CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP022293	Lactiplantibacillus plantarum strain DSR_M2 plasmid pDSRM202, complete sequence	0 crisprs	csa3	0	0	0
NZ_CP022292	Lactiplantibacillus plantarum strain DSR_M2 plasmid pDSRM201, complete sequence	0 crisprs	NA	0	0	1
NZ_CP022294	Lactiplantibacillus plantarum strain DSR_M2 chromosome, complete genome	3 crisprs	csa3,DinG,cas3,DEDDh	1	1	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17023 : 27105

Enterococcus_phage(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029508458.1\|17023_19171_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	9.4e-256	60.3
WP_010623241.1\|19277_20204_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	5.9e-37	32.1
WP_046811155.1\|20218_21169_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.2e-98	54.3
WP_112260612.1\|21296_22109_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	6.3e-11	29.5
WP_013356283.1\|22940_23843_+	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
WP_112260613.1\|23950_24725_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_112260613.1\|26329_27105_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022294

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022294_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022294_1

1046137-1046293

Orphan

Consensus_repeat	Method
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP022294_1

>merge|NZ_CP022294|1|1046137-1046293|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAATACTAGTCAGACAACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTGCGAAAAA

>NZ_CP022294|1|1|1046137-1046293|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	TACTAGTCAGAC
AACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACC	CGTACAAGCAATC
AAGAATCCAGTAGTGCGAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022294.1\|WP_003645955.1\|1056473_1057277_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NZ_CP022294.1\|WP_003643204.1\|1049704_1050145_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP022294.1\|WP_027822090.1\|1050274_1051696_-\|flippase	unknown	unknown	gnl\|CDD\|240533
NZ_CP022294.1\|WP_033617362.1\|1040218_1041439_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_024002500.1\|1041435_1042545_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377101
NZ_CP022294.1\|WP_024002857.1\|1053678_1053984_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_024002858.1\|1054669_1054864_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_060417605.1\|1038469_1039603_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_003643208.1\|1054085_1054313_-\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP022294.1\|WP_027822092.1\|1044644_1045391_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP022294.1\|WP_003643211.1\|1054899_1055448_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP022294.1\|WP_003644190.1\|1054342_1054555_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_021356757.1\|1043743_1044520_+\|DUF4422-domain-containing-protein	unknown	unknown	gnl\|CDD\|379595
NZ_CP022294.1\|WP_003644178.1\|1037320_1038454_+\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|223636
NZ_CP022294.1\|WP_024002496.1\|1035875_1036808_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028
NZ_CP022294.1\|WP_112260669.1\|1055682_1056441_+\|competence-protein-ComK	unknown	unknown	gnl\|CDD\|368849
NZ_CP022294.1\|WP_003643206.1\|1052133_1052802_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP022294.1\|WP_060417604.1\|1042528_1043608_+\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|226122
NZ_CP022294.1\|WP_024002495.1\|1034928_1035837_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028
NZ_CP022294.1\|WP_033608528.1\|1039599_1040232_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022294.1\|WP_003643204.1\|1049704_1050145_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.5268e-13
NZ_CP022294.1\|WP_027822090.1\|1050274_1051696_-\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.42954e-41
NZ_CP022294.1\|WP_021356757.1\|1043743_1044520_+\|DUF4422-domain-containing-protein	gnl\|CDD\|379595	pfam14393, DUF4422, Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.	1.45088e-120
NZ_CP022294.1\|WP_003643208.1\|1054085_1054313_-\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	7.46609e-13
NZ_CP022294.1\|WP_027822092.1\|1044644_1045391_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.68549e-18
NZ_CP022294.1\|WP_003643211.1\|1054899_1055448_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	1.75371e-08
NZ_CP022294.1\|WP_024002500.1\|1041435_1042545_+\|hypothetical-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.00312482
NZ_CP022294.1\|WP_003644178.1\|1037320_1038454_+\|UDP-galactopyranose-mutase	gnl\|CDD\|223636	COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].	4.88338e-180
NZ_CP022294.1\|WP_024002496.1\|1035875_1036808_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	6.46458e-83
NZ_CP022294.1\|WP_112260669.1\|1055682_1056441_+\|competence-protein-ComK	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	3.97955e-05
NZ_CP022294.1\|WP_003645955.1\|1056473_1057277_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	5.53268e-120
NZ_CP022294.1\|WP_060417604.1\|1042528_1043608_+\|acyltransferase-family-protein	gnl\|CDD\|226122	COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism].	1.57606e-13
NZ_CP022294.1\|WP_024002495.1\|1034928_1035837_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.73092e-74
NZ_CP022294.1\|WP_003643206.1\|1052133_1052802_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	1.56324e-95

>NZ_CP022294.1|WP_027822092.1|1044644_1045391_-|helix-turn-helix-transcriptional-regulator
MNIARFTPLRISSSEQEFILNFSLLEHDLIHFFKIRDFDHAISRINKFKEVHPINWIDAEILNQLLLGLIGSLTAASYTHNLNLNDFLKLRLYFFNFIKKSPCTSSTFWPLSNDIITTYFNLLDNFDFHVSYQNLSKQVALTAYYISAHPQELTNSHGVLHTLNLNNDYTQKLFKKELGFSINAYIQHIKLSEAKRLLLQRQLSVGKIASLLHFYDTPTFSKTFKKAVGLSPLKYRELNYLSLTSQSY
>NZ_CP022294.1|WP_021356757.1|1043743_1044520_+|DUF4422-domain-containing-protein
MKVQIYVAAHKPYQMPQDPTYRPIFVGAAIHGGAPQNYQPDDVGDNISASNPNFNELTAMYWIWKNCHADVKGLNQYRRYLSEAPKRKLAGILSMTEIESLLQQYDVIVPKKRHYYIESNYSHYVHAHHREPLDMMRTVISERHAAYLDDFDQLMHQTSAHMFNMMIMAGPKFDDYAKWVFDILFAVRDRIDIADYDVQEARVFGYLSEFLLDVWINHNQLKYVEVPVMYMEKQQLPAKAYNLLKRKFFPQAAKRTHF
>NZ_CP022294.1|WP_060417604.1|1042528_1043608_+|acyltransferase-family-protein
MRNRIEWIDIAKGIAILAVVIGHTLGPYNGQFFGSLIFAFHMPIFFMLSGYLYHSRPARQECQRGIINLLLPYLATAVVLLVVSAIARLLPNPLLNAYFPSWRQGLIATAYGAGSAVFNPWHWQVQPIGAVWFLLSMFIALQLFNGVMLLTVRRHQRWRQAIVRGGVFAMFAILGGWLGHVAYLPWAVNAALLAQLFLYAGYLVEQTALLSRISSAWYLLFTFMWLVSAFQGYFALTVPTSPNLLISVMGGVAGSLCIIRVSDWLSHYPNARPIKWLKRYGQLSLVVLCFHLIDLNVIGIEGWLTNHLIAHMGPLVATIIAISYRIGFVTVAMLAIPHLPGIRACFLPRQYLFRRLQRR
>NZ_CP022294.1|WP_024002500.1|1041435_1042545_+|hypothetical-protein
MNHQQAYRVQRLILIIALMLILFGDTGMNAVFSFSHQPQSIWFYPQLVIALITAAGPNLLLMALGAYQLRRTALTVPQLIRRVLWIMGGITLFSLAFYLEDLVTQGSLTSFNIAGFFTALAQAPVGFYDILYELLGFFVTLPLLRVIAHHASVAIQQYLFWAELVFIGMLPILAYFTGLTTISVNPPLAITAGCFFALMGYWLSQTEVLHRITREHLLVAWLLTCGCYAVIVSVTMYQVNLEKNFDLISSQPFAQTFQAIPCLTLWVTIATWMMNRPRSKAVRRHNFVQTGYGDMLVAGLLITPFMDINRLLTPIIGAWWSGWLWSIAVLIVSVELVWLLRHVRWLQRLLPDLFGGSQLIGGSVNAQQN
>NZ_CP022294.1|WP_033617362.1|1040218_1041439_+|hypothetical-protein
MMRRRGASIQQHRNALYLIIFGIYLASVTLQTTTFNEMIPHRVGVLIELATLAALLGLVVCLDTLTPGQIIGEVSLLVLVTVVTLTSGAHYLMPTIMLVIAAREVSFRQIIQVYLGVVGTILLLALVASEVGLIKNITFATADGLRQSFGVVYTTDFAAHIFYLCAAYLYLLARRFRLVALLPVLFSLAMIYQFTKTMTDVIALIVLISLYLVYIYRRQLRWLRPMIRYSFLMLPLASGLIIGLSNIFNYQDRLLVALNNTLSTRLALGNNALLAYGVKLFGQAPIPINGWGGDRVETFTNGVGDATYFFIDSSFLNMLISYGLLLTLIIIIGMTWFLYQRTRQHDYLLPVIFVAIAISSMFDQHFLEVTYNVFILMLFADLPNYQTAVGPAFDQPVVIRRGASCR
>NZ_CP022294.1|WP_033608528.1|1039599_1040232_+|hypothetical-protein
MRHMKVQPKERFSLAWRWLPLELLIIMLSVGLGWAGNRWLPKPVYQASVDIQIAQTPRSELSTARLKRQRRQDIKAITQFNVMPHQSAVLTQASTYAYAHYGIWQPIQELSESVQAAPVARRPVLRVTATSSSRQVAQQNAQAFNVAIKANLTGLKNYRVKTVKRTVTRETNVIRGALWKLILVVGGGLALLSPYLVKYGQSWGRHDDET
>NZ_CP022294.1|WP_060417605.1|1038469_1039603_+|hypothetical-protein
MKMRKRLAIVWGSLALLALLLGYACYALSIQRGQDTVTRIYQTDQNGTPIISPGPITLVGKVNHRNLFQSGINGYVLTNRDPLSTLLPRRNQTVHLKYRSAQTTAELRKTLRQARYLQAGTQNTATPVFQNRQQRGDATTYGRISTSQDGRIWTKLPISYPHVQLSRPSVWYANGRLTLIDGQDRYWTTNFKDWQHQRLNFNGADFKQGRVQAVFPGTTRSAVVMVRGIDRQSSRAKLYYGQLTKTGRVKAWHALQLGKLPARQIAGMSLIDQHLYLFRQRGTQLAVYRANRLTRPVRLVGRVKLNHAQSQRVTAVNLIPTTKHRYRLIFDLTTAEKVQKQPRYRLLDRRFKAVGQQHLLVTDYLWSQFQISLRGSE
>NZ_CP022294.1|WP_003644178.1|1037320_1038454_+|UDP-galactopyranose-mutase
MNEQYDYLVVGAGLFGAVFAHEAALRGKRVKVIEKRDHIAGNIYTKEVAGIQVHQYGAHIFHTSDREIWDYVNQFAEFNRYTNSPVANYKGHMYNLPFNMNTFSELWGVRTPAEAAAKIAEQRAAANLGDHQPRNLEEQAIALIGTDIYEKLIKGYTEKQWGQKATDLPAFIIRRLPVRYTYDNNYFNDTYQGIPIGGYTQIVEKMLAHPEITVETNTDFFAHKAEYLAQYPKVVFTGMIDQFFDYQLGELAYRSLRFETETVPVDNYQGNAVVNYTDAETPYTRVIEHKHFEFGKGDADQTVITREFPANWQRGDEPYYPVNNQTNNTLYKQYAKLAAAEPQVIFGGRLGQYRYYDMHQVIHAALVTVASEFATTK
>NZ_CP022294.1|WP_024002496.1|1035875_1036808_+|glycosyltransferase-family-2-protein
MQYGAIVVTFNRKQLLIESITALLNQTVPPAKIIIIDNHSTDGTKAELQTADILANPSVDYRYLTKNIGGAGGFARGMQIAAADPNLDWVSMSDDDAIFEPDYFEKLIAYQQDHPNRQILTGSVYIEDGRLQADQRNRFTNWSTFQAQAVPEREYRGNFEFDQYTFCGVFMSVAVIKQVGVADAGYFIWWDDCEYAVRTAKLSRPVNVSAAKLIHKTALPSLDFKSKFVPDWRLYYGQRNRLITIKRWRANSLVSLGWLLGFYARLAIKLCGPFYRGYRKMVIRVYLEALRDASREREGLNPNFMPGQKF
>NZ_CP022294.1|WP_024002495.1|1034928_1035837_+|glycosyltransferase-family-2-protein
MTKIACVIVTFNRKALLAEAIESVLTQPEAPEYVFVIDNASTDGTEAFIQQQFDFDDQHLVYVRCQQNLGGSAGFATGIRLALQTDCDWISISDDDAIFQTDYFAAMRRAIVTQPQQGVFSGSVLLPNGHHDAMHREMITNSQTLTVKPIAEADYAQDFKYDIFSFVGILMSRGIVERIGLPEQDYFIRFDDFEYALRARKYGQFLNVHDALVLHKTTYTRTAIAPWKEYYVMRNRLASLFKHRGQTRVTRWYARRFLARKLFAILLFRDRWGQAGPLIKAYVHGYRDGWHDRLGRNQDYLP
>NZ_CP022294.1|WP_003643204.1|1049704_1050145_+|MarR-family-transcriptional-regulator
MLNHQQIKAQFESLETLQSIQKQVHQMSIQGLVTTGISMREWEVLVYLEQHEQASASELAKVFKVTRTLISRNTWHLIQDNLIQPQIDQSDRRIVWLSLTTTGQETIGKVARQIQANLQAFDCNHELATLMKQLRYLKQQLIILNN
>NZ_CP022294.1|WP_027822090.1|1050274_1051696_-|flippase
MRIIRNYFYTAGYNLLILLTPLLTVPYISRVLGPTGVGINATTNSIITYFLLFGTVGITIYGNREIAFIRDNRGQRSQTFWEIEILQLLTISCAYLAFLVFLFFEHQLQIYFFYQSFYIIAGAVDISWYFMGLEDFKKTVLRNMLVKIASVIAIFIFVKTRQDTGIYILILAGSQVLGNLTLWPYLRHSVERPNWRQLNLFRHLRPSLALFVPQIATTVYLALNKTMLWQMDSLTAAGFYDYSDKLIKLVLALVTATGTVMLPHIANLFMKQQLERVKQYLYMSFDFVLAIAIPMALGVAAVATTLAPLFFGRAFWAVDRLLMIEAPVIILIGMSNVLGQQFLLPTKQTKTYTISVTIGALVNIACNIPLIWFWGVAGAMCATLISEVCVTGYQLFITRHVLHAQSLFTGIWKYTLAGGLMFTFVFRLNVTMTASYLNLCLQIGVGVLLYLGLILLLQPPVLRNAIKLRNNLH
>NZ_CP022294.1|WP_003643206.1|1052133_1052802_-|sugar-transferase
MELKEREIRPITIDAGRQHRRYGYRFIKRVFDFVASLLGLIILSPLFLLIAIAIKVEDPKGAVFYSQTRLGRGEVPFKMYKFRSMVSNADELLEKLLKDNEIDGAMFKMQDDPRVTKIGRFIRKYSIDELPQLLNVLQGSMSLVGPRPPLPREVEEYSDYDKQRLAVKPGCTGLWQATVRNSVGFDEMVKLDLTYISKRSVAFDVYILFKTVVIMFKPNGAY
>NZ_CP022294.1|WP_024002857.1|1053678_1053984_+|hypothetical-protein
MNDDWITVFPADYNNSYHLILKRGTAHYAYYYFKVDKLDQRVIFYDDIERSGISIKTQITRTFMRALVKAIDWHPVGNSIIIEIYPVDRQETKAIRLSCDI
>NZ_CP022294.1|WP_003643208.1|1054085_1054313_-|DUF2922-domain-containing-protein
MKTLDLSFKTSTNKVHHLKLHYANDNLSKDVVSKAMADLAATKLFVKDGENLVAEPLAAKYVETIETPIVTAPKA
>NZ_CP022294.1|WP_003644190.1|1054342_1054555_-|hypothetical-protein
MTKTWLKATLTVQTTTELDEQRKQTFNAIAQDATDEQLAAFGKIVEVLTGDQFTAANLANAYRYDPQPIA
>NZ_CP022294.1|WP_024002858.1|1054669_1054864_-|hypothetical-protein
MHIWMHTHVLLTVTDSNQRQFHQHWLAGRELTDSDFTSLITILTPLFAEKIISITVRTITEFAD
>NZ_CP022294.1|WP_003643211.1|1054899_1055448_-|sigma-70-family-RNA-polymerase-sigma-factor
MHADRFDNQMAFDLLARPEHQRLLYGALKAAQVTKYHPQFEDCVTVAHLTWLSAYQNYAPELPANLPDFRKFAFRRIKWRTVDYLRKQTLRTQSQVNLEHALPITIDPMTEQETHWQLTALLTELLVQCRPGERIYLTEFFFEEQTVSSIMRRHQVSRRTVYNWRASLLVKAHKLYQQQTTN
>NZ_CP022294.1|WP_112260669.1|1055682_1056441_+|competence-protein-ComK
MLEINTDFEGDLPSMNQNIDVPHHVNTFWQCHAGTWDTRQPQRLLIIAQRSELATIDVLETLFLLDIKHLTCVENTLIFDRQRGLIKTKLTTRQIMMNYAGRLGLSGTQLIKRLAGELGLSKHKLPVIHGDAILMPLSMAKRGTTSWYNRHYLKHIEAQGFMTALVYDGQITIQVDMSERVATRQLAKAGQLQAALQEHHRRRLVPDQSVPSMADTDHEMMQSYTDQVLKHFGILALPGEISCLTRRFFGKL
>NZ_CP022294.1|WP_003645955.1|1056473_1057277_+|recombination-regulator-RecX
MTKKVTKIVAQKRAGRYNIYLDEQYAFPISESVMIKFRVFKGMEVDEQLQAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEIDESVIDATMQQLRELRLLNDQQYADAFVRTAKRTSDKGPRVIRQNLRQKGVGEQLIDDALAGQFSAEEQIDNASELARKLAKRYHRQAFKTMQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGAKLWQRNRKYAFRERMMRTKRSLFQKGFMMDDINRFIDEQVADE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022294_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022294_2

2551322-2551547

Orphan

Consensus_repeat	Method
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	PILER-CR

2 spacers

csa3

The CRISPR arrays of NZ_CP022294_2

>merge|NZ_CP022294|2|2551322-2551547|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAATGTTCCAAGCCCATTAGTAACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAACGTTCCTAGCCCATTAGTGACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

>NZ_CP022294|2|2|2551322-2551547|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAATGTTCCAAGCCCATTAGTA
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAACGTTCCTAGCCCATTAGTG
ACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022294.1\|WP_027821794.1\|2535915_2536476_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_033608924.1\|2557521_2558727_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP022294.1\|WP_052661592.1\|2561636_2563562_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP022294.1\|WP_060684131.1\|2538044_2539217_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|224090
NZ_CP022294.1\|WP_021356578.1\|2534848_2535532_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	unknown	unknown	gnl\|CDD\|162788
NZ_CP022294.1\|WP_003642181.1\|2552963_2553293_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP022294.1\|WP_003644778.1\|2558819_2560442_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP022294.1\|WP_003644847.1\|2541841_2543629_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP022294.1\|WP_003642184.1\|2555619_2556147_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP022294.1\|WP_033617504.1\|2547533_2548091_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022294.1\|WP_060684132.1\|2539206_2540073_-\|DUF3737-family-protein	unknown	unknown	gnl\|CDD\|378875
NZ_CP022294.1\|WP_060684134.1\|2543628_2545380_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP022294.1\|WP_003644859.1\|2560755_2561550_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319820
NZ_CP022294.1\|WP_060684133.1\|2540175_2541204_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP022294.1\|WP_027821793.1\|2537302_2537896_-\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224996
NZ_CP022294.1\|WP_011101965.1\|2554811_2555357_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP022294.1\|WP_033617510.1\|2552310_2552865_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022294.1\|WP_024002907.1\|2553790_2554735_-\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|214889
NZ_CP022294.1\|WP_060684135.1\|2545649_2547044_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP022294.1\|WP_015825877.1\|2556223_2557054_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270702

Protein	Function_ID	Function_description	E-value
NZ_CP022294.1\|WP_033608924.1\|2557521_2558727_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.00928e-09
NZ_CP022294.1\|WP_052661592.1\|2561636_2563562_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	2.34233e-122
NZ_CP022294.1\|WP_060684131.1\|2538044_2539217_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	9.2573e-145
NZ_CP022294.1\|WP_021356578.1\|2534848_2535532_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	gnl\|CDD\|162788	TIGR02254, hydrolase_haloacid_dehalogenase-like_family, noncanonical pyrimidine nucleotidase, YjjG family. This HAD superfamily includes including YjjG from E. coli and YfnB from B. subtilis. YjjG has been shown to act as a house-cleaning enzyme, cleaving nucleotides with non-canonical nucleotide bases. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).	6.30531e-49
NZ_CP022294.1\|WP_003644778.1\|2558819_2560442_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP022294.1\|WP_003644847.1\|2541841_2543629_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.03372e-169
NZ_CP022294.1\|WP_003642184.1\|2555619_2556147_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.41001e-30
NZ_CP022294.1\|WP_003642181.1\|2552963_2553293_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.32613e-13
NZ_CP022294.1\|WP_060684132.1\|2539206_2540073_-\|DUF3737-family-protein	gnl\|CDD\|378875	pfam12541, DUF3737, Protein of unknown function (DUF3737). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 281 and 297 amino acids in length.	5.59866e-179
NZ_CP022294.1\|WP_060684134.1\|2543628_2545380_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP022294.1\|WP_003644859.1\|2560755_2561550_-\|HAD-family-hydrolase	gnl\|CDD\|319820	cd07518, HAD_YbiV-Like, Escherichia coli YbiV sugar phosphatase/phosphotransferase and related proteins; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli YbiV can act as both a sugar phosphatase and as a phosphotransferase. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.36012e-48
NZ_CP022294.1\|WP_060684133.1\|2540175_2541204_-\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	2.65663e-135
NZ_CP022294.1\|WP_027821793.1\|2537302_2537896_-\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|224996	COG2085, COG2085, Predicted dinucleotide-binding enzymes [General function prediction only].	1.72029e-34
NZ_CP022294.1\|WP_011101965.1\|2554811_2555357_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.46296e-18
NZ_CP022294.1\|WP_033617510.1\|2552310_2552865_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.68761e-08
NZ_CP022294.1\|WP_024002907.1\|2553790_2554735_-\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|214889	smart00892, Endonuclease_NS, DNA/RNA non-specific endonuclease. A family of bacterial and eukaryotic endonucleases share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. An histidine has been shown to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.	6.05604e-24
NZ_CP022294.1\|WP_060684135.1\|2545649_2547044_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.66222e-56
NZ_CP022294.1\|WP_015825877.1\|2556223_2557054_-\|phosphotransferase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	3.51122e-07

>NZ_CP022294.1|WP_033617504.1|2547533_2548091_+|hypothetical-protein
MNYTSQANIHKFTVSLVIILLSSILISTTITLKISANTTSSSQQAIDCIAQELADVSNSIRYDPQTGLATNLDVNALVSKYGSNNQNQLQHINEIMKYEYKRNLQFNQGKLNSIQTRSFWSCMKNQLLDMIGYQTFQALLRGGIQGLIQRKAWKAAAKLLIRYLGDGIGVGFIAAQLSWYAIRCA
>NZ_CP022294.1|WP_060684135.1|2545649_2547044_+|MFS-transporter
MSQPSTVTLKTKLAILSVGLLSFVGILVETSMNVTFPTLIKTMGVSLDTVQWLTTGYLLLTTIVMSTTAYVLKRFNPKPLFLFAALVCLLGGILCWLAPNFPILLTGRLLQAVATGISIPLMFQLIFTYVPRNQLGTYTGLASVIVSLAPALGPTYGGILTSVWSWRAIFVGIVPLLALLAILGAFNISGKALGVGDKKFDYLGAILLAITFTSLLFTFNNAGTHGWLSPNFGLWCLWSIVMIGAMVTYAIKGRRQLIDYSILKLPILRLRLFNYFGLQFINIGLSFVLPLFAQTVLGASAMTAGLMMLPGAIVGAITGPIAGRIYDKQGPTTLLTFSAIMASAALLLFWLTTDYFTVIIMAVIYALLRVGFNTGFGTAISDGSTRVPLPQKSDQNSMFSMMQQYAGSIGTSIMSAVIAGYEIHHPTVTGTIMGSKLDFLLLFVLAIAILISVLHVKRLEIGQN
>NZ_CP022294.1|WP_060684134.1|2543628_2545380_-|ATP-binding-cassette-domain-containing-protein
MSIFLKLGWYFRREWKLYLAGVLGLVLTAIIGIVPPRIIGDVVDGINQHSLTAHTLTVYLVIIGVAAVGQYLARYLWRNAIWGGAAGLERTLRERLFWHFMKMDATFYQQYRTGDLMAHATNDLTAVERVAGGGILQFADSIITGGTTLIAMMTLIDWRLTLIAVVPFPLLAVVSRYLGKKIHVAFRASQAAFSRLNNKAQESISGIKVIKALGQEKADVADFNQQIDQTIKINRHVNVLDSLFDPAITMIIALSYGATIILGGLYVTHGVITIGNLVSFVTYLGMMVWPMFAVGMLFNTMERGNASYDRVMELLNQQSAIIDAKRGIEQRPHGDIQYQIKQFNYPNDAGTSLSNVDFTLKAGQTLGIVGRVGAGKSTIMKLILREFDQYDGHITYGGHDIKQYALDSYLPALGYVPQDSFLFSNTIRENIRFADPTVSQAVVEAVAAKSDLSGQIASMPAGYDTQVGEEGISLSGGQRQRLAIARALLINPELLILDDALSAVDAETEAEILANLKAERADKTTIIAAHRLSSVMNADEIIVLDAGHVVERGTHAQLMTQHGWYQKMFTRQQLETKVEGAVQ
>NZ_CP022294.1|WP_003644847.1|2541841_2543629_-|ABC-transporter-ATP-binding-protein
MAARQSVWARSMPVKEQLTVIRRLLPYAKPFKWFFIAAIVFSGLISVVNIYLPRVLQTFIDHYLKTGHATVPVMWYFAGLYFFGMVVRALMQFVQNFSSTMGAEYMLENVRRQMFAKLHRMGMRYFDQVPGGSILSRLTNDTMSFSNFWALFNTLFTAFFAVISSFVAMYLTDAQIALWLLVFMPFLAVTIWYYQRYSSRVYRRMRERLSELNTKLSEAITGISVIQQFRQEHRINGEFDHTNDAYFKTRQAMIRTNSLLLSPLIDLFYALGTVMVLGIFGVRGLNGYVAAGVVYAFITYLNNFYNPMTSMMDNLSDFQDGVVAGSRVLRVMDDPTIAPAQHADPTAKITRGKIEFRHVTFAYDGQHPVLKDVSFVAEPGQTVALVGQTGSGKTSTINVLMRFYEFQSGEVLIDDRDIREYPAEELRQKMGLVLQEPFMFYGDINSNIRMFNDQISDEQVQAAARFVKADDFINDLPENYQSRVIERGASYSSGQRQLISFARTIVTDPKILILDEATANVDTETEEMIQTGLDRIQENRTTIAIAHRLSTIQNADLILVLNQGQIVERGSNDELLQQHGYYYDMIQLQNSAHVD
>NZ_CP022294.1|WP_060684133.1|2540175_2541204_-|aldo/keto-reductase
MQYRQLGTSDLKVSSIALGCMGFGAGTGTALNQRSWAVGQTQANQVLDRAISLGINFFDTAPVYQAGASERVLGQGLKKFQRDQLVLATKFTNRTTQEIENHVSGREHVLRSLDQSLQNLQTDYVDLYIYHIWDWLTPMAEIMAGLNEAVQAGKVRYIGISNAYSWQIAQINALAVRYGYPQFVSIQSHYNLVYREDERELFSYAHENDLATTPYSPLASGRLAHPFGTQTTRRQQDTFADTKYQATSEMDKPIIDRVEELAHQHHVSMAAINLAWLQQRVTAPIIGATKPHHLDAVAEAAGLALTASEIQYLETPYRPHDLEGVMALNRSRTNNWNQYSGQ
>NZ_CP022294.1|WP_060684132.1|2539206_2540073_-|DUF3737-family-protein
MKTITQQYLTGERALFKAHDLEIDNTTFADGESPLKESRNVTLKQPIFKWKYPLWYSQHVTVDQGLFETMSRSGIWYTKDITITNSTLQAPKLFRRASQVKLAHVHFSDAEETLWNCQDITLNDVQAAGDYFGMNSQNIRIDGFNLFGNYAFDGAKNVEIHHATLMTKDALWNCENVTVYDSQIIGEYLGWNSKNIRFVNCTIESDQGLCYMDNVKLENCTLLNTDLAFEYCRNIDADVVSTIDSVKNPLSGRIHAQAIGEIIMDDPEVDPHQTLISVDHESRAPHAV
>NZ_CP022294.1|WP_060684131.1|2538044_2539217_-|pyridoxal-phosphate-dependent-aminotransferase
MPFDFETVLNRRHTNAVKWDVADNELPMWVADMDFETAPVIKQALIKRAQFGVFGYEEVPTAYYEAVADWWATEHNFRPQIEWLMFCTGVVPAISSIVRKMTAAGDNVLVQAPVYNIFYHSIENNGRHTLSSDLVAHDAAYAIDWDDLTTKLADPLTTMMILCNPQNPIGIVWSRATLQRLGELCLKYHVLVVADEIHCDLTLNGHTYTPFSSLTAPVAHNSISCISPSKTFNVAALHAATLIIPDAHVRALVSRGINNDELAEPNSFAIPASIAAYTEGHDWVAALRTKLAANQRQVQTYLTAELPQVKLVEAQATYLLWLDVRQVTTDSAALAAFIRQRTGLFLSAGDVYRGDGNRFLRLNVACPTTTLTNGLARLKAGITAYQQIQA
>NZ_CP022294.1|WP_027821793.1|2537302_2537896_-|NAD(P)-binding-domain-containing-protein
MEIGIIGAGTVGTVLAKTFARGDHQIKLSRHSGAASLATRRAEFAANVAFVEVAEALQQPLVILAVPFEQAPAVLAQVADYKQRIVVDVTNQFTADFKKIKTAPLTGSEVIARAANNARVIKAFNTIPPEFMDGHVDGPGKRVLFYAGDDVAAKKEFAALVRPLNFRPVNLGKLRHGGSVMQVGGGLGNTHFVQIEE
>NZ_CP022294.1|WP_027821794.1|2535915_2536476_-|hypothetical-protein
MSSYSNELLMLIFQSTLFKQVIILFAYGCLYYLVTHFIDKKIQHKKNFLLKLGLVKLKKRNKTRWEKIRLIMQLFLLASIPVLVFSELVLNTDYQYMLLVSSIMKCVGFISFVIAFVDSLGPIKEMQQLIAGAQSSDTLDSDKKALAVTSFKKIRWMLILYQVLKVPLLVIFLSLSVDYRRDGFFS
>NZ_CP022294.1|WP_021356578.1|2534848_2535532_+|noncanonical-pyrimidine-nucleotidase,-YjjG-family
MQYAIFDLDNTILDFDRAEAANLAAVFQHHGVTDIRRAENEYQAYNETVWQQIEQGADRDSLLDQRFQVFLGTLGITVDGPAVQQEYDQLLAHSYQVIPGAHELLRTLTNAGLTLLVGTNGIKHTQLSRLAGAHMTPYFDHIFISESIGYAKPNPHFFNAIHDQYPDMNATNTVMIGDSLRSDIAGAATVQLPSIWYNPQHAHNDTTIAPTYTVDNFKQLQKLLLTA
>NZ_CP022294.1|WP_033617510.1|2552310_2552865_-|TetR/AcrR-family-transcriptional-regulator
MVISIRTELDLQRAMYQLLEQRSISQITVEQICKQAFIHRSSFYRYYTDKFDLLRQMVMHTLDELLAAERTNTVGSAIMSTFIGAHTQVLRHLLVTNNEGDNTRSQQVINDCFVTVAETGADDRVFAMIRQSQHPDLTAYLVSGVVTSIVQWLNNGHRDGQAASTQAMIQGTLATVFSLEQHTV
>NZ_CP022294.1|WP_003642181.1|2552963_2553293_-|winged-helix-turn-helix-transcriptional-regulator
MVSSEEALQEFRETIPIFEVLADERRQQIMIELSQHAQGMTVGELTERMHISQPAVSHQLKTLKERHFVAVEHQGTRNYYRVTFDAPLTQVEHLIHTLKADLELKPYLH
>NZ_CP022294.1|WP_024002907.1|2553790_2554735_-|DNA/RNA-non-specific-endonuclease
MVKLMRRVGIAGLLSLSLLLGGCSLLTSGTDTTSSTTSQQSESSRNQTTSATGNTQQTYKQLAKMTYQSGSAAAIKVNSGKSTLAASQWKNSKIDYGNLDSLNRTTTDTAYLSKANLGRSEGRTAQTWSPTGWHNQPITVNGKRVYPQNRGHLIAYTLSFNLTSNGQYRAGEDGSLDNPKNLATQTAYSNQKTMQIYEDQVRTALEQGKKVIYRVTTVFRGNELMPRGYWSQAVSTDGSVNFNVYIWNVEPGVSFDYATGRGKADSTMQVAGADKVSSSQNTSASRSSQSTTTSKQVERELVKYGYKYVKKALN
>NZ_CP022294.1|WP_011101965.1|2554811_2555357_-|GNAT-family-N-acetyltransferase
MTATITIRPLQRAELTMLWQLGFSDPNAEWTRWNGPYFHDQLPTQTDFETIIGPRDWLIRPRNWVITRDGVIVGSVNWHFVDGSLKRWLEVGIIIYNQEHWGEHIGRTALTKWLTHLFQEETTLPHIGLTTWSGNMRMMQLAEAVGLKQEAWIPQVRYWQGQYYDSVKYGILRNDWQVQKD
>NZ_CP022294.1|WP_003642184.1|2555619_2556147_-|GNAT-family-N-acetyltransferase
MTQFETERLILRPMTAADHDALADMIFDPQVVAYLRYRRVQSPAAFEQLFTTHFLADTTTVFGIERRRDHQLIGFYEFHGSGATGELTYALSPAAWGHGYVAEAGNCLMHYGFETLNYETIEAHYASANPNSGRVMAKMGMQAAGELHTFTSDKGEVIHVMRYLLTKATWRQLSA
>NZ_CP022294.1|WP_015825877.1|2556223_2557054_-|phosphotransferase
MRTLHKTLTRLLQADLIPIAHVSFNEMYTGYSRRYDTVVFVKVFSPNHERKFRTEQQVTAQLTDRVLASFQLASREWVLVLRDWQLTPVPTTLTPALVYQMGQVVSRFHHAIQLPTTADLMPVLDFDGMAARVERLKTSPHYDALVSLLPYFLDHRTMIITALAPQPVMTLHGDMGTRNFRYHHGQLVLIDFERARHGYALEDCLKFFFEDLQQSATLIQAFWAGYGTDLQIPPLVTQWLLLQCSTGIFTYVNQITDPRFEAVGTAMLAQVTLPNH
>NZ_CP022294.1|WP_033608924.1|2557521_2558727_-|CPBP-family-intramembrane-metalloprotease
MTPETEQLLRRWYMGQLIVLFGAAFIQLFTFDGGVFFPVGGMQLLIWGLLAWWPAAEEDQAQWRRLRHVNYYVQTVLQFTLLPILLANLVAWLSQLSWLDEQGLIAVGMAYLMVAFVPVAVVVTKPIESVIGRIAVLITAIFSGVVSAQQTFLVLPNLQAPSVFEMVSDTGILGALGFVIAVGVLLRGWGLTGPSWRFNRQAQTSLVVGLIVVGTAFSLWNAFSAGGSWATTFTHWDFQLRSATWKMFLSGLEPGIAEEWLYRFAVLTLLLQAFRHRRHQLDLAVWLSGGLFGMWHITNVFAGQPLSATVEQIIFAATLGWFLASTYLYSGSILLPMVIHAAIDILSMMASGSQTMVKPDAFEWQTIGATVIIFVGITIYFLTGSRRQVIQAHVNQRLSVQ
>NZ_CP022294.1|WP_003644778.1|2558819_2560442_-|ATP-binding-cassette-domain-containing-protein
MLTVNNVSMQFSTRKLYEDVNLKFTPGNCYGVIGANGAGKSTFLKILEGKLQPTTGTVSMGPNERMSSLNQNHFAFEDEEVLATVIRGHEKLYEIMTEKDALYAKPDFSDEDGIRAAELEGEFAEMDGWNAESEADQLLQNLGIDESMQHLKMSELTEPQKVKVLLGQALFGSPDVLLLDEPTNGLDVQSISWLEDFLAGYEKTVIVVSHDRHFLNQVCTHMCDVDFGKITLFVGNYDFWMESSQLAAKLQANANAKKADQIKELQEFVARFSANASKSKQATSRKKQLEKITLDDIKPSSRKYPFIKFTPDREIGNDLVKVENVSKSIEGVKILDNISFTLRPNEKTALISRNDLATTTLMQIIAGSMAPDSGTVTWGQTTSRTYLPKDINEEYAGSELPIIDWLRQFASKEESDNTFLRGFLGKMLFSGSDVERPVNVLSGGEKVRGMLSKMMLSRANVLLLDDPTNHLDLESITALNDSLIDFKGAIVFTSHDHEFIQTIADHIVEVSAKGVVDRGDTTYDEYLAHEATQGRVQDLY
>NZ_CP022294.1|WP_003644859.1|2560755_2561550_-|HAD-family-hydrolase
MTIKLIATDMDGTFLNDHGDYDQERFANDYAALQQRGIQFVIASGHQAAELATTFSAYPEMWLIGGNGAELWQREAGLKAATFSPQATQQVLAALAPYPELQVALCGTQTVHVLAHANPQFVANMRDYYYQLETCADLTTVTDPVVKFDVICPAAMTEQLVYELTPKLAGIAVPASGGQGSMDLIQPGMHKGRALKQLGEQLGILPDEMLVFGDGTNDLEMFHYATHAVAMQNAPENVQANATAVTGTNVDDGVLDYIEQHILS
>NZ_CP022294.1|WP_052661592.1|2561636_2563562_-|DUF2207-domain-containing-protein
MPKKAVAVSRAPRPGEYDKLGLTIIGGGDGEMSKKRRLSWLSVLGLLAGFCWWFSLAMRAAADYDIDQYQVNVAIQRDGSANVTQAMTYQFDDDYHGVFNVQDLKGIQGAQLEGVTTQLNGGTTVTAAPSETGANNTYQLTQNADRMRVKLYRQVQEDDKLRVVYRYRLKGVVTNYADTAELNWKVIGSGWDVPLNNVKIVIQLPAKNVSALQAWTHGPLSGQTKVERAAGRVTMTLGHNPANQFVESHLLFPTTVTATNTRTNTAKRKATVQKQEAKLAQEANEKRRRNQLLRRVIFGAAVAGWLLVMIGYLWWLARHPAKPHQQPIPINHSFDVPPVTPAVAESLWAQRSPNTDALTAEILRAAANHEITIETVAGHRKPDVRLTQLKPVTNSFLAHCFDKIAVDGQFMLTDLKKYGKRDKAGRLGKWFSRWQTEVDQDVAVYQDETNYRLRNQWLMAAVVVSVMGMIATGAGLLVSPKVVTLMVIPAVVAAVAFWIGWIIQRRRIAINTDAGLELRNQINGLRRMLKDIGHFNTAQVGDLILWEQILPYAAAFGLANQVTKQLAIDFGTEALATGMLVYYPLFYANGGLDFDLSGAINDSFSGALDASGSASSASGGSGGFSGGSSGGFGGGSGGGAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022294_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022294_3

2731092-2731177

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022294_3

>merge|NZ_CP022294|3|2731092-2731177|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP022294|3|1|2731092-2731177|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022294.1\|WP_003642340.1\|2723910_2724195_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP022294.1\|WP_003643398.1\|2731194_2731794_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022294.1\|WP_003642345.1\|2727742_2728309_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP022294.1\|WP_003643401.1\|2736105_2736618_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP022294.1\|WP_011102044.1\|2736598_2737492_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP022294.1\|WP_011102046.1\|2739313_2740150_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP022294.1\|WP_003642350.1\|2733080_2733875_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP022294.1\|WP_112260753.1\|2725863_2726430_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP022294.1\|WP_003642344.1\|2726556_2727594_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP022294.1\|WP_112260754.1\|2734866_2735862_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP022294.1\|WP_003642355.1\|2737785_2738532_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP022294.1\|WP_022638457.1\|2738548_2739004_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100047
NZ_CP022294.1\|WP_003642342.1\|2724976_2725705_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP022294.1\|WP_022638460.1\|2729598_2731077_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP022294.1\|WP_044432936.1\|2731914_2732796_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP022294.1\|WP_033608962.1\|2721042_2723625_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP022294.1\|WP_003643400.1\|2733871_2734870_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP022294.1\|WP_003642338.1\|2719359_2720772_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP022294.1\|WP_003642346.1\|2728528_2729482_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP022294.1\|WP_011102039.1\|2724478_2724844_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647

Protein	Function_ID	Function_description	E-value
NZ_CP022294.1\|WP_003642340.1\|2723910_2724195_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP022294.1\|WP_003643398.1\|2731194_2731794_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP022294.1\|WP_003642345.1\|2727742_2728309_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP022294.1\|WP_003643401.1\|2736105_2736618_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP022294.1\|WP_011102044.1\|2736598_2737492_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.15129e-131
NZ_CP022294.1\|WP_011102046.1\|2739313_2740150_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NZ_CP022294.1\|WP_003642350.1\|2733080_2733875_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP022294.1\|WP_112260753.1\|2725863_2726430_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.17389e-05
NZ_CP022294.1\|WP_003642344.1\|2726556_2727594_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP022294.1\|WP_112260754.1\|2734866_2735862_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.4786e-78
NZ_CP022294.1\|WP_003642355.1\|2737785_2738532_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP022294.1\|WP_022638457.1\|2738548_2739004_-\|hypothetical-protein	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.35635e-53
NZ_CP022294.1\|WP_003642342.1\|2724976_2725705_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP022294.1\|WP_022638460.1\|2729598_2731077_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP022294.1\|WP_044432936.1\|2731914_2732796_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.72098e-56
NZ_CP022294.1\|WP_033608962.1\|2721042_2723625_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.86064e-70
NZ_CP022294.1\|WP_003643400.1\|2733871_2734870_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP022294.1\|WP_003642338.1\|2719359_2720772_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP022294.1\|WP_003642346.1\|2728528_2729482_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NZ_CP022294.1\|WP_011102039.1\|2724478_2724844_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31

>NZ_CP022294.1|WP_022638460.1|2729598_2731077_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP022294.1|WP_003642346.1|2728528_2729482_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP022294.1|WP_003642345.1|2727742_2728309_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP022294.1|WP_003642344.1|2726556_2727594_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP022294.1|WP_112260753.1|2725863_2726430_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDPQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP022294.1|WP_003642342.1|2724976_2725705_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP022294.1|WP_011102039.1|2724478_2724844_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP022294.1|WP_003642340.1|2723910_2724195_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP022294.1|WP_033608962.1|2721042_2723625_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP022294.1|WP_003642338.1|2719359_2720772_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP022294.1|WP_003643398.1|2731194_2731794_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP022294.1|WP_044432936.1|2731914_2732796_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP022294.1|WP_003642350.1|2733080_2733875_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP022294.1|WP_003643400.1|2733871_2734870_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP022294.1|WP_112260754.1|2734866_2735862_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGVPYFIYLLVRG
>NZ_CP022294.1|WP_003643401.1|2736105_2736618_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP022294.1|WP_011102044.1|2736598_2737492_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP022294.1|WP_003642355.1|2737785_2738532_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP022294.1|WP_022638457.1|2738548_2739004_-|hypothetical-protein
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP022294.1|WP_011102046.1|2739313_2740150_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP022294_2	2.1\|2551380\|26\|NZ_CP022294\|PILER-CR	2551380-2551405	26	NZ_CP022294.1	2551296-2551321	0	1.0

1. spacer 2.1|2551380|26|NZ_CP022294|PILER-CR matches to position: 2551296-2551321, mismatch: 0, identity: 1.0

cattcaatgttccaagcccattagta	CRISPR spacer
cattcaatgttccaagcccattagta	Protospacer
**************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022294_2	2.1\|2551380\|26\|NZ_CP022294\|PILER-CR	2551380-2551405	26	AP014283	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, * SEQUENCING IN PROGRESS *	15532-15557	4	0.846

1. spacer 2.1|2551380|26|NZ_CP022294|PILER-CR matches to AP014283 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.846

cattcaatgttccaagcccattagta	CRISPR spacer
cattaaatgttccatgcccattaaaa	Protospacer
**** ********* ********. *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

324083 : 403006

Bacillus_virus(16.67%)

protease,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|324083_324647_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011100974.1\|324840_325509_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|325658_327164_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|327428_327797_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|327909_328419_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_024521227.1\|328449_329646_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|329755_330226_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_112260636.1\|330244_330700_+	hypothetical protein	NA	NA	NA	NA
WP_013355176.1\|330803_331376_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|331541_332462_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_063721090.1\|332598_333510_+	oxidoreductase	NA	NA	NA	NA
WP_003646442.1\|334399_334846_-	ribonuclease H	NA	NA	NA	NA
WP_112260637.1\|335083_336610_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|336610_337582_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|337659_338991_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|339456_340974_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|340988_342818_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|342832_343555_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_112260638.1\|344141_347825_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_041161944.1\|347826_349626_+	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_003641948.1\|349622_350540_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|350583_350847_+	hypothetical protein	NA	NA	NA	NA
WP_003641960.1\|350958_351234_+	hypothetical protein	NA	NA	NA	NA
WP_003641962.1\|351615_352233_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|352236_353391_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|353394_354186_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|354256_355129_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|355288_356104_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|356629_358006_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|358050_359235_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|359619_359823_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|360234_360903_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|360899_361073_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|361103_361271_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|362132_362333_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|362460_362628_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641976.1\|362745_363945_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|363975_364722_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|365599_365746_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_063486822.1\|367266_368010_+	response regulator transcription factor	NA	NA	NA	NA
WP_063204018.1\|368128_368872_+	response regulator transcription factor	NA	NA	NA	NA
WP_021356666.1\|369165_369939_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_021356667.1\|370037_370196_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|370220_370391_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_063721087.1\|370657_372808_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_062688861.1\|372823_374200_+	HlyD family secretion protein	NA	NA	NA	NA
WP_062688864.1\|374289_374979_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|375045_375714_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053566440.1\|375800_376481_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_112260639.1\|376574_377261_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_076633895.1\|377421_377709_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003646479.1\|377720_378014_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_053566442.1\|378303_380613_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_021356643.1\|380871_381648_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|382087_383104_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|383511_384222_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|384294_385656_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|385662_385851_+	hypothetical protein	NA	NA	NA	NA
WP_053566443.1\|385840_386263_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_066011098.1\|386485_387841_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|387858_389295_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003642003.1\|389415_390312_+	ROK family protein	NA	NA	NA	NA
WP_063721084.1\|390461_391208_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_112260640.1\|391320_392334_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_047672680.1\|392788_393922_+	hypothetical protein	NA	NA	NA	NA
WP_060684284.1\|393926_394721_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|394889_395807_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|395852_397127_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_112260641.1\|397119_398079_+	IpaB/EvcA family protein	NA	NA	NA	NA
WP_003646490.1\|398100_398805_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|398804_399647_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_011101012.1\|400243_400633_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|400954_403006_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

1226124 : 1235133

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063722303.1\|1226124_1227354_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.5e-216	97.9
WP_063733823.1\|1227444_1228416_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.0e-180	98.5
WP_003643099.1\|1228601_1229549_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1229892_1230507_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_063720948.1\|1230509_1232948_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_003643095.1\|1233035_1233596_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1233666_1234107_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643092.1\|1234451_1234919_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	2.7e-83	100.0
WP_060683890.1\|1234893_1235133_+	DUF11 domain-containing protein	A0A2P0ZL95	Lactobacillus_phage	1.8e-35	100.0

DBSCAN-SWA_3

1735733 : 1820863

Lactobacillus_phage(79.17%)

capsid,integrase,tail,portal,tRNA,protease,terminase,head

attL 1761316:1761333|attR 1827802:1827819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645968.1\|1735733_1736657_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003645967.1\|1737141_1737663_-	shikimate kinase	NA	NA	NA	NA
WP_063720972.1\|1737665_1738763_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_063720971.1\|1738765_1740064_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003644492.1\|1740077_1740605_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_003640721.1\|1740613_1741783_-	chorismate synthase	NA	NA	NA	NA
WP_015825652.1\|1741775_1743230_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1743878_1744232_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_063485195.1\|1744254_1746831_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1746845_1747151_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1747140_1747440_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1747484_1748702_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1748722_1749199_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1749494_1753808_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1754301_1756011_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1756050_1757328_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1757365_1758151_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_063720970.1\|1758166_1758946_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1759065_1759629_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1759630_1760353_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1760553_1761432_-	elongation factor Ts	NA	NA	NA	NA
1761316:1761333	attL	NA	NA	NA	NA
WP_003640739.1\|1761534_1762338_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1762562_1763285_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1763573_1764572_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1764656_1764962_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003644499.1\|1764945_1765704_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1765815_1766451_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1766507_1766744_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1766841_1767081_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1767232_1767865_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_157262971.1\|1767953_1768046_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003644502.1\|1768419_1769049_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1769098_1770268_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1770303_1770696_-	hypothetical protein	NA	NA	NA	NA
WP_112260704.1\|1770859_1771252_+	hypothetical protein	NA	NA	NA	NA
WP_003644504.1\|1771696_1772638_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_031275254.1\|1773445_1774018_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644505.1\|1774169_1775354_-	LCP family protein	NA	NA	NA	NA
WP_112260705.1\|1775334_1776126_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-30	36.3
WP_003644507.1\|1776144_1777887_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003644508.1\|1778365_1779577_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_003644509.1\|1780621_1781158_-	hypothetical protein	E9LUS0	Lactobacillus_phage	8.6e-41	98.9
WP_003644510.1\|1781169_1781433_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_013355619.1\|1781432_1782605_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.2e-199	89.5
WP_013355620.1\|1782616_1782976_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	5.9e-46	80.7
WP_003644513.1\|1782959_1783121_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	9.5e-20	100.0
WP_013355621.1\|1783124_1783376_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.4e-30	98.6
WP_112260706.1\|1783368_1785903_-\|tail	phage tail protein	A0A2K9VDD0	Lactobacillus_phage	3.8e-248	80.0
WP_003644516.1\|1785919_1788331_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.0
WP_112260707.1\|1788396_1790169_-\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	0.0e+00	93.4
WP_103002053.1\|1790242_1795273_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	53.0
WP_003644519.1\|1795304_1795496_-	hypothetical protein	NA	NA	NA	NA
WP_003644520.1\|1795534_1795909_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
WP_003641402.1\|1795985_1796639_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.5e-111	94.0
WP_003644521.1\|1796654_1797035_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	3.8e-59	91.3
WP_003644522.1\|1797034_1797442_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	9.0e-67	95.4
WP_003644523.1\|1797444_1797792_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	2.7e-43	73.0
WP_003644524.1\|1797781_1798114_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.4e-44	83.6
WP_003644525.1\|1798186_1799419_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	3.2e-208	91.6
WP_003644526.1\|1799433_1800177_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	3.5e-125	95.1
WP_003644527.1\|1800154_1801348_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.2e-223	98.5
WP_003644529.1\|1801526_1803425_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	95.9
WP_003644530.1\|1803427_1803886_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	5.8e-78	94.0
WP_187346411.1\|1804104_1804575_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.9e-84	96.2
WP_112260709.1\|1804585_1804765_-	hypothetical protein	E9LUP6	Lactobacillus_phage	2.5e-13	67.8
WP_112260710.1\|1804952_1805519_-	hypothetical protein	NA	NA	NA	NA
WP_112260711.1\|1805530_1806505_-	hypothetical protein	NA	NA	NA	NA
WP_057138676.1\|1806819_1807248_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	8.3e-63	82.4
WP_057138675.1\|1807522_1807831_-	hypothetical protein	E9LUN7	Lactobacillus_phage	3.5e-47	92.2
WP_057138674.1\|1807834_1808671_-	helix-turn-helix domain-containing protein	U5U793	Lactobacillus_phage	1.9e-39	43.5
WP_112260712.1\|1808712_1809405_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.4e-115	87.4
WP_074028643.1\|1809419_1809881_-	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	1.4e-39	70.9
WP_074028641.1\|1809877_1810504_-	ERF family protein	D7RWM8	Brochothrix_phage	1.0e-13	38.2
WP_112260713.1\|1810503_1811364_-	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	7.1e-37	33.7
WP_164971120.1\|1811363_1811510_-	hypothetical protein	E9LUT9	Lactobacillus_phage	4.7e-18	97.9
WP_187346408.1\|1811512_1811677_-	hypothetical protein	E9LUT8	Lactobacillus_phage	3.2e-15	78.8
WP_074028637.1\|1811688_1811889_-	hypothetical protein	E9LUT7	Lactobacillus_phage	2.9e-26	87.9
WP_003644546.1\|1811891_1812146_-	hypothetical protein	NA	NA	NA	NA
WP_003644547.1\|1812158_1812362_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033615377.1\|1812527_1812818_+	hypothetical protein	NA	NA	NA	NA
WP_003644548.1\|1813410_1813671_-	hypothetical protein	NA	NA	NA	NA
WP_003644549.1\|1813728_1814085_+	hypothetical protein	NA	NA	NA	NA
WP_003644550.1\|1814081_1814285_-	hypothetical protein	NA	NA	NA	NA
WP_003644551.1\|1814295_1815048_-	phage repressor protein/antirepressor Ant	E9LUT0	Lactobacillus_phage	9.8e-59	97.3
WP_003644552.1\|1815060_1815276_-	hypothetical protein	NA	NA	NA	NA
WP_003641361.1\|1815532_1815859_+	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_112260775.1\|1815889_1816279_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	1.0e-35	53.5
WP_016511000.1\|1816341_1817220_+	HIRAN domain-containing protein	A0A2H4J549	uncultured_Caudovirales_phage	3.0e-06	34.8
WP_003644554.1\|1817234_1817435_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.2e-25	97.0
WP_003644556.1\|1818474_1818651_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	7.2e-21	86.2
WP_003644557.1\|1818776_1819034_+	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.0e-31	76.2
WP_003644558.1\|1819216_1819531_+	hypothetical protein	NA	NA	NA	NA
WP_112260714.1\|1819699_1820863_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	2.7e-63	37.6
1827802:1827819	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2143393 : 2179627

Oenococcus_phage(40.62%)

capsid,tail,portal,protease,terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022638105.1\|2143393_2143771_-	hypothetical protein	A0A2K9VCG4	Lactobacillus_phage	7.9e-17	67.5
WP_022638106.1\|2143757_2144054_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	6.4e-38	74.5
WP_050578343.1\|2144054_2145170_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	3.1e-32	77.4
WP_021732622.1\|2145348_2145783_-	hypothetical protein	NA	NA	NA	NA
WP_022638108.1\|2145785_2146235_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.8e-20	39.9
WP_112260728.1\|2146256_2151512_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	8.2e-144	59.4
WP_099739626.1\|2151526_2151859_-	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
WP_057138638.1\|2151902_2157734_-	hypothetical protein	V5URV5	Oenococcus_phage	6.6e-227	40.9
WP_031275283.1\|2157749_2158013_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_003642826.1\|2158120_2158519_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_099447638.1\|2158618_2159002_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_013355729.1\|2159103_2159469_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_013355730.1\|2159468_2160020_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	2.0e-64	62.3
WP_003642822.1\|2160021_2160369_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_013355731.1\|2160368_2160701_-\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642820.1\|2160712_2160889_-	hypothetical protein	NA	NA	NA	NA
WP_003642819.1\|2160901_2161924_-\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_013355732.1\|2161943_2162291_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
WP_013355733.1\|2162305_2162983_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
WP_112260729.1\|2163155_2163362_-	hypothetical protein	NA	NA	NA	NA
WP_003642815.1\|2163413_2163692_-	hypothetical protein	NA	NA	NA	NA
WP_013355736.1\|2163666_2165352_-\|capsid	minor capsid protein	V5US81	Oenococcus_phage	6.5e-119	58.0
WP_024971552.1\|2165498_2165795_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_013355738.1\|2165724_2167233_-\|portal	phage portal protein	V5US18	Oenococcus_phage	1.8e-136	52.0
WP_022638113.1\|2167244_2168483_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	7.1e-139	61.0
WP_022638114.1\|2168472_2169000_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.0e-41	73.1
WP_033607771.1\|2169177_2169357_-	hypothetical protein	E9LUP6	Lactobacillus_phage	4.6e-07	56.9
WP_099447637.1\|2169466_2170297_-	abortive infection family protein	NA	NA	NA	NA
WP_022638116.1\|2170808_2171270_-	hypothetical protein	D6PSV8	Lactobacillus_phage	4.1e-39	57.0
WP_021356389.1\|2171347_2171488_-	hypothetical protein	E9LUN8	Lactobacillus_phage	3.4e-05	96.3
WP_022638117.1\|2171480_2171861_-	hypothetical protein	NA	NA	NA	NA
WP_057138635.1\|2171857_2172376_-	hypothetical protein	O03915	Lactobacillus_phage	2.9e-54	69.1
WP_022638119.1\|2172372_2172660_-	hypothetical protein	NA	NA	NA	NA
WP_003642799.1\|2172656_2173565_-	DnaD domain protein	NA	NA	NA	NA
WP_161325284.1\|2173643_2174396_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	6.3e-74	52.2
WP_022638121.1\|2174427_2175315_-	recombinase RecT	E9LUM3	Lactobacillus_phage	4.6e-63	53.3
WP_022638122.1\|2175317_2175698_-	hypothetical protein	NA	NA	NA	NA
WP_112260730.1\|2176068_2176581_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.5e-23	39.4
WP_003642793.1\|2176648_2176954_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2176965_2177136_-	hypothetical protein	NA	NA	NA	NA
WP_011101086.1\|2177294_2177495_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101085.1\|2177641_2177878_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_013355753.1\|2177915_2178230_+	hypothetical protein	NA	NA	NA	NA
WP_033099030.1\|2178286_2178541_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013355754.1\|2178686_2179190_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.7e-22	42.6
WP_013355755.1\|2179204_2179627_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	3.0e-12	35.1

DBSCAN-SWA_5

2379998 : 2388509

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2379998_2380577_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645866.1\|2380569_2381595_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_016527273.1\|2381591_2383046_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
WP_003645864.1\|2383030_2385250_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2385242_2385923_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2385922_2386177_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2386178_2386910_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_011101896.1\|2386912_2388043_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2388026_2388509_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022292

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022294

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection