CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP030762	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed2, complete sequence	0 crisprs	PD-DExK	0	4
NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	0 crisprs	csa3	0	1
NZ_CP030760	Rhizobium leguminosarum strain ATCC 14479 chromosome, complete genome	1 crisprs	csa3,DEDDh,WYL,cas3	1	6
NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	0 crisprs	csa3,DEDDh	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5065 : 69842

Mycobacterium_phage(21.43%)

transposase,integrase

attL 55655:55714|attR 69900:70016

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162710371.1\|5065_6012_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.6e-10	23.2
WP_063473322.1\|6421_7597_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_063473321.1\|7610_8471_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.4e-32	33.7
WP_112907836.1\|9754_10075_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.5e-19	49.5
WP_063474895.1\|10147_10480_+	thiol reductase thioredoxin	NA	NA	NA	NA
WP_063474896.1\|11319_12093_-	thiazole synthase	NA	NA	NA	NA
WP_063474897.1\|12094_12292_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_063474898.1\|12288_13281_-	glycine oxidase ThiO	NA	NA	NA	NA
WP_082849701.1\|15503_16214_-	hypothetical protein	NA	NA	NA	NA
WP_063474901.1\|16503_16725_-	hypothetical protein	NA	NA	NA	NA
WP_063474902.1\|17161_17638_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_063474903.1\|17780_18800_+	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
WP_063474904.1\|19371_19779_-	hypothetical protein	NA	NA	NA	NA
WP_063474905.1\|19847_20564_-	hypothetical protein	NA	NA	NA	NA
WP_063474906.1\|21270_21906_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_063474907.1\|22069_22795_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_063474908.1\|23340_23985_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-10	25.7
WP_063474909.1\|23977_24754_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-12	24.1
WP_082849703.1\|24750_25713_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_063474910.1\|25709_26606_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_063474911.1\|26750_28031_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_082849704.1\|28561_29392_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_063474914.1\|30945_32109_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_063474915.1\|32156_32948_+	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_063474916.1\|33116_34292_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_063474917.1\|34761_35295_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_112904563.1\|36275_37517_+\|integrase	tyrosine-type recombinase/integrase	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
WP_112904561.1\|37513_38437_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_112904559.1\|38433_39435_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
WP_112907852.1\|39317_40961_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	7.9e-45	31.9
WP_003592504.1\|41128_41473_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_024323553.1\|41469_41856_-\|transposase	transposase	NA	NA	NA	NA
WP_063474919.1\|42038_42953_+	4Fe-4S binding protein	NA	NA	NA	NA
WP_082849708.1\|43592_44735_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_082849705.1\|44739_45357_-	hypothetical protein	NA	NA	NA	NA
WP_063474925.1\|53139_54393_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.7e-68	40.4
WP_028734754.1\|54989_55454_-	hypothetical protein	NA	NA	NA	NA
55655:55714	attL	NA	NA	NA	NA
WP_112904559.1\|55771_56773_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
WP_112904561.1\|56769_57693_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_112904563.1\|57689_58931_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
WP_028734752.1\|60568_60922_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_028734751.1\|60918_61305_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_018241647.1\|64211_64622_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_018241646.1\|64618_64966_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.8e-38	62.6
WP_112904563.1\|66682_67924_+\|integrase	tyrosine-type recombinase/integrase	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
WP_112904561.1\|67920_68844_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_112904559.1\|68840_69842_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
69900:70016	attR	NA	NA	NA	NA

DBSCAN-SWA_2

93191 : 156956

uncultured_virus(11.76%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063474724.1\|93191_94193_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	8.5e-42	35.2
WP_112907838.1\|94310_95321_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_063474865.1\|96328_97033_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_112907853.1\|97785_99408_+	cytochrome-c oxidase, cbb3-type subunit I	NA	NA	NA	NA
WP_003549661.1\|99416_100151_+	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_003549664.1\|100159_100312_+	CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone	NA	NA	NA	NA
WP_112907839.1\|100313_101177_+	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_003549668.1\|101188_101374_+	hypothetical protein	NA	NA	NA	NA
WP_112907840.1\|101550_103119_+	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
WP_011649553.1\|103115_103601_+	cation transporter	NA	NA	NA	NA
WP_063473332.1\|103597_105883_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.6e-78	30.8
WP_003549679.1\|105879_106038_+	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_017992270.1\|106072_106744_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_063473331.1\|107077_108157_-	hypothetical protein	NA	NA	NA	NA
WP_063473330.1\|108190_109198_-	glycerophosphodiester phosphodiesterase family protein	NA	NA	NA	NA
WP_081295608.1\|109662_109995_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_063473328.1\|110314_110986_-	HAD family hydrolase	NA	NA	NA	NA
WP_063473327.1\|111121_112408_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A218MN59	uncultured_virus	2.6e-11	20.5
WP_063473326.1\|112850_114125_+	ROK family protein	NA	NA	NA	NA
WP_012881219.1\|115118_115376_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_063473325.1\|115375_115762_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_027690734.1\|117733_118000_+	hypothetical protein	NA	NA	NA	NA
WP_063473767.1\|118087_119578_+	hypothetical protein	NA	NA	NA	NA
WP_063473768.1\|119574_121032_+	S8 family serine peptidase	NA	NA	NA	NA
WP_063473769.1\|121061_121688_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	4.4e-44	44.3
WP_063473770.1\|121687_122695_+	adenylosuccinate synthetase	A0A1B3B082	Gordonia_phage	6.8e-31	30.9
WP_063473771.1\|122691_123990_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.0e-19	34.7
WP_063473772.1\|124045_124741_-	7-carboxy-7-deazaguanine synthase QueE	A0A0A0RTJ1	Escherichia_phage	3.7e-44	43.5
WP_063473773.1\|124737_125943_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-66	36.5
WP_162710373.1\|125939_126611_-	nitrile hydratase subunit alpha	NA	NA	NA	NA
WP_063473775.1\|126610_127315_-	7-cyano-7-deazaguanine synthase QueC	A0A1V0DY95	Dinoroseobacter_phage	1.9e-32	40.5
WP_162710374.1\|127389_128019_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_162710375.1\|128051_128591_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_063473778.1\|128784_129402_+	6-carboxytetrahydropterin synthase	A0A1B0Z0B1	Vibrio_phage	5.0e-08	24.4
WP_063474878.1\|130543_131173_-	DUF433 domain-containing protein	NA	NA	NA	NA
WP_063474879.1\|131984_132191_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.8e-10	50.0
WP_088930310.1\|135109_136652_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.7e-37	33.2
WP_063473312.1\|137365_137608_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_063473309.1\|138077_138812_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.7e-32	33.7
WP_063473308.1\|138811_140311_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.6e-14	26.2
WP_082849700.1\|140904_143244_-	S8 family peptidase	NA	NA	NA	NA
WP_063474892.1\|143255_144245_-	ATP-binding protein	A0A125SJ49	Acidianus_tailed_spindle_virus	1.7e-13	33.6
WP_063474890.1\|145116_145797_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_063474889.1\|146781_147384_+	amino acid synthesis family protein	NA	NA	NA	NA
WP_063474888.1\|148228_150424_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.7e-08	58.5
WP_082849699.1\|150453_150561_-	hypothetical protein	NA	NA	NA	NA
WP_082849698.1\|152684_152963_+	hypothetical protein	NA	NA	NA	NA
WP_112907841.1\|153043_154042_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	3.1e-52	39.0
WP_112907842.1\|156239_156956_-\|transposase	IS6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

186867 : 241042

Wolbachia_phage(28.57%)

holin,transposase,integrase

attL 175077:175091|attR 248364:248378

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
175077:175091	attL	NA	NA	NA	NA
WP_112907843.1\|186867_187569_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_063473660.1\|187697_188558_-	S49 family peptidase	Q9JMP1	Wolbachia_phage	2.1e-12	25.5
WP_033181974.1\|189380_190361_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_089046350.1\|190826_191591_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_063473658.1\|192581_193166_+	hypothetical protein	NA	NA	NA	NA
WP_063473657.1\|193484_194402_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	2.3e-70	47.7
WP_027691174.1\|195041_195353_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_162710370.1\|195653_195815_+	hypothetical protein	NA	NA	NA	NA
WP_063473655.1\|196350_196659_-	WGR domain-containing protein	NA	NA	NA	NA
WP_063473654.1\|197102_197417_+	hypothetical protein	NA	NA	NA	NA
WP_063473653.1\|197659_198109_-	thermonuclease family protein	NA	NA	NA	NA
WP_063473652.1\|198497_200408_-	conjugal transfer protein TraG	NA	NA	NA	NA
WP_063473651.1\|200394_200610_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_063473650.1\|200614_200911_-	TraC family protein	NA	NA	NA	NA
WP_027681723.1\|201739_202039_-	conjugal transfer protein TrbD	NA	NA	NA	NA
WP_063473648.1\|202031_202415_-	conjugal transfer protein TrbC	NA	NA	NA	NA
WP_063473647.1\|202404_203382_-	P-type conjugative transfer ATPase TrbB	NA	NA	NA	NA
WP_063473646.1\|203378_204017_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_089046349.1\|204217_204607_+\|transposase	transposase	NA	NA	NA	NA
WP_082849656.1\|204747_205002_+	hypothetical protein	NA	NA	NA	NA
WP_063473668.1\|205617_206832_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.4e-118	54.7
WP_063473644.1\|206828_207851_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	9.3e-44	34.3
WP_063473643.1\|208006_209311_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	5.0e-18	26.5
WP_112907845.1\|211173_213234_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	1.7e-07	23.4
WP_082849655.1\|213232_213943_+	hypothetical protein	NA	NA	NA	NA
WP_162710376.1\|214527_216483_-	asparagine synthase (glutamine-hydrolyzing)	R4TIC1	Phaeocystis_globosa_virus	1.7e-33	27.9
WP_063473639.1\|216473_217172_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_162710377.1\|217201_218095_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_063473636.1\|218382_218598_+	hypothetical protein	NA	NA	NA	NA
WP_063473635.1\|218646_219519_+	hypothetical protein	NA	NA	NA	NA
WP_063473634.1\|219765_220929_+	hypothetical protein	NA	NA	NA	NA
WP_082849651.1\|221077_222223_+	phosphonopyruvate decarboxylase	NA	NA	NA	NA
WP_063473633.1\|222327_223188_-	phosphoenolpyruvate mutase	NA	NA	NA	NA
WP_125853655.1\|223399_224485_+	methyltransferase	NA	NA	NA	NA
WP_125853653.1\|224614_225793_-	hypothetical protein	NA	NA	NA	NA
WP_063473630.1\|226005_226698_+	hypothetical protein	NA	NA	NA	NA
WP_027688356.1\|229204_229468_+	hypothetical protein	NA	NA	NA	NA
WP_063473628.1\|229525_230158_+	hypothetical protein	NA	NA	NA	NA
WP_063473626.1\|231070_231655_-	UPF0149 family protein	NA	NA	NA	NA
WP_063473625.1\|233190_233895_-	hypothetical protein	NA	NA	NA	NA
WP_063473624.1\|233983_234466_-	hypothetical protein	NA	NA	NA	NA
WP_063473666.1\|234758_235601_-	hypothetical protein	NA	NA	NA	NA
WP_112907847.1\|235652_236126_-	hypothetical protein	NA	NA	NA	NA
WP_082849659.1\|236146_236689_-	hypothetical protein	NA	NA	NA	NA
WP_063473621.1\|236868_237624_-	nucleotidyltransferase	NA	NA	NA	NA
WP_011649147.1\|237900_239571_+\|transposase	transposase	NA	NA	NA	NA
WP_063473620.1\|239893_241042_+\|integrase	site-specific integrase	NA	NA	NA	NA
248364:248378	attR	NA	NA	NA	NA

DBSCAN-SWA_4

296262 : 305713

Staphylococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063473580.1\|296262_297273_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_063473306.1\|297620_298787_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_063473307.1\|299118_300492_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_063473306.1\|300783_301950_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_041936326.1\|302339_303077_+	hypothetical protein	NA	NA	NA	NA
WP_082849634.1\|303176_304172_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.9e-40	32.1
WP_063473343.1\|304594_305713_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP030761

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1027242 : 1071239

Brevibacillus_phage(14.29%)

transposase,integrase

attL 1027127:1027153|attR 1030502:1030528

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1027127:1027153	attL	NA	NA	NA	NA
WP_112904559.1\|1027242_1028244_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.9e-13	23.9
WP_112904561.1\|1028240_1029164_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_112904563.1\|1029160_1030402_-\|integrase	tyrosine-type recombinase/integrase	A0A2K9VF00	Mycobacterium_phage	3.3e-11	27.8
WP_112907668.1\|1031999_1033115_-	hypothetical protein	NA	NA	NA	NA
1030502:1030528	attR	NA	NA	NA	NA
WP_112907669.1\|1033340_1034954_-	GMC family oxidoreductase	A0A1V0SI18	Klosneuvirus	1.5e-40	27.3
WP_112907671.1\|1036200_1038765_-	two-component system VirA-like sensor kinase	W8CYF6	Bacillus_phage	2.3e-06	23.8
WP_162710355.1\|1038721_1039702_-	c-type cytochrome	NA	NA	NA	NA
WP_162710356.1\|1039749_1040493_-	response regulator	NA	NA	NA	NA
WP_162710357.1\|1042007_1043138_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_112907675.1\|1043660_1044680_+	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
WP_112907676.1\|1044726_1047120_+	transketolase	NA	NA	NA	NA
WP_112907677.1\|1047709_1048081_-	hypothetical protein	NA	NA	NA	NA
WP_112907678.1\|1048077_1048938_-	extradiol ring-cleavage dioxygenase	NA	NA	NA	NA
WP_112907679.1\|1049385_1050303_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_162710358.1\|1050817_1051516_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_162710359.1\|1052240_1053344_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_112907682.1\|1053872_1055048_+	cytochrome P450	NA	NA	NA	NA
WP_112907683.1\|1055223_1055460_+	4-oxalocrotonate tautomerase family protein	NA	NA	NA	NA
WP_112907684.1\|1056166_1056496_+	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_112907685.1\|1057059_1058220_+	amidohydrolase	NA	NA	NA	NA
WP_162710360.1\|1058371_1058842_+	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_162710361.1\|1059230_1059437_+\|transposase	transposase	NA	NA	NA	NA
WP_162710362.1\|1059477_1059627_+\|transposase	transposase	NA	NA	NA	NA
WP_112907688.1\|1059938_1060454_-	hypothetical protein	NA	NA	NA	NA
WP_112907689.1\|1060585_1061254_-	transcriptional regulator	NA	NA	NA	NA
WP_112907691.1\|1061916_1062219_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_112907692.1\|1062280_1063270_+	zinc-dependent alcohol dehydrogenase family protein	A0A0K0KVL7	Prochlorococcus_phage	3.1e-12	30.2
WP_112907693.1\|1063972_1064236_+	WGR domain-containing protein	NA	NA	NA	NA
WP_112907694.1\|1064254_1064878_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_112907695.1\|1064849_1065566_-	hypothetical protein	NA	NA	NA	NA
WP_112907696.1\|1066805_1067861_-	Fic family protein	D7RWK9	Brochothrix_phage	2.5e-07	20.5
WP_112907697.1\|1068918_1069173_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_028739446.1\|1069169_1069412_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_112907698.1\|1069777_1069978_-	hypothetical protein	NA	NA	NA	NA
WP_112907699.1\|1070555_1071239_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-38	41.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP030760

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP030760_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP030760_1

4119676-4119755

Orphan

Consensus_repeat	Method
TGCCGAAAAGTGTGAGCGGTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP030760_1

>merge|NZ_CP030760|1|4119676-4119755|CRISPRCasFinder
TGCCGAAAAGTGTGAGCGGTTTTCGGGCAACATCATGCTCCCACTATTAAAGCATGGTGCCGGAAAGTGTGAGCGGTTTT

>NZ_CP030760|1|1|4119676-4119755|CRISPRCasFinder
TGCCGAAAAGTGTGAGCGGTTTT	CGGGCAACATCATGCTCCCACTATTAAAGCATGG
TGCCGGAAAGTGTGAGCGGTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP030760.1\|WP_112906058.1\|4108607_4110386_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP030760.1\|WP_112906063.1\|4115588_4117535_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP030760.1\|WP_112906730.1\|4113491_4114238_-\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP030760.1\|WP_112906060.1\|4111231_4112242_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293841
NZ_CP030760.1\|WP_112906064.1\|4120927_4121695_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP030760.1\|WP_112906069.1\|4128502_4129642_-\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP030760.1\|WP_018449326.1\|4119794_4120718_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_CP030760.1\|WP_112906067.1\|4124467_4125991_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235870
NZ_CP030760.1\|WP_003545921.1\|4121784_4122036_-\|exodeoxyribonuclease-VII-small-subunit	unknown	unknown	gnl\|CDD\|179195
NZ_CP030760.1\|WP_018245044.1\|4106824_4107310_+\|BA14K-family-protein	unknown	unknown	gnl\|CDD\|369573
NZ_CP030760.1\|WP_018245058.1\|4123257_4123659_+\|thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP030760.1\|WP_003556974.1\|4107403_4108399_-\|transporter	unknown	unknown	gnl\|CDD\|213368
NZ_CP030760.1\|WP_104891238.1\|4128154_4128376_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|215598
NZ_CP030760.1\|WP_018449327.1\|4117655_4119572_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|224076
NZ_CP030760.1\|WP_112906059.1\|4110395_4111151_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|168351
NZ_CP030760.1\|WP_112906066.1\|4123696_4124308_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379265
NZ_CP030760.1\|WP_112906065.1\|4122038_4122974_-\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212541
NZ_CP030760.1\|WP_112906062.1\|4114370_4115369_+\|DUF4424-domain-containing-protein	unknown	unknown	gnl\|CDD\|373054
NZ_CP030760.1\|WP_112906061.1\|4112244_4113495_-\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|225174
NZ_CP030760.1\|WP_112906068.1\|4126445_4127990_+\|methionine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237012

Protein	Function_ID	Function_description	E-value
NZ_CP030760.1\|WP_112906058.1\|4108607_4110386_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.10631e-148
NZ_CP030760.1\|WP_112906063.1\|4115588_4117535_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.65517e-68
NZ_CP030760.1\|WP_112906730.1\|4113491_4114238_-\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	6.51127e-115
NZ_CP030760.1\|WP_112906060.1\|4111231_4112242_-\|hypothetical-protein	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.76119e-76
NZ_CP030760.1\|WP_112906064.1\|4120927_4121695_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.10785e-68
NZ_CP030760.1\|WP_112906069.1\|4128502_4129642_-\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.71334e-41
NZ_CP030760.1\|WP_018449326.1\|4119794_4120718_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	1.74269e-104
NZ_CP030760.1\|WP_112906067.1\|4124467_4125991_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|235870	PRK06834, PRK06834, hypothetical protein; Provisional.	5.79499e-101
NZ_CP030760.1\|WP_003545921.1\|4121784_4122036_-\|exodeoxyribonuclease-VII-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	6.83197e-24
NZ_CP030760.1\|WP_018245044.1\|4106824_4107310_+\|BA14K-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	1.84683e-10
NZ_CP030760.1\|WP_018245058.1\|4123257_4123659_+\|thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	1.95552e-13
NZ_CP030760.1\|WP_003556974.1\|4107403_4108399_-\|transporter	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.40768e-112
NZ_CP030760.1\|WP_104891238.1\|4128154_4128376_+\|hypothetical-protein	gnl\|CDD\|215598	PLN03138, PLN03138, Protein TOC75; Provisional.	0.00211985
NZ_CP030760.1\|WP_018449327.1\|4117655_4119572_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|224076	COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism].	0
NZ_CP030760.1\|WP_112906059.1\|4110395_4111151_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	1.24586e-161
NZ_CP030760.1\|WP_112906066.1\|4123696_4124308_-\|hypothetical-protein	gnl\|CDD\|379265	pfam13563, 2_5_RNA_ligase2, 2'-5' RNA ligase superfamily. This family contains proteins related to pfam02834. These proteins are likely to be enzymes, but they may not share the RNA ligase activity.	0.00015911
NZ_CP030760.1\|WP_112906065.1\|4122038_4122974_-\|histone-deacetylase-family-protein	gnl\|CDD\|212541	cd11599, HDAC_classII_2, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes eukaryotic as well as bacterial Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. In D. discoideum, where four homologs (HdaA, HdaB, HdaC, HdaD) have been identified, HDAC activity is important for regulating the timing of gene expression during development. Also, inhibition of HDAC activity by trichostatin A is shown to cause hyperacetylation of the histone and a delay in cell aggregation and differentiation.	3.26826e-156
NZ_CP030760.1\|WP_112906062.1\|4114370_4115369_+\|DUF4424-domain-containing-protein	gnl\|CDD\|373054	pfam14415, DUF4424, Domain of unknown function (DUF4424). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 310 and 361 amino acids in length.	3.64472e-129
NZ_CP030760.1\|WP_112906061.1\|4112244_4113495_-\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	4.5785e-121
NZ_CP030760.1\|WP_112906068.1\|4126445_4127990_+\|methionine--tRNA-ligase	gnl\|CDD\|237012	PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed.	7.10983e-176

>NZ_CP030760.1|WP_018449327.1|4117655_4119572_-|1-deoxy-D-xylulose-5-phosphate-synthase
MTQLPKTPLLDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKSDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKNIDRAITRAVEHARGYVTGGTMFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNGRGPVLIHVVTQKGKGYPPAEAAADKYHGVNKFDVITGAQARVKPNAPSYTSVFAEALVQEAALDDKIVGITAAMPNGTGLDKLAEAFPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTAFLTTLPGFVVMAAADEAELKHMVRTAVAYDGGPISFRYPRGEGVGVDMPARGEILQIGKGRIVKEGTKVALLSFGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQLARHHEMVITVEEGSIGGFGSHVMHFLATEGLLDNGLKLRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFRALGRGVAVGVAG
>NZ_CP030760.1|WP_112906063.1|4115588_4117535_+|methyl-accepting-chemotaxis-protein
MSAKNISLNGKLAATFAALILIFVAISAFVYSKATASAAASAEQEKSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTATGEPQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIEEVVKIGVNATKGQLDGFRQASAKIKATAREKSNALAAIRADANSDLKTTLLAGGILASLAAAVLAWLMSRTIVRPVVGMTAAMDRLAGGQNDIEVPAVERGDEIGRMAQSVLVFKQAAIEKLRLAGETDRMRDDAERQRRAGDEQKAREEGEIRYAIDALAGGLAELANGDMAGRIQTPFASQYDSLRNDFNHAVEKLQAALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEQTAAALEEVTTTVRDSAKRAEDVGNLVERTRLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALITTSGEQVVAGVGLVGETGKALEVIVSEVQEINHHVNAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEEQTAASHALAQEANALDELLRQFKLGQAKADAPAPRAAVAGTSSRPVASPAHALTRTVAKAFGGRQAAATATVQEEWTEF
>NZ_CP030760.1|WP_112906062.1|4114370_4115369_+|DUF4424-domain-containing-protein
MLKLFTLIVAAVIASPALANDTMAEVKTGGLIFAQSDDVSMAEEDLFISASEVRVDYIFENSSEKDVESLVAFPMPDITGQVDNNSAISDYDSNNFLHFSTVQDGKPITAKLQQRVVSLGIDVTDEFAKLGIPVLPYSQKTTEALAKLPETVRKDWISRGLVYPMGAGDAAGVDLVPLWTLRSTYWWRTTFPAKKKVSVEHRYKPAVGGTVAISFLEGGEPKGDRFEEYSRKYCLDGDFVRVAQQRAREAEAGGANYTESWISYVLSTGANWAGPIKRFQLTIDKGKPGSLISFCGSNVQKIGPTTFRMASEDFDPTRDFDILILNPPETAQ
>NZ_CP030760.1|WP_112906730.1|4113491_4114238_-|TlyA-family-RNA-methyltransferase
MSDQNTQRLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFGADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLLRGAQHVTAIDVGHGQMHPRISGDPRVTNREGLNARNMTAEDIGHPATFIVSDVSFITLKLALAPALEIAEPGAVAILLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFIEDMGWKSLGLIPSPISGGDGNQEFLLAGLKP
>NZ_CP030760.1|WP_112906061.1|4112244_4113495_-|class-I-SAM-dependent-RNA-methyltransferase
MSTETVTIEKLGAQGDGIASSASGPVYVPFSLPGETVAIARVKSQGTIMSITTPSPDRQEPPCRHFGPDGVNGTCGGCTLQHMADAPYRAFKRQLVIDALKSKGLTPEVGEVVPARPGERRRVVFAARKTEKDMLVGFNQAESHHIVAIEECPISSAGIIARLPAIRAIAASLATNAEPFRVAVLETLSGLDISVDEVKKLSDPQRRKAIETALGLRGIARVSLNGEILVEPSKPMVEFGGVQVSPPPGSFTQATKPAEEAMAELVIAHAGKAKRIADLFAGSGTFSLRLARIGRVHAVEAEAKALAALDHAARNTQGLKPVTVEKRDLFRRPLMTQEFKPYDAVVFDPPRAGAEFQCQELARSGVKKIVAVSCNPLTLARDLAILVEGGYRITQVTPIDQFLWTSHVEVVATLEK
>NZ_CP030760.1|WP_112906060.1|4111231_4112242_-|hypothetical-protein
MPVGKAKRRNPYYNGPVSDHFDGTHFFNPDGIEPLGFRDLLRWQFGGGRERWPQSVPSPYPAAKPDPCVDGEDLRVTMVGHATMLVQVAGLNILTDPVWSERVSPFSFAGPKRVVQPGIAFDDLPPIDLVLVSHNHYDHLDIATLRRLGAKHRPRVVTPLGNDTIIRRAVPDIQTTSMDWGERISHAGISIDAEPAHHWSARGTADRRMALWASFVLSTPAGKIYHVGDTGFHNGINYKAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPQEAVIGMKLANAAYVAGHHFATFQLTNEAVDAPARALQDAMSEHDIPPERFRPLRAGEVFNVPAV
>NZ_CP030760.1|WP_112906059.1|4110395_4111151_+|crotonase/enoyl-CoA-hydratase-family-protein
MTDYIIVEQPSAYPGVQSIRFNRPEKKNAITRAMYRTMADALNAANTSPDIRATAFLGTEGCFSAGNDLNDFLAAAMGGRGLEQEILDFLYELVSAEKPVVSGVDGLAVGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGHQRAFAMLAAGEAFSADEAKEAGLVWKVVESGEVDSLTLGLAAKLAAKPPEALRIARDLIRGDRGEIIARIDEEARHFSARLKSAEARAAFEAFMRR
>NZ_CP030760.1|WP_112906058.1|4108607_4110386_+|acyl-CoA-dehydrogenase
MYKAPVEEIAFTLKHVAGMGEAIAQGLLGDLGEDLVDAILAEAGRFATEEVAPLAEIGDRQGARLIDGEVRLPDGWRDLYRHWIAGGWNGLTAPEALGGQALPHMLNVAALEMWNSGSMAFALAPTLTMGAIEAVSTHGSVALKDKYLEKMVSGEWTGTMNLTEPHAGSDLGVLKARAERCDDGSYRLFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHSLEHKLGIHGSPTCTMIYGDGKFGGEKGAVGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGASGAGMSPIVEHPDVARMLLTMKALTQGARAISYACAHAIDMSHRAGDASRHWQERAALLTPIAKSFSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGDQVKGFIAELREIADGVRRSNLDGFGETAARLDAAIADLEQATAWLMKTLAENRTAEALSGATPYQRLFGLVLTGCYLAKGGLAESADGAAENRIALCRFAAENLLAETAALRDRVVNGAASLAAARILLA
>NZ_CP030760.1|WP_003556974.1|4107403_4108399_-|transporter
MDTLPVNIPGFVWAYRFSPEEKTAVRLNNSATVAELTADNCFYWLHLNLVDARVPALLDTLDGLTEDAKSALTTRDTHAAITVDEQMLYGTLVDCQRDFAQDTNNLGWLHFAMSDRFLITTRLQPLRSVERARALIEKNPGKFSRPVDLFELLVIEFQRTLIAIVIELTEELNQIEDIVYDSAQRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAAADDDEMPFGFDDVARRLTSRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTEYAVALIVASIAFAWWLLRRVDIL
>NZ_CP030760.1|WP_018245044.1|4106824_4107310_+|BA14K-family-protein
MIGLRNKIATAVLAAAVVLTGFAPSQAIQMPTAPQVEKSSAVENVQYRRYYRPGYRPGAYYRPGYRPGAYYRPGYYGGYRGYSYYRPGYRHYNGYWYPLAAFGAGAVIGGAIVAQPRYVDPAPRMGSSHVAWCANRYRSYRAYDNTFQPYNGPRQQCYSPY
>NZ_CP030760.1|WP_018449326.1|4119794_4120718_-|pirin-family-protein
MSFFPGKDPLPGDAFACDAIENLIIPRTSDIGGFQVRRALPSRQRRLVGPFIFFDRMGPAILKPDEALDVKPHPHIGLSTVTYLFDGEIRHRDSLGTEKVIRPGDINLMTAGRGIVHSERTPDNLRGHPLLMSGLQTWLALPDDKEEIDPSFAHTEKSAMPLIETAGVRGRVVIGSFEGMTSPVGVFSDTLYVDLDLQPGAKFPFGAGHEERAVYVLSGEVVISGDRFAADQLLVFRPGDAITLEAGRDGCHLMLFGGAALNSKRYIWWNFVSSSKERIEQAKEEWRTGRFDIVPGDEEEFVPLPEG
>NZ_CP030760.1|WP_112906064.1|4120927_4121695_-|SDR-family-oxidoreductase
MSDRLKGKVAIISGGATGMGGAASKLFAAEGARVAIIDRNDQAAADTVQAIREAGGEADCWTADVSDESAVNAAVAGVEERYGAVTVLFNHAGTIVIKPFLETTLQEWDWLHAVNVRSMFLMTKAVLPKMIESGGGSIVCTSSISAVAATPMEVLYDTTKGAVHMFARAIAVEFRDRNIRCNAVCPGFIRTPHGLREVADLQALGVDVSDAAIAAQQGRIGEPEDVARAALYLASDESSFVNGAHLFVDNGFTAI
>NZ_CP030760.1|WP_003545921.1|4121784_4122036_-|exodeoxyribonuclease-VII-small-subunit
MTDSAKPEVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAENRIEKIRLDRAGKPQGVEPLDGA
>NZ_CP030760.1|WP_112906065.1|4122038_4122974_-|histone-deacetylase-family-protein
MSTRLYEHPIFLEHVTPAGHPERSDRIRAINVALEHPNFERLERRQAPQANEDAVLLAHPEEHLIAVMREIPEEEGEINQIEADTYASSKSLQAALTGIGGAMAAVDDVFTGRADNVFVAARPPGHHAEKMTAMGFCFFNNAAIAARHAQKTHGAERIAIVDWDVHHGNGTQDIFWDDASVLFCSTHQMPLYPGTGAKDEKGTHNTIVNAPLSPNVGSDHFREAFKSRVLPALDEFRPDLIIISAGFDAHHRDPLAQINLTGEDFDWATGRVLELADRHAKNRVVSLLEGGYDLEGLAESAGMHILRMMKG
>NZ_CP030760.1|WP_018245058.1|4123257_4123659_+|thioesterase
MSQSKRPDVAEIRVPFRDVDMTGQMFLASYISYAESVLASFWSSRPDVDDEPVYSPSKVSCMLHRPLHYDELATFTATVDKIGMHSIGLLVAIDTGEERAAEVEIIWQARTREDQSPASLPEETRDWLYRFLD
>NZ_CP030760.1|WP_112906066.1|4123696_4124308_-|hypothetical-protein
MIRTKVDTLWFKQCCAFHLQFFPDGEALSQLCNFQDRIERDSDAPLSRVPAKSLHMTVVTLVNAAAQFSIPNDEVWKLNGERWKEIVERLVEETPPFELHFHEVAASEAAVFVKAEEPPELRRLRSAISHAICFEQWRPTPPRIAHITLFRFFAEDRLPAVNFDAGLLPTGVKVGSLKLLEERVYPSVKINILSEPLLRGKST
>NZ_CP030760.1|WP_112906067.1|4124467_4125991_-|FAD-dependent-oxidoreductase
MNNRHPTSFLFDVVIAGAGPVGLLLACELRLARVSVLVLEQAENPHSPLKKLPFGMRGLTLPTIEAFYRRGLLDSLEAPGRQAKPEGKPRKQAGHFAGIPFDYDRINPSMWAYRLPSPADSNMAAEMERVEAVLADRAQSIGVEIRRGVGVEGFAQSADGVTIQAGDQSFEGRWLVGCDGGRSMVRKVGGFSFVGTDPEFTGYSVQVDLADPEKLKLGRQLTPTGMYFQTQPGHFGMVEFDGGASHRTGPITLAHVQAVLRRISQTDVTLTALHVATSWTDRAQQATEYRRGRVLLAGDAAHIHSPLGGQGLNLGLGDAMNLGWKLAATVRGEAPDGLLDSYFSERHPIGEQILAWSRAQVSIMRPSPHARAMESIIRDLIATRDGATYFANRVWNASMRYDLGDGHALAGRSAPDFEWTDGTRLAALLADGTGLLIDFGDRAPLRSIARRWDDRVKYVRGEVKDRLGLTALLVRPDGIVAWACEGEANAEDAVEAGSRWFAVHGGG
>NZ_CP030760.1|WP_112906068.1|4126445_4127990_+|methionine--tRNA-ligase
MNKIYITTSIPYVNAAPHVGFALELIQADAYARHFRLLGHDVRFQCGTDDNSLKNVRSAEAAGLEVRDFVNANADRFEHLGGLLDISNEEFVRTSGDPRHIACVHALWRACAENGDLYRKAYEGLYCVGCEQFYEPSELDDGRCPEHGIALETIREENWFFRLSRYGDRLLELVETGELRIVPAHRRNEVLALLRRGLTDISVSRSAERARGWGVPVPDGDEVVYVWFDALANYLTGLSHGADPTLLQHYWTGGQRIHVVGKGISKFHAIYWPAILLSAGLPPPSSILVHGYVTVDGRKIGKSAGNGIDPERIIQSYETPDALRYYLLRHIRSGDDGDFSDERLEAAWSGELAGQLGNLANRVLALLSTSFNGIVPPVPDSELVEEAARLPEKVARAFAAYELHVGLADIFEFIGAANRRFAQRAPWADAKALLADLTPDDRKATATRLGTSLAEQVHGLAIIARCLLPFLPSSAAKLHSRLGIPSPRLYRDPLIVGGVKAAPQAVLFPQRAAA
>NZ_CP030760.1|WP_104891238.1|4128154_4128376_+|hypothetical-protein
MEIFLVVTVLVGGFALIFALIARAERGATTQTTANTKRRWGNSEGSGDGGGGWFDASGDGGCDGGGGDGGGGD
>NZ_CP030760.1|WP_112906069.1|4128502_4129642_-|PAS-domain-containing-sensor-histidine-kinase
MSGPDTQISMPAEDLEDLYENAPCGYLSLQPDGRIVKVNRTLSTWIGIPAEQLLGKRLHDLLNTSGRIFYETHFAPLLRMQGFFNEVALDLVAVDGRKLPVLANAMERRAEDGALLFTRVTMFQAAERRRYERELVEARAAADTAGAIVKSQLDFEQQTAELREQFIAILGHDLRNPLASIAAAGRMLRKEEQTDRSTKVLDLMQGSVVRMSGLIDNVLDFARARLGGGIVLDRRAEEFEPILRQVIEELRYSHLDRRIEVSIELDGPINCDSSRIGQLVSNLLGNALTHGTPDEPVRLSAATLDGRLELWIANGGAPISSDAMTRLFQPFFKGEAGTSQRGLGLGLYIASEIARAHGGAITVSSGVNETRFTFVMPLD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP030760_1	1.1\|4119699\|34\|NZ_CP030760\|CRISPRCasFinder	4119699-4119732	34	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	179879-179912	9	0.735

1. spacer 1.1|4119699|34|NZ_CP030760|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 9, identity: 0.735

cgggcaacatcatgctcccactattaaagcatgg	CRISPR spacer
cggacaacatcatgctccaactatataatttaga	Protospacer
***.************** *****  ** .  *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4126 : 14835

Bacillus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112906544.1\|4126_5380_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.0e-12	34.1
WP_003547334.1\|5756_6386_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.4e-63	59.2
WP_017963839.1\|6689_7967_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.7e-132	58.4
WP_017959927.1\|8369_10787_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-204	49.4
WP_003558438.1\|10993_11269_+	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	7.1e-07	34.1
WP_112902543.1\|11641_12541_+	DMT family transporter	NA	NA	NA	NA
WP_112906545.1\|12636_14835_+	esterase-like activity of phytase family protein	M4SLV1	Cyanophage	7.8e-80	42.4

DBSCAN-SWA_2

303406 : 316787

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112902752.1\|303406_304420_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.6e-24	42.6
WP_112902754.1\|304438_305296_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.3e-34	38.5
WP_065277110.1\|305292_306009_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-40	47.0
WP_003538990.1\|306192_306384_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_018241796.1\|306435_307047_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_018241797.1\|307043_307871_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.2e-53	46.5
WP_112902756.1\|308071_309355_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	45.3
WP_018241799.1\|309359_310133_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.4e-23	30.2
WP_112902758.1\|310129_310783_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.9e-16	34.1
WP_112902760.1\|311023_312628_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_112902762.1\|312774_313647_-	ATP-binding protein	NA	NA	NA	NA
WP_003558894.1\|313853_314201_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
WP_112902764.1\|314246_316787_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.3e-57	48.2

DBSCAN-SWA_3

594028 : 604297

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112903055.1\|594028_596950_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
WP_018242013.1\|597234_597744_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.6e-44	72.9
WP_018242015.1\|597844_598492_-	MarC family protein	NA	NA	NA	NA
WP_112903057.1\|598728_601569_+	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	1.5e-75	42.2
WP_112903059.1\|602220_602496_-	hypothetical protein	NA	NA	NA	NA
WP_112903061.1\|602632_603127_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.8e-24	35.9
WP_112903063.1\|603185_603758_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.1e-41	52.8
WP_003559389.1\|603787_604297_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-45	59.4

DBSCAN-SWA_4

1578908 : 1592711

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112904272.1\|1578908_1580966_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6
WP_112904274.1\|1581537_1581885_-	GFA family protein	NA	NA	NA	NA
WP_075224496.1\|1581895_1582933_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
WP_112904276.1\|1583195_1584383_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	7.5e-37	28.3
WP_112904278.1\|1584547_1585276_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.4e-49	42.0
WP_112904280.1\|1585324_1587205_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	6.7e-72	34.4
WP_112904282.1\|1587204_1589214_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.2e-89	42.2
WP_112904286.1\|1589882_1590773_+	hypothetical protein	NA	NA	NA	NA
WP_112904288.1\|1590776_1591232_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	3.1e-15	38.7
WP_105008202.1\|1591505_1592711_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.1e-40	33.2

DBSCAN-SWA_5

2557658 : 2567569

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018243693.1\|2557658_2558369_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	2.3e-49	48.7
WP_018446446.1\|2558368_2558725_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_018243695.1\|2558721_2559450_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	2.9e-39	37.6
WP_018243696.1\|2559454_2560675_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	5.4e-14	29.7
WP_026188536.1\|2560779_2561754_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	7.3e-139	75.1
WP_112905309.1\|2561841_2564046_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	4.3e-211	51.4
WP_018243699.1\|2564024_2564429_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.5e-17	43.1
WP_018243700.1\|2564443_2564665_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.9e-17	52.1
WP_112905311.1\|2565316_2567569_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.4e-126	41.2

DBSCAN-SWA_6

4144087 : 4190155

Paenibacillus_phage(25.0%)

transposase,integrase,protease

attL 4132977:4132992|attR 4152041:4152056

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4132977:4132992	attL	NA	NA	NA	NA
WP_112906075.1\|4144087_4144645_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	7.1e-14	36.7
WP_162710315.1\|4144470_4144743_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	1.2e-17	52.0
WP_112906077.1\|4145214_4146390_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_112906078.1\|4146402_4147263_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	2.4e-32	33.7
WP_112906079.1\|4147397_4147853_-	hypothetical protein	NA	NA	NA	NA
WP_018245083.1\|4147918_4148539_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_112906080.1\|4148545_4149583_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_112906081.1\|4149860_4151144_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_028734869.1\|4151227_4151545_+	pyrophosphatase	NA	NA	NA	NA
WP_112906082.1\|4151595_4152087_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
4152041:4152056	attR	NA	NA	NA	NA
WP_112906083.1\|4152103_4153519_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_112906084.1\|4153879_4154524_-	invasion associated locus B family protein	NA	NA	NA	NA
WP_018449294.1\|4154864_4155749_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_033181404.1\|4155766_4157473_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	6.6e-10	37.2
WP_028734865.1\|4157540_4158491_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_018245094.1\|4158627_4159236_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_018245095.1\|4159297_4160176_+	cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_112906085.1\|4160230_4160872_-	chloramphenicol phosphotransferase	NA	NA	NA	NA
WP_028734863.1\|4161013_4161394_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_112906086.1\|4161386_4162142_+	SURF1 family protein	NA	NA	NA	NA
WP_011650764.1\|4162205_4163207_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_112906087.1\|4163277_4164243_+	homoserine kinase	NA	NA	NA	NA
WP_003545999.1\|4164239_4164695_+	ribonuclease HI	J9Q745	Salmonella_phage	4.7e-40	55.8
WP_112906088.1\|4164807_4165893_-	hypothetical protein	NA	NA	NA	NA
WP_003546001.1\|4166041_4166233_-	CsbD family protein	NA	NA	NA	NA
WP_018245102.1\|4166332_4166938_-	YqgE/AlgH family protein	NA	NA	NA	NA
WP_112906733.1\|4167079_4167931_+	cytochrome C biogenesis protein	NA	NA	NA	NA
WP_003557102.1\|4168013_4168499_+	peroxiredoxin	M1I839	Pelagibacter_phage	3.9e-24	50.0
WP_162710316.1\|4168580_4169729_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	2.4e-08	31.7
WP_112906090.1\|4169752_4170889_-	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_018449273.1\|4170992_4171889_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_162710325.1\|4172280_4173267_+	aldo/keto reductase	NA	NA	NA	NA
WP_112906092.1\|4173480_4173999_+	hypothetical protein	NA	NA	NA	NA
WP_112906093.1\|4173995_4174712_+	DUF4405 domain-containing protein	NA	NA	NA	NA
WP_112906094.1\|4174804_4175644_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_112906095.1\|4175679_4176057_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_112906096.1\|4176153_4177224_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_018245123.1\|4177455_4178292_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_112906097.1\|4178507_4178924_+	ester cyclase	NA	NA	NA	NA
WP_065277988.1\|4179049_4179625_-	peroxidase-related enzyme	NA	NA	NA	NA
WP_112906098.1\|4179621_4180104_-	hypothetical protein	NA	NA	NA	NA
WP_112906099.1\|4180265_4181264_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_112906100.1\|4181260_4182751_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_112906101.1\|4182743_4183484_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-25	36.3
WP_112906102.1\|4183500_4184325_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018245130.1\|4184380_4185088_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_018245131.1\|4185107_4185800_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_112906103.1\|4186026_4186548_-	hypothetical protein	NA	NA	NA	NA
WP_112906105.1\|4187323_4188073_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_028734837.1\|4188069_4188942_+	metal ABC transporter permease	NA	NA	NA	NA
WP_112906551.1\|4189087_4190155_+\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP030762

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP030761

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP030760

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection