	NA	NA	NA
WP_058659765.1\|4310800_4311289_-	hypothetical protein	NA	NA	NA	NA
WP_058673151.1\|4311317_4312634_-	ImpA family type VI secretion system protein	NA	NA	NA	NA
WP_045347387.1\|4312657_4313113_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_045347389.1\|4313112_4313658_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_023324760.1\|4313635_4314721_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_023324761.1\|4314684_4316439_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_045347392.1\|4316480_4318082_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_112777828.1\|4318081_4321480_-	type VI secretion protein VasK	NA	NA	NA	NA
WP_045347397.1\|4321485_4322916_-	hypothetical protein	NA	NA	NA	NA
WP_032648447.1\|4322915_4323179_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_045347399.1\|4323267_4323999_-	DUF3274 domain-containing protein	NA	NA	NA	NA
WP_058673152.1\|4324560_4324947_-	hypothetical protein	A0A077K801	Ralstonia_phage	1.3e-09	41.2
WP_127913678.1\|4324971_4325202_-	hypothetical protein	NA	NA	NA	NA
WP_045347410.1\|4325191_4326241_-	hypothetical protein	NA	NA	NA	NA
WP_072049647.1\|4326242_4326866_-	DUF2345 domain-containing protein	NA	NA	NA	NA
WP_072026010.1\|4326804_4327065_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_045347413.1\|4327065_4328997_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.3e-59	29.8
WP_045347416.1\|4329250_4331743_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	8.7e-19	33.1
WP_112778022.1\|4331739_4334385_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.9e-96	32.4
WP_045347680.1\|4334558_4335050_-	type VI secretion system effector Hcp	NA	NA	NA	NA
WP_063251064.1\|4335055_4336762_-	OmpA family protein	NA	NA	NA	NA
WP_045347663.1\|4336758_4337448_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_032628287.1\|4337444_4338785_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
4348660:4348676	attR	NA	NA	NA	NA

DBSCAN-SWA_329

4351879 : 4352962

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032609322.1\|4351879_4352962_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.1e-13	29.3

DBSCAN-SWA_330

4370040 : 4379524

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856840.1\|4370040_4371033_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	2.3e-07	26.1
WP_003856838.1\|4371034_4371841_+	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.8e-13	26.8
WP_003856836.1\|4371837_4372428_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_112777633.1\|4372560_4372962_+	RidA family protein	NA	NA	NA	NA
WP_032609348.1\|4373839_4375180_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.2e-17	30.0
WP_003856831.1\|4375573_4376362_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_045346337.1\|4376514_4377501_+	oxidoreductase	NA	NA	NA	NA
WP_045346338.1\|4377589_4379524_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	5.5e-05	23.3

DBSCAN-SWA_331

4388180 : 4388771

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856813.1\|4388180_4388771_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-42	48.4

DBSCAN-SWA_332

4393695 : 4398025

Tupanvirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856806.1\|4393695_4396293_-	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	4.6e-87	34.0
WP_003856804.1\|4396691_4396943_+	YciN family protein	NA	NA	NA	NA
WP_022651351.1\|4396978_4398025_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	1.3e-19	29.2

DBSCAN-SWA_333

4403974 : 4406932

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856782.1\|4403974_4405570_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.8e-49	37.0
WP_003856781.1\|4405573_4406932_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.0e-37	41.0

DBSCAN-SWA_334

4421206 : 4424103

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856745.1\|4421206_4422043_-	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	6.1e-09	39.8
WP_003856743.1\|4422088_4423093_-	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G3M9Y6	Bacillus_virus	8.9e-15	30.7
WP_003856742.1\|4423089_4424103_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-15	29.4

DBSCAN-SWA_335

4432318 : 4442516

Citrobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856726.1\|4432318_4432933_-	thymidine kinase	A0A0A0YP64	Citrobacter_phage	1.7e-56	54.7
WP_003856724.1\|4433483_4433897_+	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
WP_003856723.1\|4434099_4435005_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.6e-58	47.2
WP_003856721.1\|4435204_4436218_-	two-component system response regulator RssB	NA	NA	NA	NA
WP_003856719.1\|4436307_4437210_-	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_045333133.1\|4437323_4437788_+	YchJ family protein	NA	NA	NA	NA
WP_003856715.1\|4437829_4438672_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.7e-12	49.3
WP_003856712.1\|4439596_4440274_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_022651366.1\|4440273_4440984_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_017384243.1\|4440980_4442516_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.7e-20	42.2

DBSCAN-SWA_336

4458851 : 4459640

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045336446.1\|4458851_4459640_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-30	36.9

DBSCAN-SWA_337

4463711 : 4472544

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346350.1\|4463711_4465496_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-14	34.6
WP_015570352.1\|4465690_4465930_+	hypothetical protein	NA	NA	NA	NA
WP_112777636.1\|4465960_4466656_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_003856674.1\|4466832_4467063_-	putative cation transport regulator ChaB	A0A1S5YE01	Mythimna_unipuncta_granulovirus	1.0e-06	45.3
WP_003856672.1\|4467331_4468432_+	sodium-potassium/proton antiporter ChaA	NA	NA	NA	NA
WP_003856671.1\|4468538_4469393_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.4e-47	39.5
WP_003856670.1\|4469429_4470239_-	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_023314273.1\|4470242_4470635_-	SirB family protein	NA	NA	NA	NA
WP_045346353.1\|4470631_4471462_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003856667.1\|4471461_4472544_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.5e-07	41.6

DBSCAN-SWA_338

4475646 : 4478398

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856663.1\|4475646_4476594_+	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	3.9e-44	37.8
WP_032658872.1\|4476718_4478398_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	6.7e-23	24.0

DBSCAN-SWA_339

4488371 : 4489124

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052686896.1\|4488371_4489124_-	Appr-1-p processing protein	A0A2L1IVW3	Streptomyces_phage	3.8e-18	34.6

DBSCAN-SWA_340

4495693 : 4506691

Serratia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777638.1\|4495693_4500118_-	RHS domain-containing protein	A0A2H4JHK7	uncultured_Caudovirales_phage	9.6e-29	50.8
WP_023324829.1\|4500121_4500562_-	DUF1795 domain-containing protein	NA	NA	NA	NA
WP_022651393.1\|4500770_4501289_-	hypothetical protein	NA	NA	NA	NA
WP_058672750.1\|4501278_4503861_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-45	27.0
WP_058672751.1\|4504020_4505121_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	7.9e-57	42.8
WP_022651396.1\|4505159_4505540_-	hypothetical protein	NA	NA	NA	NA
WP_045337769.1\|4505620_4506691_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	1.8e-58	42.6

DBSCAN-SWA_341

4510117 : 4518952

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058672753.1\|4510117_4512076_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.6e-44	27.2
WP_058672754.1\|4512159_4512615_-	hypothetical protein	NA	NA	NA	NA
WP_032661818.1\|4512628_4513375_-	accessory protein	NA	NA	NA	NA
WP_003859977.1\|4513386_4514853_-	hypothetical protein	NA	NA	NA	NA
WP_022651404.1\|4514878_4516312_-	serine/threonine protein kinase	M1HKB5	Acanthocystis_turfacea_Chlorella_virus	6.1e-09	27.0
WP_045347053.1\|4516336_4518952_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	3.2e-80	31.3

DBSCAN-SWA_342

4527367 : 4528357

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006810951.1\|4527367_4528357_-	hypothetical protein	A0A2H4JEI9	uncultured_Caudovirales_phage	3.2e-41	32.6

DBSCAN-SWA_343

4564997 : 4572240

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859933.1\|4564997_4566683_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	26.0
WP_047653749.1\|4566886_4567468_-	Slp family lipoprotein	NA	NA	NA	NA
WP_032658967.1\|4567505_4568201_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003859928.1\|4568267_4570178_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	8.0e-89	32.0
WP_003859925.1\|4570661_4570844_-	YoaH family protein	NA	NA	NA	NA
WP_003859923.1\|4570905_4572240_+	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	6.4e-45	41.9

DBSCAN-SWA_344

4576098 : 4577658

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859916.1\|4576098_4577658_-	CNNM family cation transport protein YoaE	A0A0R6PEZ3	Moraxella_phage	6.0e-42	45.4

DBSCAN-SWA_345

4585090 : 4585300

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062678.1\|4585090_4585300_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_346

4590564 : 4592613

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859896.1\|4590564_4592613_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	7.8e-82	32.6

DBSCAN-SWA_347

4599831 : 4648875

Salmonella_phage(28.33%)

integrase,head,terminase,holin

attL 4615145:4615159|attR 4653300:4653314

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045347139.1\|4599831_4600476_-	protein-serine/threonine phosphatase	S4TNS0	Salmonella_phage	6.2e-54	45.0
WP_003859879.1\|4600643_4601624_+	DUF535 domain-containing protein	NA	NA	NA	NA
WP_058672762.1\|4602053_4603322_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	4.4e-229	91.2
WP_080399863.1\|4603321_4603627_-	hypothetical protein	K7PGV5	Enterobacterial_phage	5.6e-13	41.6
WP_045340345.1\|4603738_4604101_+	GtrA family protein	U5P0S6	Shigella_phage	2.0e-49	84.2
WP_058672764.1\|4604097_4605015_+	glycosyltransferase family 2 protein	U5P087	Shigella_phage	1.3e-158	91.4
WP_058672765.1\|4605014_4606622_+	hypothetical protein	B9UDL6	Salmonella_phage	1.7e-60	31.4
WP_112777642.1\|4608656_4611134_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	0.0e+00	93.1
WP_032677284.1\|4611120_4611486_-	C40 family peptidase	F1C5F2	Cronobacter_phage	1.6e-62	90.8
WP_015571561.1\|4611499_4611970_-	hypothetical protein	F1C5F1	Cronobacter_phage	1.0e-66	80.1
WP_058672993.1\|4611969_4612467_-	hypothetical protein	F1C5F0	Cronobacter_phage	2.1e-89	91.5
WP_058672994.1\|4612466_4614791_-	tape measure protein	A0A1B1W284	Salmonella_phage	1.7e-146	52.2
WP_016245416.1\|4614848_4615223_-	membrane lipoprotein lipid attachment site-containing protein	A0A0M4QWT0	Salmonella_phage	5.1e-24	53.4
4615145:4615159	attL	NA	NA	NA	NA
WP_058672995.1\|4615295_4616039_-	hypothetical protein	G0ZNE7	Cronobacter_phage	7.7e-64	52.6
WP_047724454.1\|4616089_4616845_-	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	9.9e-59	53.4
WP_032619446.1\|4616903_4617287_-	hypothetical protein	F1C5E4	Cronobacter_phage	4.9e-38	57.5
WP_058672996.1\|4617283_4617652_-	hypothetical protein	F1C5E3	Cronobacter_phage	1.8e-45	75.4
WP_045324574.1\|4617694_4617883_-	hypothetical protein	NA	NA	NA	NA
WP_045324576.1\|4617896_4618247_-	hypothetical protein	G0ZNE2	Cronobacter_phage	8.9e-39	67.0
WP_033486569.1\|4618246_4618420_-	hypothetical protein	I6R0P9	Salmonella_phage	6.0e-12	49.1
WP_058672997.1\|4618419_4618821_-	hypothetical protein	G0ZNE1	Cronobacter_phage	1.4e-56	79.7
WP_058672998.1\|4618883_4619177_-	hypothetical protein	A0A1V0E5P8	Salmonella_phage	1.9e-42	89.7
WP_058672999.1\|4619186_4620263_-	hypothetical protein	Q5G8Y0	Enterobacteria_phage	1.6e-179	88.0
WP_058673000.1\|4620280_4620730_-	hypothetical protein	A0A1V0E5Q8	Salmonella_phage	2.7e-64	85.2
WP_112777643.1\|4620742_4622008_-	hypothetical protein	Q5G8Y2	Enterobacteria_phage	1.7e-220	91.4
WP_058673024.1\|4622010_4622937_-\|head	phage head morphogenesis protein	Q5G8Y3	Enterobacteria_phage	4.0e-163	92.9
WP_058673025.1\|4622896_4624246_-	DUF1073 domain-containing protein	A0A1V0E5Q5	Salmonella_phage	7.8e-232	87.3
WP_058673026.1\|4624261_4625740_-	DNA-packaging protein	G0ZND4	Cronobacter_phage	1.5e-257	87.6
WP_058673027.1\|4625726_4626299_-\|terminase	terminase small subunit	G0ZND3	Cronobacter_phage	2.2e-71	72.6
WP_058673028.1\|4626321_4626546_+	hypothetical protein	NA	NA	NA	NA
WP_063137118.1\|4626611_4626830_-	hypothetical protein	NA	NA	NA	NA
WP_112778023.1\|4627159_4627678_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	2.3e-91	97.7
WP_112777772.1\|4628101_4628488_-	DUF2570 domain-containing protein	A0A192Y6H8	Salmonella_phage	2.1e-12	38.1
WP_025760164.1\|4628484_4628925_-	lysozyme	A0A0M4R365	Salmonella_phage	9.5e-62	81.9
WP_001514184.1\|4628928_4629204_-\|holin	phage holin family protein	S4TNV9	Salmonella_phage	5.8e-09	41.0
WP_001514183.1\|4629200_4629602_-	hypothetical protein	NA	NA	NA	NA
WP_045332618.1\|4629875_4630376_-	antiterminator	G8C7V7	Escherichia_phage	5.5e-90	95.7
WP_058647991.1\|4630488_4631133_-	recombination protein NinG	S4TSR3	Salmonella_phage	2.1e-73	69.6
WP_058647992.1\|4631126_4631594_-	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	2.1e-35	50.7
WP_112777771.1\|4631590_4631761_-	NinE family protein	K7P7K0	Enterobacteria_phage	2.5e-18	86.8
WP_112777770.1\|4631753_4632203_-	recombination protein NinB	I6R9D0	Salmonella_phage	1.9e-33	47.2
WP_176691857.1\|4632389_4632545_-	hypothetical protein	NA	NA	NA	NA
WP_176691858.1\|4632557_4633154_-	hypothetical protein	Q8HAA7	Salmonella_phage	3.0e-26	44.7
WP_112777769.1\|4633157_4633439_-	hypothetical protein	A0A077KAZ4	Edwardsiella_phage	5.2e-29	73.9
WP_112777768.1\|4633441_4633801_-	ead/Ea22-like family protein	K7PLZ3	Enterobacterial_phage	6.0e-06	46.3
WP_112777766.1\|4633991_4634180_-	hypothetical protein	NA	NA	NA	NA
WP_112777765.1\|4634176_4634482_-	hypothetical protein	A0A0F6N6A6	Escherichia_phage	1.7e-14	53.1
WP_112777764.1\|4634478_4634727_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_176691861.1\|4634723_4635023_-	protein ren	M1FPD5	Enterobacteria_phage	1.3e-14	48.4
WP_112777762.1\|4635027_4636401_-	replicative DNA helicase	E5AGF0	Erwinia_phage	8.4e-165	63.1
WP_112777761.1\|4636397_4637483_-	replication protein	E5AGE9	Erwinia_phage	1.5e-84	45.4
WP_015571544.1\|4637475_4637622_-	hypothetical protein	NA	NA	NA	NA
WP_112777760.1\|4637711_4638278_-	hypothetical protein	NA	NA	NA	NA
WP_032676295.1\|4638308_4638524_-	helix-turn-helix transcriptional regulator	K7PMD5	Enterobacterial_phage	1.7e-27	81.7
WP_052254344.1\|4638627_4639269_+	helix-turn-helix domain-containing protein	K7PH71	Enterobacterial_phage	5.2e-93	76.8
WP_045286845.1\|4639461_4640319_+	NYN domain-containing protein	A4JWQ6	Burkholderia_virus	7.6e-39	39.7
WP_112777759.1\|4640456_4640654_-	hypothetical protein	G8C7T7	Escherichia_phage	4.6e-24	92.2
WP_127913676.1\|4640920_4641298_+	hypothetical protein	NA	NA	NA	NA
WP_059453074.1\|4641587_4641785_+	DUF1482 family protein	NA	NA	NA	NA
WP_112777758.1\|4641856_4642141_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	3.2e-47	94.7
WP_032608701.1\|4642159_4643005_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	4.5e-68	55.4
WP_024198026.1\|4643001_4643682_+	YqaJ viral recombinase family protein	M9NZE1	Enterobacteria_phage	6.9e-128	95.6
WP_112777757.1\|4643678_4644107_+	regulator	M9NYX4	Enterobacteria_phage	1.5e-72	95.8
WP_163374164.1\|4644103_4644271_+	hypothetical protein	G8C7S7	Escherichia_phage	2.5e-23	98.1
WP_112777756.1\|4644267_4644927_+	DNA methyltransferase	G8C7S6	Escherichia_phage	2.7e-121	93.2
WP_112777755.1\|4644923_4645142_+	hypothetical protein	NA	NA	NA	NA
WP_042889503.1\|4645138_4645435_+	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	2.4e-29	66.7
WP_112777754.1\|4645431_4645623_+	DUF1382 family protein	A0A0P0ZC60	Stx2-converting_phage	4.6e-13	62.7
WP_112777753.1\|4645714_4646224_+	HNH endonuclease	A0A1W6DY33	Salmonella_phage	6.5e-38	48.8
WP_047355337.1\|4646440_4646932_+	HNH endonuclease	Q7Y5G7	Xanthomonas_virus	4.9e-35	49.0
WP_094058358.1\|4646974_4647205_+	hypothetical protein	G8C7S3	Escherichia_phage	8.8e-35	98.7
WP_022650951.1\|4647313_4647562_+	excisionase family protein	S4TND0	Salmonella_phage	8.3e-15	50.0
WP_058672823.1\|4647594_4648875_+\|integrase	site-specific integrase	B6DZ48	Enterobacteria_phage	1.1e-123	50.9
4653300:4653314	attR	NA	NA	NA	NA

DBSCAN-SWA_348

4665182 : 4666457

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017384594.1\|4665182_4666457_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.5e-86	43.0

DBSCAN-SWA_349

4669754 : 4671119

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058672819.1\|4669754_4671119_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	9.0e-18	35.6

DBSCAN-SWA_350

4674893 : 4675412

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023313963.1\|4674893_4675412_-	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	3.7e-49	56.6

DBSCAN-SWA_351

4682271 : 4693432

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023313959.1\|4682271_4683030_+	C40 family peptidase	A0A217EQL1	Bacillus_phage	9.4e-17	38.7
WP_003857629.1\|4683152_4683734_+	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	6.2e-45	45.3
WP_045346483.1\|4683771_4684938_-	MFS transporter	NA	NA	NA	NA
WP_003857632.1\|4685099_4685189_-	YnhF family membrane protein	NA	NA	NA	NA
WP_003857634.1\|4685486_4686512_+	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	1.3e-32	32.2
WP_003857638.1\|4686529_4687441_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045336562.1\|4687553_4688753_+	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003857641.1\|4689051_4690200_+	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	3.6e-84	44.8
WP_003857643.1\|4690231_4690873_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	3.9e-24	37.3
WP_045346480.1\|4691098_4692472_+	MdtK family multidrug efflux MATE transporter	NA	NA	NA	NA
WP_003857647.1\|4692961_4693432_-	Hsp20 family protein	A0A1D7SNF0	Cyanophage	5.8e-09	31.8

DBSCAN-SWA_352

4704815 : 4709025

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072050849.1\|4704815_4705082_-	PAAR domain-containing protein	E5E3Y0	Burkholderia_phage	1.3e-05	37.8
WP_058672817.1\|4706237_4707011_-	hypothetical protein	NA	NA	NA	NA
WP_058672816.1\|4707003_4709025_-	lipase family protein	A0A2R8FER2	Brazilian_cedratvirus	2.1e-07	30.6

DBSCAN-SWA_353

4712875 : 4715506

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112778024.1\|4712875_4715506_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.9e-96	32.4

DBSCAN-SWA_354

4728787 : 4729603

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023324533.1\|4728787_4729603_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-35	41.4

DBSCAN-SWA_355

4732814 : 4735608

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058673110.1\|4732814_4733837_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-14	23.9
WP_045346468.1\|4734237_4735608_+	cystathionine beta-synthase	A0A1W6JHY1	Lactococcus_phage	5.4e-47	36.8

DBSCAN-SWA_356

4740717 : 4747952

environmental_halophage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346417.1\|4740717_4741938_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.3e-92	41.9
WP_045346418.1\|4741934_4743206_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003857736.1\|4743180_4743927_-	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	3.3e-06	24.3
WP_003857739.1\|4743936_4745427_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_003857741.1\|4745435_4745804_-	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	2.9e-16	42.2
WP_045346421.1\|4746300_4746660_+	hypothetical protein	NA	NA	NA	NA
WP_032609046.1\|4746661_4747114_+	DUF3828 domain-containing protein	NA	NA	NA	NA
WP_050871090.1\|4747223_4747952_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.1e-50	50.8

DBSCAN-SWA_357

4770136 : 4774881

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023305974.1\|4770136_4772515_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.5e-172	36.7
WP_017384644.1\|4772850_4773684_+	posphoenolpyruvate synthetase regulatory kinase/phosphorylase PpsR	NA	NA	NA	NA
WP_045346435.1\|4773834_4774881_+	3-deoxy-7-phosphoheptulonate synthase AroH	S4W5F1	Pandoravirus	6.1e-83	47.4

DBSCAN-SWA_358

4780201 : 4793621

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346437.1\|4780201_4780981_+	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.4e-12	29.1
WP_003857792.1\|4780977_4782420_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	5.7e-55	34.7
WP_003857794.1\|4782481_4783195_-	EAL domain-containing protein	NA	NA	NA	NA
WP_015570730.1\|4783488_4783953_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.3e-13	36.7
WP_022650906.1\|4784025_4784781_-	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2K9L407	Tupanvirus	1.7e-10	26.2
WP_045346439.1\|4784780_4785332_-	glutathione peroxidase	NA	NA	NA	NA
WP_022650904.1\|4785365_4786346_-	vitamin B12 ABC transporter permease BtuC	NA	NA	NA	NA
WP_003857805.1\|4786449_4786749_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_058673106.1\|4786753_4789141_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003857809.1\|4789156_4790140_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	9.9e-35	43.2
WP_001386830.1\|4790277_4790322_-	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_000124850.1\|4790444_4790801_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_001124225.1\|4790851_4791049_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_023616141.1\|4791146_4791689_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.8e-15	32.9
WP_003857814.1\|4791692_4793621_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.9e-128	37.1

DBSCAN-SWA_359

4799736 : 4805444

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003857827.1\|4799736_4800498_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-17	32.3
WP_112777726.1\|4800593_4801184_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_015570743.1\|4801311_4802703_+	cystine/sulfocysteine:cation symporter	NA	NA	NA	NA
WP_071785203.1\|4802751_4803006_-	cell division activator CedA	NA	NA	NA	NA
WP_112777725.1\|4803194_4805444_+	catalase HPII	A0A2K9L572	Tupanvirus	8.4e-138	48.0

DBSCAN-SWA_360

4811638 : 4812466

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112777723.1\|4811638_4812466_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.9e-71	54.2

DBSCAN-SWA_361

4819796 : 4821017

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650886.1\|4819796_4821017_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-25	27.5

DBSCAN-SWA_362

4825624 : 4826245

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022650881.1\|4825624_4826245_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.8e-08	28.4

DBSCAN-SWA_363

4831166 : 4833074

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058673103.1\|4831166_4833074_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.2e-40	29.5

DBSCAN-SWA_364

4837902 : 4840020

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045346459.1\|4837902_4838544_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	3.6e-17	34.6
WP_058673102.1\|4838763_4840020_+	glycoside hydrolase family 18 protein	W5VKF1	Buzura_suppressaria_nuclear_polyhedrosis_virus	1.5e-22	27.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP030079

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3436 : 46373

Escherichia_phage(27.78%)

integrase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112778029.1\|3436_4141_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	2.0e-138	99.6
WP_049824851.1\|4150_4621_+	TetR family transcriptional regulator	A0A0R6PIB6	Moraxella_phage	5.3e-10	32.7
WP_014839978.1\|4640_5429_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014839979.1\|5428_5947_+	hypothetical protein	NA	NA	NA	NA
WP_014839980.1\|5951_6368_-	fosfomycin resistance glutathione transferase FosA3	Q2LI91	Bacillus_phage	2.0e-08	35.6
WP_001067855.1\|6753_7458_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000219391.1\|7579_8485_+	Mph(A) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_000004159.1\|8481_9720_+	MFS transporter	NA	NA	NA	NA
WP_001137892.1\|9719_10304_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001389365.1\|10796_11561_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001067855.1\|11730_12435_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_112777775.1\|12471_13452_-	hypothetical protein	NA	NA	NA	NA
WP_053389732.1\|13451_13712_-	hypothetical protein	NA	NA	NA	NA
WP_053389733.1\|14326_14596_+	hypothetical protein	NA	NA	NA	NA
WP_053389734.1\|14647_15034_+	hypothetical protein	NA	NA	NA	NA
WP_069325153.1\|15045_15579_+	hypothetical protein	NA	NA	NA	NA
WP_053389736.1\|15583_16360_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	3.6e-48	85.1
WP_053389737.1\|16453_16738_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_048227675.1\|16785_17439_-	AAA family ATPase	E5FFJ3	Burkholderia_phage	7.0e-45	45.4
WP_048227674.1\|17716_18688_+	hypothetical protein	A0A222YXF2	Escherichia_phage	1.4e-68	44.5
WP_053389738.1\|18692_19082_+	plasmid partitioning/stability family protein	NA	NA	NA	NA
WP_053389739.1\|19085_20357_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	3.5e-157	64.0
WP_048227699.1\|20356_20785_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.3e-28	51.2
WP_053389740.1\|21239_21983_+	hypothetical protein	NA	NA	NA	NA
WP_072206635.1\|22337_22799_+	hypothetical protein	NA	NA	NA	NA
WP_053389741.1\|22798_23137_+	hypothetical protein	NA	NA	NA	NA
WP_053389742.1\|23500_24280_+	hypothetical protein	NA	NA	NA	NA
WP_053389743.1\|24687_25197_+	antirestriction protein ArdA	A0A222ZHP3	Rhodococcus_phage	6.3e-09	30.8
WP_048227667.1\|25239_25428_+	hypothetical protein	NA	NA	NA	NA
WP_176691863.1\|25589_25823_+	hypothetical protein	NA	NA	NA	NA
WP_158236436.1\|25958_26108_+	hypothetical protein	NA	NA	NA	NA
WP_077223967.1\|26250_26583_+	DUF905 family protein	NA	NA	NA	NA
WP_053389745.1\|26650_28639_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	1.7e-25	30.2
WP_053389746.1\|28682_29108_+	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
WP_048227664.1\|29104_29839_+	plasmid SOS inhibition protein A	NA	NA	NA	NA
WP_048227663.1\|29835_30072_+	hypothetical protein	NA	NA	NA	NA
WP_040231232.1\|30303_30462_+	type I toxin-antitoxin system Hok family toxin	NA	NA	NA	NA
WP_040231230.1\|31369_31726_+	hypothetical protein	NA	NA	NA	NA
WP_053389747.1\|31768_32587_+	N-6 DNA methylase	H7BVT3	unidentified_phage	4.0e-13	34.4
WP_053389748.1\|32666_33158_+	antirestriction protein	NA	NA	NA	NA
WP_053389749.1\|33202_33505_+	DUF957 domain-containing protein	NA	NA	NA	NA
WP_053389750.1\|33501_33759_-	helix-turn-helix transcriptional regulator	A0A248SLB9	Klebsiella_phage	2.3e-07	48.3
WP_048227658.1\|34514_34661_+	hypothetical protein	NA	NA	NA	NA
WP_053389751.1\|34715_35285_+	hypothetical protein	NA	NA	NA	NA
WP_053389752.1\|35692_36526_+	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	3.3e-47	40.6
WP_069325148.1\|36688_37012_-	hypothetical protein	NA	NA	NA	NA
WP_048227655.1\|37255_37591_+	nikA protein	NA	NA	NA	NA
WP_053389753.1\|37612_40312_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_112777774.1\|40407_41559_+	Fic family protein	D7RWK9	Brochothrix_phage	1.5e-29	28.4
WP_094935554.1\|41684_42461_+	hypothetical protein	NA	NA	NA	NA
WP_048227650.1\|42491_42761_-	hypothetical protein	NA	NA	NA	NA
WP_053389033.1\|42833_45134_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_053389034.1\|45242_46373_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	2.0e-188	85.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP030078

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP030078_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP030078_1

40166-40255

Orphan

Consensus_repeat	Method
CCTTTTGGCTGGAAACGCCCGTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP030078_1

>merge|NZ_CP030078|1|40166-40255|CRISPRCasFinder
CCTTTTGGCTGGAAACGCCCGTCAGACTCTGCTTTTGTATAAGCCTGTCCAGCTGGGGTATAGCTCCCTTTTGGCTGGAAACGTCCGTCA

>NZ_CP030078|1|1|40166-40255|CRISPRCasFinder
CCTTTTGGCTGGAAACGCCCGTCA	GACTCTGCTTTTGTATAAGCCTGTCCAGCTGGGGTATAGCTC
CCTTTTGGCTGGAAACGTCCGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP030078.1\|WP_042863552.1\|36883_37135_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_006812500.1\|37136_37829_-\|membrane-protein	unknown	unknown	gnl\|CDD\|222880
NZ_CP030078.1\|WP_006812498.1\|36175_36700_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP030078.1\|WP_023316023.1\|36726_36933_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_045339239.1\|50846_51182_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|227062
NZ_CP030078.1\|WP_000469441.1\|57362_57746_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_042863549.1\|39386_39818_-\|tail-fiber-assembly-protein	unknown	unknown	gnl\|CDD\|367075
NZ_CP030078.1\|WP_006812497.1\|35902_36172_+\|DUF1778-domain-containing-protein	unknown	unknown	gnl\|CDD\|226860
NZ_CP030078.1\|WP_000952684.1\|55814_56039_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_160859104.1\|34521_34875_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_045339244.1\|48690_49281_-\|tail-assembly-protein	unknown	unknown	gnl\|CDD\|227067
NZ_CP030078.1\|WP_042863551.1\|37842_38166_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_006812510.1\|56541_57288_-\|Ig-domain-containing-protein	unknown	unknown	gnl\|CDD\|227779
NZ_CP030078.1\|WP_016051624.1\|50058_50757_-\|phage-minor-tail-protein-L	unknown	unknown	gnl\|CDD\|130661
NZ_CP030078.1\|WP_023315962.1\|34880_35546_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854
NZ_CP030078.1\|WP_045339242.1\|49268_50066_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|163704
NZ_CP030078.1\|WP_100229795.1\|51223_55807_-\|tape-measure-protein	unknown	unknown	gnl\|CDD\|226450
NZ_CP030078.1\|WP_080395882.1\|33683_34481_+\|DUF2971-domain-containing-protein	unknown	unknown	gnl\|CDD\|378585
NZ_CP030078.1\|WP_000163862.1\|56164_56482_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030078.1\|WP_000523626.1\|57747_58221_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP030078.1\|WP_006812497.1\|35902_36172_+\|DUF1778-domain-containing-protein	gnl\|CDD\|226860	COG4453, COG4453, Uncharacterized protein conserved in bacteria [Function unknown].	2.29605e-23
NZ_CP030078.1\|WP_006812500.1\|37136_37829_-\|membrane-protein	gnl\|CDD\|222880	PHA02564, V, virion protein; Provisional.	5.08203e-43
NZ_CP030078.1\|WP_006812498.1\|36175_36700_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.17883e-07
NZ_CP030078.1\|WP_042863549.1\|39386_39818_-\|tail-fiber-assembly-protein	gnl\|CDD\|367075	pfam02413, Caudo_TAP, Caudovirales tail fibre assembly protein, lambda gpK. This family contains bacterial and phage tail fibre assembly proteins. E.coli contains several members of this family although the function of these proteins is uncertain. Using the lambda phage members as examples, there are both gptfa and gpK tail proteins here. GpK forms part of the TTC or tail-tip complex that is located at the distal end of the tail. TTCs form the platform on which the tail-tube proteins self-assemble and are also the attachment point for fibers or receptor-binding proteins that mediate phage-adsorption to the surface of the host cell. TTC assembly starts with gpJ, which is also known as the central tail fibre and is involved in host-cell adsorption. It is the C-terminus of gpJ that interacts with the lamB receptor on host cells. A number of intermediates including gpK then interact with gpJ during tail morphogenesis.	4.63067e-30
NZ_CP030078.1\|WP_045339239.1\|50846_51182_-\|phage-tail-protein	gnl\|CDD\|227062	COG4718, COG4718, Phage-related protein [Function unknown].	6.14718e-50
NZ_CP030078.1\|WP_045339244.1\|48690_49281_-\|tail-assembly-protein	gnl\|CDD\|227067	COG4723, COG4723, Phage-related protein, tail component [Function unknown].	1.74402e-72
NZ_CP030078.1\|WP_100229795.1\|51223_55807_-\|tape-measure-protein	gnl\|CDD\|226450	COG3941, COG3941, Mu-like prophage protein [General function prediction only].	2.97341e-145
NZ_CP030078.1\|WP_006812510.1\|56541_57288_-\|Ig-domain-containing-protein	gnl\|CDD\|227779	COG5492, COG5492, Bacterial surface proteins containing Ig-like domains [Cell motility and secretion].	3.78897e-33
NZ_CP030078.1\|WP_016051624.1\|50058_50757_-\|phage-minor-tail-protein-L	gnl\|CDD\|130661	TIGR01600, lambda_minor_tail, lambda-like phage minor tail protein L. This model detects members of the family of phage lambda minor tail protein L. This model was built as a fragment model to allow detection of fragmentary sequences, as might be found in cryptic prophage regions. [Mobile and extrachromosomal element functions, Prophage functions].	4.38474e-146
NZ_CP030078.1\|WP_023315962.1\|34880_35546_-\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	6.57606e-41
NZ_CP030078.1\|WP_045339242.1\|49268_50066_-\|C40-family-peptidase	gnl\|CDD\|163704	cd08073, MPN_NLPC_P60, Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding) found in proteins also containing NlpC/P60 domains. This family contains bacterial MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+)-like domains at the N-terminus of NlpC/P60 phage tail protein domains. These domains contain the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity for the release of ubiquitin from ubiquitinated proteins (thus having deubiquitinating (DUB) activity) that are tagged for degradation. The JAMM proteins likely hydrolyze ubiquitin conjugates in a manner similar to thermolysin, in which the zinc-polarized aqua ligand serves as the nucleophile, compared with the classical DUBs that do so with a cysteine residue in the active site.	1.71636e-40
NZ_CP030078.1\|WP_080395882.1\|33683_34481_+\|DUF2971-domain-containing-protein	gnl\|CDD\|378585	pfam11185, DUF2971, Protein of unknown function (DUF2971). This bacterial family of proteins has no known function.	4.49896e-10

>NZ_CP030078.1|WP_042863549.1|39386_39818_-|tail-fiber-assembly-protein
MKKYFSNTEKSFYLEETVKTYQAQDISVPADLMIISDDEYEAFMVSPDRKAPQYNVESECMEWVDIEPPTREEAIENAEALKAQLLSVAAQAIAPLQDAVDLSMATDDEMASLSAWKKYRVLLNRVDTSEPDEIEWPESPLTE
>NZ_CP030078.1|WP_042863551.1|37842_38166_-|hypothetical-protein
MSNEMAGVTPEQVERIAAIVAREVVGKLGKELREEIGQGVNDQLKTYFGDMTPSQHSIQHSNLDKLLNRLDAISSGFFGGIISKITSFLITALLLGLAAYGVKNGLQ
>NZ_CP030078.1|WP_006812500.1|37136_37829_-|membrane-protein
MKTPRGIRNNNPGNLDKGSPWQGLIDNPAEPRFCTFKDPVWGIRALAVTLITYHDKRRAKDGSSIDTIREVIERWAPPHENNTVAYVNEVSKAVGVTPDMIIDLHDYDTLRPLVEAIIRHENGRGPLKTPNTWYAAEVIEEGLRRAGVVKPVKTVKAVPVTKETAGATVTAGIGLAQLADVMPQVSAAMDKAQGHITSGDTVRIIFGIATIVVAGFIAWSQVRKHQNGMV
>NZ_CP030078.1|WP_042863552.1|36883_37135_-|hypothetical-protein
MTGSLFSKLKFALMTLAAVLFVLVGAYTMGDRAARQAIEEKARQEDRKRLQSTVDVKNETLNEVRRKDASAVHRELHDKWLRD
>NZ_CP030078.1|WP_023316023.1|36726_36933_-|hypothetical-protein
MLLLFIASCMISGCVIKTQTSGVLFCDAANPIYVSNDDFMTEETEREILFHNTMGERLCNWQDRQALN
>NZ_CP030078.1|WP_006812498.1|36175_36700_+|GNAT-family-N-acetyltransferase
MANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQRKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSLFYPTKGIEKLFGGK
>NZ_CP030078.1|WP_006812497.1|35902_36172_+|DUF1778-domain-containing-protein
MSALKKQRIDLRLTDDDKSMIEEAAAMTNQTITQFMVASASERAAEVIEQHRRLILSEESWNIVMDAISNPPAPNDRLKRAAERLQSME
>NZ_CP030078.1|WP_023315962.1|34880_35546_-|AAA-family-ATPase
MTRIIVVGGTKGGPGKSTVAQQIAVCLKVKKKKKTHVTDIDIQRTTTSWCEDRRQNEDLELIPFAYVQDDIVKHIKSLKGRYDYVVIDAGGFDSEIQRQAMLLADFIIIPLRPKRRDLKSLRDIDPIIDNVRNVNETVKIRAVVNQCPSLPSQASRILAAKEIVETFGIEAAPVNLYNRNVYDDAEEAGRSIFEMTGAERDKKAEAEFEEFVDYIMSLEEE
>NZ_CP030078.1|WP_160859104.1|34521_34875_-|hypothetical-protein
MRMGDLAKRKDPEEPVKSSTPMRQPVRPQGRPTRGKEKIKSRTMSLEDEYFDLLEMMKFIPRFEKFTRSDVIRAAIFHLAEKSPQEIEDIVKLNEAITAADVTMRTDEIKRELMKKG
>NZ_CP030078.1|WP_080395882.1|33683_34481_+|DUF2971-domain-containing-protein
MMILYKYVPEETLKLFFDHDATSFKFTPVGQFNDPFETYGVSFASEDKDSLAHLTFRSKINSDLASLCLSRSPLEVLMWSHYAQHHRGYVVGIDTELAGFNDENLCLITANEGGIDYLDERDKSRVIISDKNFKNKDIVKKVLFRKSQHWKYEKEVRIVIESDKLIPIGDDEEDRFYIYKAPGTNIIKEIFIGISNDDFELTALENDNLRNAILDNNIKIQKCCFKRGTWDLDKTDYDMSLLTDWPSADFGILAGVISAFEKNEI
>NZ_CP030078.1|WP_045339244.1|48690_49281_-|tail-assembly-protein
MSELVHVQLGGPMARHFGRHWHLKVRNTKQALDLVEANRPGLKAWMKRNMKTYDKYHIQITNKQGHKWSVDESEFQMMGQSDNIAKIRITPVPRGSGGSAFGWFQTVVGAALMVISAFIMPALVPLGLSLMMGGISQLISPQATNDSVRQADNSNSFYFDGPQNTTNQGNPVQLIYGEEILVGSQVVSSSITIDQL
>NZ_CP030078.1|WP_045339242.1|49268_50066_-|C40-family-peptidase
MGNRAFPELGSDVMQEIYLTAIKRYPNEACGFLVRTTGDKYRFMEARNVSENPKNTFVMHADDIIAAEDTGDVVAIWHSHTDESAEASDADRAGCEATEVPWLILAVRKNVEGDAPFHFSEMNVITPDGFEMPYLGRPYVFGVFDCWMLCRDYLKREFNVELNPNPHLHIPSWYTGDTDILDQNYRNEGLVRLAPGTEPQRGDVFFIQYGKMPDHCAVYIGDGMILHHQIDRLSCRAYYGGMYQKHTTHHLRHRDLLKGDETCLS
>NZ_CP030078.1|WP_016051624.1|50058_50757_-|phage-minor-tail-protein-L
MGIKADIQSLSPSALIELFELDMSNTTSGGKLFFHAGTNELMEPVVWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNFAGTVSAEVQANDDLVGCRIIRKMTLARFLDAANFKDGNPTADPNQHFPDEMWFIEQKTLETHEVVEFELSSVFDLMGVQLPYRQIIKNTCPWKYRGPECGYTGPYFDKNNQQTTMSGADYCTKRYDSCNARRNYFANGVIHFGGFIGATRYG
>NZ_CP030078.1|WP_045339239.1|50846_51182_-|phage-tail-protein
MERLTFNWYPDYESEKTVKPNVTVLNFGDDYEQRQAKGLNRIKEEWSLTFTRSYDVINAVDDFLTARAAVESFYWTNPRGKKIVVVCDSHTVKRYQGYQVLTATFRQIYEG
>NZ_CP030078.1|WP_100229795.1|51223_55807_-|tape-measure-protein
MSQNVEFILSLEDKQFTASIDRAGKLLTRFGEQATKPAQKINNLERSLGSVSRIIGVLESKLDATADKLQDVAAGFELVSDVSRKTRGNITSLNSGLKTLIERVDTTTSSVNKLTTSLRKVQSELNEFSDWATFAGKSASRFGTEVKEASSSVSGMNTRLNTTTKRLSNWGVTTSQAAEGLKKVRDQMDAVIGRQQLISKPVRVRTSGYGEGGGNGGGGRRGGTNGHGWRGAENGVFSGLRGNIFLLGEIGDAARTVTDILFGWQKPIIEAASEMERMRVMLRGLNKDKANPGKAAAEDMQYIVDMAQNAPFAMQALTDSFVKFRSAGLDPTDGSLKALVDSVARFGGDSELLKRAAVAVQQMSGKGVVSMEELRQQLGEAVPNAMKAMADAAGITMGELTKAVSTGTVEAKQALSLMFVGLRAENENAAKDMMQTYTGALAQLQTSFTLFADRVGQAGYLDSLSKGMKELASIMNSAEGISFANSLGSGLSTAIDGLRELAQWLAKNQELVISLGKVVAAMVAFKLMRAGIAGVIGTAGQMVNTFTKMSTVLQAPFNLGATAVTRFNRAARMGLAPIPSLIFAIRGAITGLQGAFAGLTAFIAANPIGAAFTVATVAVAGLITYMTMLRSETSKVVDEIRKIPEAMTAAKRAQMAARAAELEKQIQRDQQALKTGESVNYYSTAAGPVAVKESKEVVEARLKKNQEEYERTTGTMALGDGAVAKRLAKEAAESQIEKIRADNQVFSATFVKARQEALDKIQKINDDKSLSDDEKNKLLAPLREKVNKSYLEPAQKLVDDLSSRKNATEKQIAHFSDMLEKAKKEGNTEQVQKLQGSIRGYQEHLEAVAQELTQAEFERDNAAKTGKGVMSNQGTVLGLGTTDKAAQKALAQYMRNQMDSATYQRTLPDGTAMLDFEGKPIIGPKQLKTQLNLQKASSASSLEKMSDEERAAAIAALTKAREQDAAAAEKAGQRTANASQRAARKEENAQRKLAAGYQKALDKADQLMGQMGESSKATVSFDQSLRDTTKSLTELANAVPNEFITQEMIDKAKSRLADLANASDDYREMFNRRNVEQMISTWAPESDSIISAGYKPSREEKVVDFNDTYNRNLKALMDLRDQASDPKIVALYTKQINQLVAAGNTALIKETGTATQKLALEYENLADQLENSWSNLFSNMTDTLTDFVMKGKMDFSSLAESILRDITNMVVKTQITLPLMNMLGMGTTAAGSSQSGNLLSGVASAVANQGVRMNAVNGDKSVGEATKETSSSVSGLGQTTQQTTSAIGSATNAIGSWVNGLFTSTEAKDAETKAVKTSIFSMQNLSSVTGALSAAFAMLGANMSGSGNKWLSFGATIASGLVSAWAGGGFDNIGSGSSGSNSGFNNLTGSASDGTGGIPAIPKFAKGGIFGKDGVVPLRAYQKGGIADSPQLALFGEGDMNEAYVPLPDGRSIPVTLNAEGVKGGGGGVFSPVSIEINVNSDGSVSENSNSEGAWSQAAQRMKAIALETIAQEKRPGGSLNPNSQRN
>NZ_CP030078.1|WP_000952684.1|55814_56039_-|hypothetical-protein
MLSRNIDRLRAEEDVRNLQVARAAQADGEGVKAFMEGLQLRIGRPVVTDKVYDPRKDKADPDAKEQLMQIFGRG
>NZ_CP030078.1|WP_000163862.1|56164_56482_-|hypothetical-protein
MTKLLDLDSILPPKKSIKFGGQEYPIVEMTVGLFVSIKQMEGKDLQNMSPVEQVTAYADLVRKVIPSVPDAVLEKLTVPQLQQIFTFAMEVIDEENEKAAGEGAK
>NZ_CP030078.1|WP_006812510.1|56541_57288_-|Ig-domain-containing-protein
MSNTHVKNIKLGACKVSFGGVDLGYTKGGVQVEVATETLKVTVDQLGQTTISELVQGRNITITAPLAESVLQNMVDLMPGSTLSEEDNAVTITSAQGVNLIDVAKELVLTPQDTTDYVLTIPKAATAGNFTMTYQSDDVRVFSVQFTAYPDDDGVLGKMSGPKPVKTVSISPESPEVKAGETVQLTAQITPADAGDKTGVWESDNQEKATVDQTGLVRGVAEGSANISFTSNSGGKKATKAVTVNSAE
>NZ_CP030078.1|WP_000469441.1|57362_57746_-|hypothetical-protein
MFIEAFASLMQKAKIGTVGTDIFCHYMPANVKSGVLLVTPNTGITIDHELKGFYHDSFTVIVRNATITKAVAKANKIMDMFPVEETVSEGVYFRLVRPMSMPITYPKNEGSLIEAGIPIEFAGYLLN
>NZ_CP030078.1|WP_000523626.1|57747_58221_-|hypothetical-protein
MGLKYDAHQFKRAGDRLNNSQKAFKRYLIRDMEKLARLVERLARAMAPLETGSLESAIFARVVKEGYTGLRIELSVSGAKPREGHPGVEVGDYAEYMELGKYRLGYLSRMKSVTNPPVAGVKPRVGPLFLERAVQISEKQFTQTIAEAARKAGFTRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP030078_1	1.1\|40190\|42\|NZ_CP030078\|CRISPRCasFinder	40190-40231	42	NZ_CP030078	Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence	40190-40231	1.0
NZ_CP030078_1	1.1\|40190\|42\|NZ_CP030078\|CRISPRCasFinder	40190-40231	42	NZ_CP029247	Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence	40170-40211	1.0
NZ_CP030078_1	1.1\|40190\|42\|NZ_CP030078\|CRISPRCasFinder	40190-40231	42	NZ_KX015668	Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence	69193-69234	1.0

1. spacer 1.1|40190|42|NZ_CP030078|CRISPRCasFinder matches to NZ_CP030078 (Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence) position: , mismatch: 0, identity: 1.0

gactctgcttttgtataagcctgtccagctggggtatagctc	CRISPR spacer
gactctgcttttgtataagcctgtccagctggggtatagctc	Protospacer
******************************************

2. spacer 1.1|40190|42|NZ_CP030078|CRISPRCasFinder matches to NZ_CP029247 (Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence) position: , mismatch: 0, identity: 1.0

gactctgcttttgtataagcctgtccagctggggtatagctc	CRISPR spacer
gactctgcttttgtataagcctgtccagctggggtatagctc	Protospacer
******************************************

3. spacer 1.1|40190|42|NZ_CP030078|CRISPRCasFinder matches to NZ_KX015668 (Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence) position: , mismatch: 0, identity: 1.0

gactctgcttttgtataagcctgtccagctggggtatagctc	CRISPR spacer
gactctgcttttgtataagcctgtccagctggggtatagctc	Protospacer
******************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 107614

119

Salmonella_phage(94.55%)

tail,terminase,integrase

attL 1067:1089|attR 108237:108259

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016051671.1\|0_1065_+	replication protein RepA	J9Q7H0	Salmonella_phage	1.5e-190	100.0
1067:1089	attL	NA	NA	NA	NA
WP_004110030.1\|1633_1846_-	hypothetical protein	J9Q7S8	Salmonella_phage	8.1e-35	100.0
WP_004110033.1\|1845_2181_-	hypothetical protein	J9Q7Z5	Salmonella_phage	1.6e-56	99.1
WP_004110036.1\|2177_2357_-	hypothetical protein	J9Q6J1	Salmonella_phage	7.3e-21	98.3
WP_058687805.1\|2397_2673_-	hypothetical protein	J9Q738	Salmonella_phage	5.4e-47	96.7
WP_004110040.1\|2741_3152_-	hypothetical protein	J9Q7G9	Salmonella_phage	1.1e-75	97.8
WP_004110049.1\|3668_4499_-	hypothetical protein	J9Q7Z4	Salmonella_phage	1.1e-127	99.3
WP_000589750.1\|4502_4703_-	hypothetical protein	J9Q6J0	Salmonella_phage	9.3e-25	93.9
WP_000920226.1\|5873_6140_-	hypothetical protein	J9Q7G8	Salmonella_phage	1.6e-40	100.0
WP_058687803.1\|6139_7084_-	exonuclease	J9Q7S6	Salmonella_phage	8.8e-182	99.4
WP_004110098.1\|7144_8173_-	hypothetical protein	J9Q7Z3	Salmonella_phage	1.3e-165	99.7
WP_004110100.1\|8292_8724_-	hypothetical protein	J9Q6I8	Salmonella_phage	1.2e-72	99.3
WP_004110104.1\|9268_9832_+	DNA-binding protein	J9Q7G7	Salmonella_phage	9.9e-64	65.1
WP_002213143.1\|9861_10305_-	hypothetical protein	J9Q7S4	Salmonella_phage	7.8e-72	100.0
WP_100229806.1\|10301_13820_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	99.4
WP_022649894.1\|14000_15236_-	AAA family ATPase	J9Q733	Salmonella_phage	6.0e-239	99.8
WP_100229807.1\|15332_17723_-	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	0.0e+00	92.7
WP_004110118.1\|17832_18045_-	hypothetical protein	NA	NA	NA	NA
WP_058687799.1\|18308_18695_+	hypothetical protein	NA	NA	NA	NA
WP_058687798.1\|18686_19793_-\|integrase	site-specific integrase	A0A1P8DTG6	Proteus_phage	5.6e-26	32.6
WP_100229808.1\|19964_20381_-	type II toxin-antitoxin system YafO family toxin	NA	NA	NA	NA
WP_100229809.1\|20371_20896_-	hypothetical protein	NA	NA	NA	NA
WP_100229810.1\|20992_21238_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	2.9e-12	43.6
WP_032655934.1\|21237_21603_-	phage family protein	K7PH35	Enterobacteria_phage	1.5e-36	65.6
WP_058687797.1\|21618_21822_-	hypothetical protein	A0A0B6VT64	Edwardsiella_phage	4.4e-06	49.2
WP_058687796.1\|21832_22606_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	1.4e-89	65.1
WP_127345900.1\|22849_24046_+	hypothetical protein	NA	NA	NA	NA
WP_100229811.1\|25051_25357_-	C-type natriuretic protein	J9Q7S1	Salmonella_phage	1.2e-47	98.0
WP_004110177.1\|25505_25718_-	hypothetical protein	J9Q6I3	Salmonella_phage	2.6e-33	100.0
WP_023180937.1\|25877_27200_-	DNA ligase	J9Q7G5	Salmonella_phage	2.8e-258	99.3
WP_072105575.1\|27234_27711_-	hypothetical protein	J9Q7R9	Salmonella_phage	6.4e-80	98.1
WP_100229813.1\|27792_28587_-	hypothetical protein	J9Q7Z0	Salmonella_phage	2.1e-112	76.5
WP_058687793.1\|28773_30027_+	sel1 repeat family protein	NA	NA	NA	NA
WP_169803265.1\|30018_31134_-	DNA primase	J9Q720	Salmonella_phage	1.2e-209	94.1
WP_006812582.1\|31292_32633_-	AAA family ATPase	J9Q7G4	Salmonella_phage	1.3e-247	99.8
WP_100229815.1\|32693_33419_-	hypothetical protein	J9Q7R8	Salmonella_phage	5.4e-139	98.3
WP_080395882.1\|33683_34481_+	DUF2971 domain-containing protein	J9Q7Y9	Salmonella_phage	7.3e-12	26.4
WP_160859104.1\|34521_34875_-	hypothetical protein	J9Q7G3	Salmonella_phage	2.2e-45	100.0
WP_023315962.1\|34880_35546_-	AAA family ATPase	J9Q7R7	Salmonella_phage	4.7e-113	95.0
WP_006812497.1\|35902_36172_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_006812498.1\|36175_36700_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023316023.1\|36726_36933_-	hypothetical protein	J9Q7G2	Salmonella_phage	1.1e-23	80.0
WP_042863552.1\|36883_37135_-	hypothetical protein	J9Q7R6	Salmonella_phage	9.3e-30	88.0
WP_006812500.1\|37136_37829_-	membrane protein	J9Q7Y7	Salmonella_phage	3.9e-126	96.1
WP_042863551.1\|37842_38166_-	hypothetical protein	J9Q6E7	Salmonella_phage	8.0e-50	97.2
WP_042863549.1\|39386_39818_-\|tail	tail fiber assembly protein	B6SCW7	Bacteriophage	1.5e-16	53.8
WP_045339244.1\|48690_49281_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	9.0e-100	91.8
WP_045339242.1\|49268_50066_-	C40 family peptidase	J9Q7R4	Salmonella_phage	3.5e-155	95.1
WP_016051624.1\|50058_50757_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	3.7e-137	100.0
WP_045339239.1\|50846_51182_-\|tail	phage tail protein	J9Q6E1	Salmonella_phage	5.2e-60	99.1
WP_100229795.1\|51223_55807_-	tape measure protein	J9Q712	Salmonella_phage	0.0e+00	91.4
WP_000952684.1\|55814_56039_-	hypothetical protein	J9Q7F7	Salmonella_phage	4.2e-34	100.0
WP_000163862.1\|56164_56482_-	hypothetical protein	J9Q7R3	Salmonella_phage	6.0e-50	98.1
WP_006812510.1\|56541_57288_-	Ig domain-containing protein	J9Q7Y4	Salmonella_phage	6.8e-129	98.4
WP_000469441.1\|57362_57746_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.7e-67	100.0
WP_000523626.1\|57747_58221_-	hypothetical protein	J9Q711	Salmonella_phage	2.3e-82	100.0
WP_001027662.1\|58211_58556_-	hypothetical protein	J9Q7F6	Salmonella_phage	1.9e-57	100.0
WP_045339227.1\|58653_59487_-	hypothetical protein	J9Q7R2	Salmonella_phage	1.3e-152	99.6
WP_042863546.1\|59486_59921_-	hypothetical protein	J9Q7Y3	Salmonella_phage	8.1e-74	99.3
WP_042863545.1\|59964_60888_-	Ig domain-containing protein	J9Q6D6	Salmonella_phage	9.6e-157	99.7
WP_045339225.1\|60962_61838_-	hypothetical protein	J9Q710	Salmonella_phage	8.5e-163	99.7
WP_100167782.1\|61864_62758_-	hypothetical protein	J9Q7F4	Salmonella_phage	3.3e-138	91.6
WP_042863542.1\|62780_64355_-	hypothetical protein	J9Q7R1	Salmonella_phage	3.5e-300	98.9
WP_002211787.1\|64388_65645_-\|terminase	terminase	J9Q7Y2	Salmonella_phage	1.8e-251	100.0
WP_006812517.1\|65647_66289_-	hypothetical protein	J9Q6D4	Salmonella_phage	3.4e-108	98.1
WP_000176291.1\|66484_66751_-	hypothetical protein	J9Q757	Salmonella_phage	1.3e-42	100.0
WP_002211789.1\|66760_67651_-	hypothetical protein	J9Q7I6	Salmonella_phage	6.2e-169	99.7
WP_001113021.1\|67656_67911_-	hypothetical protein	J9Q7U0	Salmonella_phage	4.1e-41	98.8
WP_016051719.1\|67903_68542_-	ATP-binding cassette domain-containing protein	J9Q807	Salmonella_phage	3.8e-112	100.0
WP_042863541.1\|68538_69207_-	ParB N-terminal domain-containing protein	J9Q6L1	Salmonella_phage	4.3e-114	99.1
WP_032634983.1\|69206_69905_-	ParB N-terminal domain-containing protein	J9Q756	Salmonella_phage	2.5e-125	99.1
WP_100229796.1\|69969_71529_+	DEAD/DEAH box helicase	J9Q7I4	Salmonella_phage	2.8e-294	99.2
WP_039264874.1\|71531_71810_+	hypothetical protein	J9Q7T9	Salmonella_phage	1.3e-40	98.9
WP_127345898.1\|71872_72400_+	hypothetical protein	NA	NA	NA	NA
WP_127345899.1\|72443_73232_-	hypothetical protein	A0A0M4QWT0	Salmonella_phage	1.6e-06	39.0
WP_048228561.1\|73358_73871_+	transcriptional regulator	J9Q6L0	Salmonella_phage	3.1e-56	68.2
WP_100229798.1\|74188_74839_+	hypothetical protein	J9Q754	Salmonella_phage	3.5e-113	98.6
WP_046622227.1\|74889_75093_+	hypothetical protein	J9Q7I3	Salmonella_phage	8.3e-29	97.0
WP_023316004.1\|75734_76217_-	hypothetical protein	J9Q805	Salmonella_phage	7.1e-87	96.9
WP_058652473.1\|76422_76704_-	hypothetical protein	J9Q753	Salmonella_phage	6.5e-48	97.8
WP_045339203.1\|76830_77226_-	hypothetical protein	J9Q7I1	Salmonella_phage	1.2e-42	66.2
WP_058687815.1\|77354_77666_-	hypothetical protein	J9Q7T7	Salmonella_phage	7.9e-47	96.1
WP_172688704.1\|77806_78022_-	hypothetical protein	J9Q804	Salmonella_phage	5.9e-33	95.8
WP_042863534.1\|78029_78251_-	hypothetical protein	J9Q6K7	Salmonella_phage	1.4e-34	98.6
WP_063162178.1\|80172_80490_-	hypothetical protein	J9Q750	Salmonella_phage	3.9e-49	83.8
WP_042863533.1\|80489_80726_-	DUF1380 domain-containing protein	J9Q7H8	Salmonella_phage	1.6e-39	97.4
WP_042863532.1\|80811_81078_-	hypothetical protein	J9Q7T5	Salmonella_phage	3.1e-31	70.5
WP_006812537.1\|81264_81468_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	6.8e-31	97.0
WP_042863531.1\|81523_82222_-	DUF1311 domain-containing protein	J9Q6K3	Salmonella_phage	2.0e-114	91.8
WP_042863530.1\|82260_82812_-	hypothetical protein	J9Q748	Salmonella_phage	2.3e-97	92.3
WP_042863529.1\|82808_83450_-	HD domain-containing protein	J9Q7H7	Salmonella_phage	1.4e-114	99.1
WP_042863528.1\|83541_83913_-	hypothetical protein	J9Q7T4	Salmonella_phage	7.2e-63	99.2
WP_042863527.1\|83915_84197_-	hypothetical protein	J9Q801	Salmonella_phage	3.6e-46	97.8
WP_042863526.1\|84193_84883_-	hypothetical protein	J9Q6K2	Salmonella_phage	8.8e-123	96.9
WP_042863525.1\|84941_86627_-	DUF4942 domain-containing protein	J9Q747	Salmonella_phage	0.0e+00	98.8
WP_022649922.1\|86768_87341_-	hypothetical protein	J9Q7H6	Salmonella_phage	5.3e-97	97.9
WP_000462606.1\|87449_88292_-	Rha family transcriptional regulator	J9Q7T3	Salmonella_phage	2.1e-70	71.1
WP_000872126.1\|88400_88589_-	hypothetical protein	J9Q800	Salmonella_phage	1.2e-26	100.0
WP_045339190.1\|88598_89093_-	hypothetical protein	J9Q6J9	Salmonella_phage	2.1e-81	98.2
WP_100229801.1\|89234_89843_-	ribonuclease HI	J9Q745	Salmonella_phage	1.4e-116	99.0
WP_000262979.1\|90438_90669_-	hypothetical protein	J9Q7H5	Salmonella_phage	2.1e-36	100.0
WP_004109976.1\|90867_91461_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	2.1e-112	100.0
WP_045339187.1\|91646_92489_-	hypothetical protein	J9Q7Z9	Salmonella_phage	1.7e-107	91.8
WP_000208226.1\|92617_93175_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	7.0e-102	99.5
WP_004109992.1\|93184_93604_-	hypothetical protein	J9Q743	Salmonella_phage	6.4e-68	97.8
WP_000386471.1\|93667_94312_-	AAA family ATPase	J9Q7H4	Salmonella_phage	5.2e-117	100.0
WP_000781812.1\|94311_94788_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	1.4e-90	100.0
WP_169803266.1\|94784_95180_-	hypothetical protein	J9Q7Z8	Salmonella_phage	1.5e-66	96.2
WP_022649915.1\|95199_96303_-	thymidylate synthase	J9Q6J6	Salmonella_phage	1.1e-218	99.2
WP_100229802.1\|96492_97362_-	phosphoribosyl-ATP pyrophosphohydrolase	J9Q742	Salmonella_phage	8.7e-160	97.9
WP_002231164.1\|97444_98587_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	1.7e-219	100.0
WP_042863520.1\|98694_101010_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	99.7
WP_002214145.1\|101087_101657_-	hypothetical protein	J9Q7Z7	Salmonella_phage	5.8e-104	100.0
WP_045339176.1\|101668_102415_-	hypothetical protein	J9Q6J5	Salmonella_phage	1.3e-135	98.0
WP_058687808.1\|102404_104321_-	AAA family ATPase	J9Q741	Salmonella_phage	0.0e+00	94.4
WP_100229804.1\|104550_105636_-	exonuclease SbcCD subunit D	J9Q7S9	Salmonella_phage	4.2e-204	97.8
WP_058687806.1\|105864_106368_+	hypothetical protein	J9Q7Z6	Salmonella_phage	2.1e-89	97.6
WP_004110023.1\|106399_106894_-	GNAT family N-acetyltransferase	J9Q6J3	Salmonella_phage	7.8e-89	98.2
WP_022649908.1\|106969_107614_-	hypothetical protein	J9Q739	Salmonella_phage	2.2e-123	99.1
108237:108259	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage