CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP029615	Lactobacillus reuteri strain SKKU-OGDONS-01 chromosome, complete genome	2 crisprs	RT,DinG,DEDDh,cas3,cas14j,csa3,PrimPol	0	0	14	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP029615_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029615_1

15588-15782

Orphan

Consensus_repeat	Method
GGTGGTAACAAGGTTAAGAAGTTAGCTAAGGAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP029615_1

>merge|NZ_CP029615|1|15588-15782|CRISPRCasFinder
GGTGGTAACAAGGTTAAGAAGTTAGCTAAGGATACCAAGAAGGTTAAGAATAAAAACGCCAAGATTAAGGCTAAGACCTTAGGTGGTAACAAGGTTAAGAAGTTAGCTAAGGATCTCAAGAAAGTCAAAAACAAGAACGCTAAAGTAAGGGTTCGAGTTTCTGGTGAGAACAAAGTTAAGAAATTAGCTAAAGAT

>NZ_CP029615|1|1|15588-15782|CRISPRCasFinder
GGTGGTAACAAGGTTAAGAAGTTAGCTAAGGAT	ACCAAGAAGGTTAAGAATAAAAACGCCAAGATTAAGGCTAAGACCTTA
GGTGGTAACAAGGTTAAGAAGTTAGCTAAGGAT	CTCAAGAAAGTCAAAAACAAGAACGCTAAAGTAAGGGTTCGAGTTTCT
GGTGAGAACAAAGTTAAGAAATTAGCTAAAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029615.1\|WP_113896316.1\|20513_21422_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_162816320.1\|23407_23566_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896305.1\|7588_7789_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_019253327.1\|17746_18610_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896313.1\|11296_11497_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896311.1\|10502_10901_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896307.1\|8122_8557_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_094502455.1\|18965_19298_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377431
NZ_CP029615.1\|WP_113896318.1\|23157_23415_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_019253329.1\|16855_17419_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|366664
NZ_CP029615.1\|WP_094502456.1\|19290_20517_+\|baseplate-J/gp47-family-protein	unknown	unknown	gnl\|CDD\|225836
NZ_CP029615.1\|WP_113896312.1\|10983_11310_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896309.1\|8920_9388_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896308.1\|8556_8937_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896304.1\|6617_7589_+\|N4-gp56-family-major-capsid-protein	unknown	unknown	gnl\|CDD\|275180
NZ_CP029615.1\|WP_162859756.1\|21435_23133_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|372197
NZ_CP029615.1\|WP_113896310.1\|9384_10488_+\|DUF3383-family-protein	unknown	unknown	gnl\|CDD\|371768
NZ_CP029615.1\|WP_113896315.1\|18613_18979_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|375779
NZ_CP029615.1\|WP_019253328.1\|17418_17754_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113896306.1\|7769_8114_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP029615.1\|WP_162859756.1\|21435_23133_+\|phage-tail-protein	gnl\|CDD\|372197	pfam12571, DUF3751, Phage tail-collar fibre protein. This domain family is found in bacteria and viruses, and is approximately 160 amino acids in length. There are two completely conserved residues (K and W) that may be functionally important. The members are annotated as being putative phage tail or tail-collar proteins.	5.3159e-06
NZ_CP029615.1\|WP_094502456.1\|19290_20517_+\|baseplate-J/gp47-family-protein	gnl\|CDD\|225836	COG3299, XkdT, Uncharacterized homolog of phage Mu protein gp47 [Function unknown].	5.10265e-19
NZ_CP029615.1\|WP_113896304.1\|6617_7589_+\|N4-gp56-family-major-capsid-protein	gnl\|CDD\|275180	TIGR04387, hypothetical_protein, major capsid protein, N4-gp56 family. Members of this family are phage major capsid proteins as found in phage N4 (a double-stranded DNA virus) plus many additional lytic phage and integrated prophage regions. [Mobile and extrachromosomal element functions, Prophage functions].	1.33711e-16
NZ_CP029615.1\|WP_094502455.1\|18965_19298_+\|hypothetical-protein	gnl\|CDD\|377431	pfam04965, GPW_gp25, Gene 25-like lysozyme. This family includes the phage protein Gene 25 from T4 which is a structural component of the outer wedge of the baseplate that has acidic lysozyme activity. The family also includes relatives from bacteria that are also presumably lysozymes.	0.00715841
NZ_CP029615.1\|WP_113896310.1\|9384_10488_+\|DUF3383-family-protein	gnl\|CDD\|371768	pfam11863, DUF3383, Protein of unknown function (DUF3383). This family of proteins are functionally uncharacterized. This protein is found in bacteria and viruses. Proteins in this family are typically between 356 to 501 amino acids in length.	6.60277e-18
NZ_CP029615.1\|WP_019253329.1\|16855_17419_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|366664	pfam01476, LysM, LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.	2.97871e-05
NZ_CP029615.1\|WP_113896315.1\|18613_18979_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|375779	pfam18352, Gp138_N, Phage protein Gp138 N-terminal domain. This domain is found in the N-terminal domain of gene product 138 (gp138) in an unidentified bacteriophage. Gp138 is thought to be involved in the process of opening the host cell membrane during infection. The domain has an OB-fold with an intramolecular disulfide bond between C114 and C120.	2.70604e-05

>NZ_CP029615.1|WP_113896313.1|11296_11497_+|hypothetical-protein
MAYSKPANQVEVINEVNDNDAFWFPVIAGVATREEMERATMKEVQILNEVASRKLELLRGDEIENE
>NZ_CP029615.1|WP_113896312.1|10983_11310_+|hypothetical-protein
MTEKNNVKNNQVQPATVDRLSAHEDWKYTDANGYEWKYSFQFPGLKKAYEMLDNATMANGQIAKSILFDEYLQNIVVSEKLTSVDDLIDRPGVNELFDAMDSFLGGLL
>NZ_CP029615.1|WP_113896311.1|10502_10901_+|hypothetical-protein
MADVRLYDAVNANIVIDGRTIQGFQDGDMFSYTYKEEKVKTTVDAQGNPAIAINNNHLATVTINLTGNSVDHKYLNGIANANKQVTLQITSEFEKISGNQAFVVKVPDGAFGKDTPKRSYTFEVLDMRVEAL
>NZ_CP029615.1|WP_113896310.1|9384_10488_+|DUF3383-family-protein
MSNILSDITVKLNIETPSIPVNMGNLAIFVKGAKQNVETFGSYEDLQNAYGSNELLKQVANGYFSQDDHGNKLFVVTYTDVATAASAYYPEGWEFATVIPTDPTAPVTILPSSEEGKENAQASATDTTNAWADVVALSNFIDGKNERFAVVGMAATPENVENAAEFKKKFGNSPRTIAFFSGTNQEEAEYGLGGLVGAVGNETVGSVTWKFRKIGGVKPVDLTVTQIQKLHESNIFTYVTKAGLDQTSEGKTLGGEFVDALHGDDWVKASLETRLQQLLSNSKKITYDAAGIAQIDATVTAVLTDATNNGIISINPETNAGEFTVKTASRAQSSKEDIAQRRYNGLQFSYTRSGAIHTVKVNGQINI
>NZ_CP029615.1|WP_113896309.1|8920_9388_+|hypothetical-protein
MATSYDYSILYKTFSRLIKSRLNLVMIELYGNGKPPEPPFVAFDIVAPKIPTNYLEDDRTFEAVVSFTIYAKTKLQALNYCNQLRAILGDLASRDIYKDNDIVMVERMQVQPRYVEESNNYAFMFGFDMRLRLWETYIDEDKGTIEHVKYKEDVK
>NZ_CP029615.1|WP_113896308.1|8556_8937_+|hypothetical-protein
MSFYIDMTTVLDMFKTEIKVVSGSSEGEWIDGQWQESQGQETTYYEPFVPNDLVGQYSFMNVIRDVGDFTQYNAIWLSKHSDYPINTIVEHKNKRYRVCNIQDLSDYSNVTMYYLQSEEGQDGNKL
>NZ_CP029615.1|WP_113896307.1|8122_8557_+|hypothetical-protein
MNISVEGSVEGDLGIEKMITNLRELDGKAVEAGVFGGFDQKKAMWQEYGTSRGIPSRPFLRNTLYENEERFANYVAPFIANILNGGSADGVINALGPFMQMSIQRTIAAGGFAPLAASTIAKKGHSKQLIDSGSMYGSIDWRAV
>NZ_CP029615.1|WP_113896306.1|7769_8114_+|hypothetical-protein
MSEQQNNRVAKRLKLFPNLSEALSKLDKDIIDELINDALDQATTDGFTESNIVRGATYLAAHFCNLASTTGSNISKQQASVLTIEYFDRGGSDDFLVEYNRLKNSLRQNSIRFM
>NZ_CP029615.1|WP_113896305.1|7588_7789_+|hypothetical-protein
MAYQVIKAFTDSNLNSVNETGEKHVYWEGDEYPYKQYAGAQTKLRLAELTSGGFIEEVNEDERTAE
>NZ_CP029615.1|WP_113896304.1|6617_7589_+|N4-gp56-family-major-capsid-protein
MADQVTQSDNVLDPQVLADMIPAKLTAGLKFTTLAQVDNTLEGRPGSTVEFPTWNYIGDAEDVQENEPIDTSKLTYGSKAATIKKIGKGGSVTDEALETGYGDAWGELSNQLGLAMANKVDNDILDTLRQAVQNTSVNLSLDGIQDALDVYNSEDDATTVLIVSPKAAGRLRLAAGKDWLRGTQLGTDAVTKGVYGDVLGVQIIRSRKLNANEAFLVKTGAEDGKPAVKLMLKRGIKVEQDRIPKQGRTDVYATAMEAAYLYDPTKVVKITFKDVDGPAGTNGAPADVTPDDKPTNVSDEKKLGRQKKRSSKSANDDKKPGEA
>NZ_CP029615.1|WP_019253329.1|16855_17419_+|LysM-peptidoglycan-binding-domain-containing-protein
MAVLAVGNEQVVIHVEREEEETTNTVSKYPIQAGNNITDHTQREEQTFTFEGLLFGKDRYDIQRQWQQLLDWQSKGSILQYAGAIWHGNMMITTLHRIYEDGGYKNAIKFEMELTYIDIVQSSYVKAMNVGPKAPSPPANPGVWVTVRPGNTYWGWWKQYGTPIQTLRNWNHWPDRRIPVGVRARVK
>NZ_CP029615.1|WP_019253328.1|17418_17754_+|hypothetical-protein
MSYRSKFDIDVSKIPQMFSTDFGNTSVSIGINYNEAGDFYTADLYDVQNNPIITGEKLIYGKRLWENYVDDRIPMVDLVPLDESGKSNICNKETFGKTVFLFIDTVVEDNG
>NZ_CP029615.1|WP_019253327.1|17746_18610_+|hypothetical-protein
MGKPQFNFECKVVVHTANANLTYQYGKMKDSIEIHFTVPFSNETEKHITEIELFNIDPNHFNLIQPGNKAELYAGYSGDVGLLVSGTIYKTTIPYAEDADTAYKIRILEGEDYTRKPKINMTFANNTYASTIIPQVVSAAGINLRYISIKDNKCYNDGFTADDHPMEVLSTLAQDCKASLFYLRGQLTMRYVYDGNGADQFDLSPATGLVEGPTRESRDDDWADYEDDDDGLGAWSYSATSILNYHLTTFAWVKLHNKYANVGVMVINGEHSFDGEEARTEFEAVTQ
>NZ_CP029615.1|WP_113896315.1|18613_18979_+|ABC-transporter-substrate-binding-protein
MVRKRDQDIKFLKILQNNINANLHVAQLARVYKLNDDRSRADVQPLALNASGKKRAPLINVPVGMMTRSYIMEGAVVLVLFLDRSMENWSKADNREFSLANKRMHDVNDAVICEVMWVAGH
>NZ_CP029615.1|WP_094502455.1|18965_19298_+|hypothetical-protein
MQDIRLDDGDIRFDYVNDNQEVIQSAEIILGTRKGEFSFAPEMGLRRTNLLGKKSDVEIAASDVYEALQQEDRLKNINVKAIVNDHDRSITLKLTGNVGETKAEMEVDYA
>NZ_CP029615.1|WP_094502456.1|19290_20517_+|baseplate-J/gp47-family-protein
MLDEKGFVRPTYDEIVQQESAKWVQLFGENAQTSAHSVGGILIRIHSYFMDKLYQLAEVIYNSQFVDSATGTTLDQLGANVGLTRLPAQVAMGSVTFYGKIGYTVPAGTLVRTLDGLEYVTSEETTLTDMGETGLTTDDGTYIQLPTESNGNTPNLGSGTSHYLYANKTGANYNKANKTTAIMVNSNENIRYVTVEEVSGGADQETDINFRDRINLSNRTVAPSSPYNGIITAIEKVTGVTAVRIIANDTMVDDTATNTPAKSIHIYVNGGYKNDVAEAIFNSVSAGVLTVGQQKIDVTDIAGGKHTICFDYPTTQDVYVSIKLTKTNEYPLDGDEQVKKIVMKYINKIGMGNTVYYSYLYRLIYDQVPGIQVADIKIGTSKDSLAAQDITLTNVETAQITAEKVMIS
>NZ_CP029615.1|WP_113896316.1|20513_21422_+|hypothetical-protein
MSFLKKFLKLIPSSLVKNKDSNNWKLAKFYTSRLDEINETLDNIELYRNVENAKGKLLDNLGDKYGVKRGPADDSFYRMMIKSKIANRKGDTTVNGVLRTMQNALDIDVKGVKLGPVYQKDGKQEPLALCLTNVPLRFARSEYEQEFMLQQIESIIAAGVRLQDLQFIVPLAAHWTVSSGLATVDTFTIDDSKDYTFNHKANFGLGATSGYTDMSAFDDSKYYSNELAAHYGIGITEGTTEMTMIDDSKQYANQINGHFSPAISINGVATVEITDQFDSKFEIRSHDKAGAAMDHREEYNIK
>NZ_CP029615.1|WP_162859756.1|21435_23133_+|phage-tail-protein
MAEFKQVVITHKGQALMSKLMSGKGNANFTAIRISDTSYNDNQLEELTEIGNIKQEVPISKVTRTNDVAVQIEGAISNIDLKTGYYMRTLGLFAKDPDEGEILYAVTVASQAGYMPPYNGRTTSGAFFRLVTTIGNAENVTLQVNPSAVATIGDVQDLQEQVDELKGIVGYTDDDVFGLEVDYENNKFTRLAGAKNRQPGNDFDNLGPWMRRRCIMTRDDNKVLAYYGEPGYETSGSLTKELTKNGVTYPVGTEFDVMVEQPKFYYRVVPLKTEKTKENGTILKKARYYVSSTSHIGFKVHPAFITNINSKKTEHSKIYLSAYNIQSYQGSAIGSIPSDGSAGIRGERGRLKKFLDETSIKPQFVQTAETISMTKLLHLVEYANFITITSEQNAAATTLRKKYEKQTNASQADMYIMMNEILTYRGETSLMGHADYFYNNMFCTKDKLIICEPISNINSNLNYTESDIKINYDIDLSKPFSDFISYFIYGEDIDWLFFPAFIKGNGNSQLPIGAMAIWEGVNESKIDFADPNNLLITAGPQGNIFGIEQSHDSSQISGRVRLVKY
>NZ_CP029615.1|WP_113896318.1|23157_23415_+|hypothetical-protein
MKLYKDTRGIEKPQSLWTDAYHVYTVENIKEKEIEINGHKIKQYEYDLTMYDKDEYIMTELQKSKQDNQLAIAQLAMQMGGIQNG
>NZ_CP029615.1|WP_162816320.1|23407_23566_+|hypothetical-protein
MVNLYIDLITQGLWTLDKVIKPFYDETVSKLDELGYFDAHPDQRPSSLSSKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP029615_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029615_2

1632500-1632588

Orphan

Consensus_repeat	Method
GGAATTGGTCAATACACAGCTGGTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP029615_2

>merge|NZ_CP029615|2|1632500-1632588|CRISPRCasFinder
GGAATTGGTCAATACACAGCTGGTGTTGCTCAAGCTGGAGCCGGTGCTAATCAACTAGCTAGCGGAATCGGTCAATACACAGCTGGTGT

>NZ_CP029615|2|2|1632500-1632588|CRISPRCasFinder
GGAATTGGTCAATACACAGCTGGTGT	TGCTCAAGCTGGAGCCGGTGCTAATCAACTAGCTAGC
GGAATCGGTCAATACACAGCTGGTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029615.1\|WP_113897238.1\|1638082_1638733_-\|VTT-domain-containing-protein	unknown	unknown	gnl\|CDD\|182775
NZ_CP029615.1\|WP_191981134.1\|1638932_1641260_+\|ATP-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226482
NZ_CP029615.1\|WP_113897240.1\|1641353_1642697_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181958
NZ_CP029615.1\|WP_020843341.1\|1627223_1627796_+\|guanylate-kinase	unknown	unknown	gnl\|CDD\|223272
NZ_CP029615.1\|WP_113897235.1\|1634835_1635018_+\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|283241
NZ_CP029615.1\|WP_019254193.1\|1628333_1628816_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_035169085.1\|1642791_1644150_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181958
NZ_CP029615.1\|WP_042229433.1\|1626806_1627217_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|239520
NZ_CP029615.1\|WP_113897229.1\|1623801_1625106_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP029615.1\|WP_003664828.1\|1629851_1630103_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP029615.1\|WP_113897234.1\|1633593_1634607_+\|D-2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240662
NZ_CP029615.1\|WP_113897230.1\|1625283_1626678_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129987
NZ_CP029615.1\|WP_113897232.1\|1630420_1630957_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP029615.1\|WP_003664834.1\|1627836_1628274_+\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|223806
NZ_CP029615.1\|WP_113897231.1\|1628834_1629674_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_081305709.1\|1635456_1635981_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029615.1\|WP_113897236.1\|1635020_1635269_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP029615.1\|WP_113897237.1\|1636048_1637326_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP029615.1\|WP_113897228.1\|1619321_1620395_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270381
NZ_CP029615.1\|WP_003669019.1\|1637355_1638009_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|223483

Protein	Function_ID	Function_description	E-value
NZ_CP029615.1\|WP_113897238.1\|1638082_1638733_-\|VTT-domain-containing-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	8.74926e-34
NZ_CP029615.1\|WP_191981134.1\|1638932_1641260_+\|ATP-binding-domain-containing-protein	gnl\|CDD\|226482	COG3973, COG3973, Superfamily I DNA and RNA helicases [General function prediction only].	9.37704e-138
NZ_CP029615.1\|WP_113897240.1\|1641353_1642697_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|181958	PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed.	1.01844e-77
NZ_CP029615.1\|WP_020843341.1\|1627223_1627796_+\|guanylate-kinase	gnl\|CDD\|223272	COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism].	8.15949e-29
NZ_CP029615.1\|WP_113897235.1\|1634835_1635018_+\|CsbD-family-protein	gnl\|CDD\|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	0.000399099
NZ_CP029615.1\|WP_035169085.1\|1642791_1644150_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|181958	PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed.	4.57605e-108
NZ_CP029615.1\|WP_042229433.1\|1626806_1627217_+\|NUDIX-domain-containing-protein	gnl\|CDD\|239520	cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily. Ap4A hydrolases are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one subfamily and fungi/animals/archaea enzymes, represented by this subfamily, fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val) that functions as a metal binding and catalytic site, and a required divalent cation, Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variation. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies.	4.19412e-34
NZ_CP029615.1\|WP_113897229.1\|1623801_1625106_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.40967e-36
NZ_CP029615.1\|WP_003664828.1\|1629851_1630103_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.40868e-16
NZ_CP029615.1\|WP_113897234.1\|1633593_1634607_+\|D-2-hydroxyacid-dehydrogenase	gnl\|CDD\|240662	cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains. D-Lactate dehydrogenase (LDH) catalyzes the interconversion of pyruvate and lactate, and is a member of the 2-hydroxyacid dehydrogenases family. LDH is homologous to D-2-hydroxyisocaproic acid dehydrogenase(D-HicDH) and shares the 2 domain structure of formate dehydrogenase. D-HicDH is a NAD-dependent member of the hydroxycarboxylate dehydrogenase family, and shares the Rossmann fold typical of many NAD binding proteins. HicDH from Lactobacillus casei forms a monomer and catalyzes the reaction R-CO-COO(-) + NADH + H+ to R-COH-COO(-) + NAD+. D-HicDH, like the structurally distinct L-HicDH, exhibits low side-chain R specificity, accepting a wide range of 2-oxocarboxylic acid side chains. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-Adenosylhomocysteine Hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain.	0
NZ_CP029615.1\|WP_113897230.1\|1625283_1626678_-\|amino-acid-permease	gnl\|CDD\|129987	TIGR00909, putative_amino_acid_transporter, amino acid transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.79115e-111
NZ_CP029615.1\|WP_113897232.1\|1630420_1630957_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.4769e-09
NZ_CP029615.1\|WP_003664834.1\|1627836_1628274_+\|transcriptional-repressor	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	7.17524e-29
NZ_CP029615.1\|WP_113897228.1\|1619321_1620395_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270381	cd13663, PBP2_PotD_PotF_like_2, The periplasmic substrate-binding component of an uncharacterized active transport system closely related to spermidine and putrescine transporters; contains the type 2 periplasmic binding fold. This group represents the periplasmic substrate-binding domain that serves as a primary polyamine receptor of an uncharacterized ABC-type transport system from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, as well as plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.97953e-143
NZ_CP029615.1\|WP_113897237.1\|1636048_1637326_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	4.53045e-155
NZ_CP029615.1\|WP_113897236.1\|1635020_1635269_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	1.15848e-08
NZ_CP029615.1\|WP_003669019.1\|1637355_1638009_-\|histidine-phosphatase-family-protein	gnl\|CDD\|223483	COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only].	3.42962e-43

>NZ_CP029615.1|WP_113897232.1|1630420_1630957_+|TetR/AcrR-family-transcriptional-regulator
MRVMRTIRDFENALITLLEKNSFESLTVDQICKEALMHRSSFYRYFSDKYDLLEQTLNAQINKLTENTDSEDDIIKQLLSYIDKNKDVIRHLAPNSARSSLYTEILNILSQVLLERRNLDTNDPIVTALQKSDNPEMLAYVLSGAIIGTFYWWQGNNYDVPTEDVIKFARAATKSLTN
>NZ_CP029615.1|WP_003664828.1|1629851_1630103_-|PspC-domain-containing-protein
MAKTKKHLTKSKDKVFLGVFGGIADYFGLDETLVRIIGILIFVFTGFFPLGVFYLLAALVMPEYNDNKTNNDDNIVDGEFREK
>NZ_CP029615.1|WP_113897231.1|1628834_1629674_+|hypothetical-protein
MFSFLDMINSSLSYFNLDVKLKSRIYIIIASLGDIYLIYVTFRLFMNHVWLRALLYCLAVIGLTYFIYLNFVFYFLEKTSRFDFISPRVAKITGQKFENGKAKTPLDAQQRLAAELANRSNGLFANADTIPAAVAIDEHEQHNLQRVVDQLLMEGVFVNGYDGLSEKEIVEQYQATEKPVTALNSQSVPPYFELVHDELRHRLEIYIGMNQMERRPVSHITKIGLTDVHTAHDKYQLYLAAVVVTGGPNKIAGRSGSTILTEEDYGLQVQVAYKQRNNA
>NZ_CP029615.1|WP_019254193.1|1628333_1628816_+|hypothetical-protein
MGAKIPPLVTPFALVSLVLALGATNVVVNKATHTSEGAKVTSVSTSRQFQQSGDDESNQSSRNSQSDRGNDDDDESASSSSTTRTSNSNNTADDTGDTNQTTRSAGNTGTETSTNRSANTNESTSANRNSTSQSTGTTTNNNTTTQDTAGGNTTGTTTTE
>NZ_CP029615.1|WP_003664834.1|1627836_1628274_+|transcriptional-repressor
MEKLIDQAQTIIKDHHLRWTKQRKMMIESVARHPDRYFNIVEIDQYLREQFPGLSHDTIYRNFKEFEKLGIVELRQHHDQMQVKYSCDFTHHHHFICDICGRVQEIQMPPIDKEFFEKQLPGVKITGHRFELHGICAQCQKKSLQ
>NZ_CP029615.1|WP_020843341.1|1627223_1627796_+|guanylate-kinase
MKNNKYVFIVTGAAGSGKTTVANYLQDHYDMHRVITHTTRLPRPGEQDGVDYHFETPFSLKKLHLLEQVTYDQFQYGSSLEGLAEGWKHGKNDVIVLDTAGAITYHQQLGAQAVIIFLTVTHMASLAKRMTLRGDKLSAIRSRLHSKEYHRDLALPAALKGIAHVVVNDQWKNTKQQIDIIVRQILSKKN
>NZ_CP029615.1|WP_042229433.1|1626806_1627217_+|NUDIX-domain-containing-protein
MAIEVTSGAVVYHQGENGIEYLLLESQNKGHFWGFPKGHVEGDESLEETAIREIKEETQLELPIDTSFKVYTEYDLPNGNHKQMTLYTAELDNKEDIHLQAEEIKNCGWFNYQDARERLTYENLKELLDQVNDYLK
>NZ_CP029615.1|WP_113897230.1|1625283_1626678_-|amino-acid-permease
MSLNIMRKESLDRYLGEDKLFVKSMNARDLMAIGIGTVIGTGIFILPGTIAANSAGPGVSLSFLFSAIVCALAAMCYAEFASALPVAGSAYSYGNVVFGEFLGWLLGWALVLEYMLAVASVSTGWAAYFNTLLEGFGIHLPKALSGPFDPAHGTYINIVAVVIVLLITVMLARGMQSSLRINNIAVFLKIAIILIFIIVGFFFIKPKNYHPFLPYHMKGVIHGATIGFFAYLGFDCVSSSAAEVKNPKRNMPLGIIGTLAVATILYTGVAVVLTGMVKYTKLDVANPVAFALQMVHQDWLAELLSIGALIGMFTMMVSMIYSSSRLIYAIGRDGLLPSFLGKLDKKSHSPQVALWIVAIIIAIMGGLVSLDQLTSLVNIGTLFAFMLVSFGIIPLRKRKDIGNRGGFKVPLYPVLPILSGLACLGMMTQLQKETYIGAAIWFGIGILIYFTYGYWHSKLADKKQ
>NZ_CP029615.1|WP_113897229.1|1623801_1625106_-|MFS-transporter
MEYTKKNYKKAPLSSIHFRIYFALALGQIACGFALGISGTALSQATDYINITDFWVGLIGAGSLIGLAGSALMGKIADQFGRRRMLMLDMYLFSIFSLLQLITTNLFILLILRILIGLMIAIDYTVGNALLVEWLPAKESGRFQSQLIIYWTIGFITSYIAGILITGFGPHNWQVILASSVVPGLVAAIYRSIFRIPASPSWLASQGKNKTAQKLIQKHLGKKWGLSLKQIRSKKPKDVSLKTLFNPPYRRKTIVGGLFYACQAFSFFGISIFLPILLKSMNLSNNNLSGIIYNSCVLIGVIFGSLIFKTLSRRMFLVGTFFLSAAALILLMIGNNFSPFFQISVFAIFAIVLSSGLVLDYPYPTELFDVKVRASGVGTCITISRFGAASGTFLLPILTHLGGPILAMLVCTLVLLIGGTICLLWAPETSPKYI
>NZ_CP029615.1|WP_113897228.1|1619321_1620395_+|ABC-transporter-substrate-binding-protein
MKKIFTAFLAIVVICILLALGDVAFNQQKTGGGKQTLTIYNWGDYIDPALITKFEHQTGYHVDYETFDSNESMLTKIRQGGTNYDVVVPSEYTVQRMKKEHLIAPLNHRKLPNLKYIDPQFLNRSFDPDNRYSVPYFWGTLGIIYNDQKVNGKDVQHWEQLWNPRLKNNVMLIDSARDVFAVALITQHHSVNTTSYHQLKLAQAHLKQLTPNVKAIIADEMKMYMEQNEAAVGVTYSGDAREMMNINPHLHYVVPSEGSNIWFDNMVIPKAARNKKAAYEFINFMLDPQNAAQNAQYVGYATPNKAAKKELPKKITDDKAFYPPETTMKHLQVYRDLPLRVLGEYNDLFLEFKMFAK
>NZ_CP029615.1|WP_113897234.1|1633593_1634607_+|D-2-hydroxyacid-dehydrogenase
MKGMGKLMKLIMYSVRDAEKPYIEEWAKKTGNEVKMVTEPLNADTVKLAEGYDGISLQQTTKLGDEQLYEQLAAMGIKQLAARMVGVDIFDFDACKANGIIVTNVPIYSPRAIAEMGVTQAMYLLRRIGEFEQRMSHGDFRWSDDLISNEIYNLTVGIVGLGNIGGATAQIYKALGAKVLAYDPSYNVEYEPYVEYTDFDTVVKNADILSLHTPLLPSTENMIAAPQFKMMKDNAYLINMARGKLVNTADLISALENKEIAGAGLDTLADETSFFGKQVSPDQIPDDYKKLAAMPNVLITPHVAFLTETSIRNMVEISLNDAVTILEGKHSRNEIRM
>NZ_CP029615.1|WP_113897235.1|1634835_1635018_+|CsbD-family-protein
MASDKHGIKDKIAGKLKETEGKVTNDKTREGEGKLQKLKGKVKDEINDLKESIKGNKKEG
>NZ_CP029615.1|WP_113897236.1|1635020_1635269_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MYWIWVLIVGGLIGLAAGALTRRGGSMGVISNIIAGLVGSAIGEAVLGAWGPQVAGMAIVPSIIGAVILVMIVSLIFGIRND
>NZ_CP029615.1|WP_081305709.1|1635456_1635981_+|hypothetical-protein
MGKIIYWVLLIALIVITMGINAHHTHNMVYIHSLILITIMVVISMVSFIAILYCVMAFIFDLRIFHVSSVFSLILLIAVLVGIMLSNFLGWFQHHYHYHMTSLTIMEYYIQWSLIYTTIYQVIFNDLSKSSKYMLKIVAESKIINPDYIIMALFPALISTWIAIVIYKVQQKQI
>NZ_CP029615.1|WP_113897237.1|1636048_1637326_-|GTPase-HflX
METNIQTLEPVIITGLNTGQEDFDYSMVELAELAQANHMEVIDRIDQVIDRPNPATYFGKGKVDEIRDVADANRVPTIITNDELSPSQLRNLEEGTGCRILDRTALILEIFATRAQTKEAKLQVQIAELQYRLPRLQTSASERLDQQTGGGSGFTNRGAGETKLEMDRRTIQHQIAHLRQELAAIAKSEQTKRKQRVKSAIPAAALVGYTNAGKSTIMNGLVRKYGAAEEKTVFEKNMLFATLDTSVRQLTLPDQKRFLLSDTVGFVSKLPTHLVESFKSTLAEAANADLLIQVIDYSDPHYKEMMETTNETLKQIGITDIPMINVFNKADRTEIEFPILEGDDQVVISAKQDASLDLLVDVIKKHLFKDYVTTTLLIPFTDGHVVSYLNEHTNILDTKYESTGTLLTVEMAVQDYQRFNKYEKA
>NZ_CP029615.1|WP_003669019.1|1637355_1638009_-|histidine-phosphatase-family-protein
MAINVYFVRHGQTYLNLYNRMQGWADGPLTPKGEEDAKRVGRALAPIQFDYVFCSDLARTVSTTRFLLAEHPGNNPTPIPEPAFREEFFGYFEGEDGQHFADFLGGPDGYHSFAEMVAGWGPDKLKDKIAAADNYGTAEDHVAFWKRVDKGFDRLRALPDGSEVLVVSHGATIRSIVQRYSDAYDPGDSPRNGSITKLTLDKNNTTVDFYNKLELPE
>NZ_CP029615.1|WP_113897238.1|1638082_1638733_-|VTT-domain-containing-protein
MSHLFYLLTHIAETIIPMFEWMGAWSYVLLFILIFMETGLVIFPWLPGESLVFLTCSFIAFNPILKMEIVIPVFFFAALIGDTVNYYIGHSLSHWQWLKRRMAGPRFEKAQEFLAHHGIKAVALGRFVPLIRTFVPLIAGTMQFPFHRFTIGNIIGVTLWVAIGAGCGYYFGTIPFVRQHFSLIILAFVVASLLGVGLLTLIKAIRQRIIKRNRML
>NZ_CP029615.1|WP_191981134.1|1638932_1641260_+|ATP-binding-domain-containing-protein
MKGREYGMSTKTEKELEQKYLDNVIDKVKQAEQKAEEKIKTAQHDIKGINKQIDDIHLNTTTYSGMMDTAMSFRAQQQMLDERQNSWQHAADRLATLQRLEKKPYFARIDFREKGADESEKVYIGLASFTDKPDHFLVYDWRAPISSVYYEGKLGKVKYQTPVGEQEVDLTLKRQFQIKDGVIVTIFDTDEQVGDQMLLDALGNHSSTKMKSIVTTIQRKQNEIIRDTKNELLFVQGAAGSGKTAAVLQRVAWLLYRYRGNLTSSQVVLFSPNQLFNDYIDQVLPELGEHNMVQMTYFQFANRRVPKLHVQNLEQRFESHQDETAKNAQQLLTSLQYFKATERYANHLGHANMRFRNLMFNGKVFLSKEKIKEIYYSFNNNYNLGNRLDGTKEELIKYLNHRVSTEMRNKWVEDEIQSLSKEEIDNLFNNQPREFEDEDKEYKFLARQIVMRAFMPIKKAIDHNQWLNINGQFLHLLRVTPKLINIAEYGISAEQWKDYVDGVKEDLKKGNISANGITIYLYLYDLITGKHGQRDIRYVFVDEVQDYDAYQLAYLKYRFPRAKFTLLGDLNQAIFTHENSRSLLKQLGTMFDPEKTKVVQLTKSYRSTKQITDFTKHILIDGEAIEAFEREGNKPQVYQTKDEQEGVAAVIDILNKYQNDHDAVAIIGKDLKDSEELYQKLNANNIKTTLIRTENQRLVKGPIVVPSYLAKGLEFDAVIVWNANDQQYHGNDERQLLYTICSRAMHELSLVSIGSTTSLLDQVPTDEYEKVNVDK
>NZ_CP029615.1|WP_113897240.1|1641353_1642697_+|FAD-dependent-oxidoreductase
MRVIIIGCTFAGMTAASQILRSHPETEVTIYDRNAVVPSIVYDINDYDDQDAEQPRLRTELSPDQLSLKGADIKMGSLVMKVDPAQKTIKVMGMLDDATSEEHYDKLIIATDSRSEAPALKGVDSSNVTLIKDQQDAKAALLLSVIDQQIAVIGNDPLSLGLVDAYRQKGKEVTLFTNGEPILHHNFEEEYSKRALDILTADNIKVVTDEHVTELDDNGIGITVATDGGSYSVSRAIVAAGQKPDTSIFEGVVEMDENGVIAVNEFIQTSDPDIYAIGGSTTIHYNPTGKDIYKPQPTEAVRQAVIVAQNINGGQVNDSGTQLSMSLNLDGTYMASLGLTYERAKAAGFDADTVTIEDNYRPEFMPTTTPVLMTLIWDKDTQRILGAQMMSKHDISETLSLISLCIQNQNTIEFLGMYDTMFQPNFDRPFNYVNILGQAAMAKAGIE
>NZ_CP029615.1|WP_035169085.1|1642791_1644150_+|FAD-dependent-oxidoreductase
MKVVIVGCTHAGTIAATQILNAHPDAEVVIYERNDNVSFLSCGIAVYLSGEIGDPDAMFYSSPKQLEEMGATVKVKHNVLSVDPDTKTLEVENQETGELTADFYDKLIITTGSWPVIPPVSGLENKNLYLCKTYYHAKKLFNVAKDSKKIVVVGGGYIGVELVEAYLRQGREVTLIDSSDQMLIKYFDKQYADRIGRIFKDHNAHLELQQRVTGFEDDGNGGVKVLTNKGKVYDADMAVLCVGFRPNSDLVRGKIDLHPDGTIKTNAYMQTSNPDIYAGGDVTSVHFNPTNTDRYVPLATNAVRQGTIAGVNVFGNTMKYMGTQSTTGLHLFGNTMVCTGLTLRRAKEMGIDADSVTIEDNYRPEFMPTTTPVFMTLVWEKGTRRILGAQFMSKHDVSQSANLVSVCIQNRNSIDFLAYVDTLFQPNFDRPFNYVNLLAQAAVAKEDKKVSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4859 : 26229

Listeria_phage(29.41%)

tail,capsid,transposase,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113896302.1\|4859_5822_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.2e-22	32.1
WP_113896303.1\|5975_6617_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_113896304.1\|6617_7589_+\|capsid	N4-gp56 family major capsid protein	Q79S85	Temperate_phage	3.2e-62	46.0
WP_113896305.1\|7588_7789_+	hypothetical protein	NA	NA	NA	NA
WP_113896306.1\|7769_8114_+	hypothetical protein	NA	NA	NA	NA
WP_113896307.1\|8122_8557_+	hypothetical protein	Q7Y5T8	Haemophilus_phage	1.2e-08	35.6
WP_113896308.1\|8556_8937_+	hypothetical protein	NA	NA	NA	NA
WP_113896309.1\|8920_9388_+	hypothetical protein	NA	NA	NA	NA
WP_113896310.1\|9384_10488_+	DUF3383 family protein	A8ATH2	Listeria_phage	5.3e-53	34.9
WP_113896311.1\|10502_10901_+	hypothetical protein	NA	NA	NA	NA
WP_113896312.1\|10983_11310_+	hypothetical protein	D6PSY5	Lactobacillus_phage	6.0e-05	32.4
WP_113896313.1\|11296_11497_+	hypothetical protein	A8ATH5	Listeria_phage	1.3e-05	49.1
WP_113896314.1\|11489_16853_+	hypothetical protein	E9LUR1	Lactobacillus_phage	1.8e-08	23.7
WP_019253329.1\|16855_17419_+	LysM peptidoglycan-binding domain-containing protein	A0A1L2JY61	Aeribacillus_phage	8.8e-20	36.9
WP_019253328.1\|17418_17754_+	hypothetical protein	D6PSZ5	Lactobacillus_phage	2.9e-26	50.9
WP_019253327.1\|17746_18610_+	hypothetical protein	A8ATH9	Listeria_phage	4.9e-38	35.2
WP_113896315.1\|18613_18979_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_094502455.1\|18965_19298_+	hypothetical protein	NA	NA	NA	NA
WP_094502456.1\|19290_20517_+\|plate	baseplate J/gp47 family protein	A8ATI2	Listeria_phage	3.0e-57	33.3
WP_113896316.1\|20513_21422_+	hypothetical protein	A8ATI3	Listeria_phage	5.2e-14	28.4
WP_162859756.1\|21435_23133_+\|tail	phage tail protein	H7BVG0	unidentified_phage	2.8e-101	40.9
WP_113896318.1\|23157_23415_+	hypothetical protein	NA	NA	NA	NA
WP_162816320.1\|23407_23566_+	hypothetical protein	NA	NA	NA	NA
WP_094502460.1\|23577_23955_+	hypothetical protein	A0A0A1ENR5	Lactobacillus_phage	2.7e-41	60.8
WP_019253318.1\|23959_24124_+	hypothetical protein	A0A0A1ENA2	Lactobacillus_phage	4.2e-07	54.9
WP_113896319.1\|24110_24467_+	hypothetical protein	NA	NA	NA	NA
WP_113896320.1\|24468_25380_+	SH3 domain-containing protein	Q9AZ81	Lactobacillus_prophage	1.3e-97	57.0
WP_066035699.1\|25554_25827_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_066035700.1\|25890_26229_+	type II toxin-antitoxin system PemK/MazF family toxin	A9D9Y1	Lactobacillus_prophage	1.8e-20	49.0

DBSCAN-SWA_2

69039 : 147429

Streptococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113896344.1\|69039_70326_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_065533058.1\|70512_70992_-	hypothetical protein	NA	NA	NA	NA
WP_162859785.1\|71161_72181_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_113896346.1\|72340_74263_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_113896347.1\|74272_76291_+	beta-galactosidase	NA	NA	NA	NA
WP_113896348.1\|76489_77470_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_113896349.1\|77550_78450_+	prenyltransferase	NA	NA	NA	NA
WP_113896350.1\|78931_80314_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.7e-30	27.0
WP_113896351.1\|80389_81097_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_113896352.1\|81117_82353_-	MFS transporter	NA	NA	NA	NA
WP_113896353.1\|82471_83350_+	metallophosphoesterase family protein	NA	NA	NA	NA
WP_003667006.1\|83495_83765_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_113896354.1\|84111_84804_+	hypothetical protein	NA	NA	NA	NA
WP_065869119.1\|85037_85700_+	serine dehydratase	NA	NA	NA	NA
WP_065869118.1\|85711_86593_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_003675595.1\|86692_87256_+	peroxiredoxin	NA	NA	NA	NA
WP_113896355.1\|87269_88937_+	FAD-dependent oxidoreductase	A0A2I2L5E1	Orpheovirus	4.0e-52	41.4
WP_113896356.1\|89035_90364_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.3e-49	31.9
WP_003663607.1\|91077_92046_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113896357.1\|92223_97323_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_113896358.1\|97623_98133_+	serine-rich glycoprotein adhesin	NA	NA	NA	NA
WP_113896359.1\|100768_101779_+	sugar transferase	NA	NA	NA	NA
WP_019253804.1\|101797_102988_+	accessory Sec system protein translocase subunit SecY2	NA	NA	NA	NA
WP_113896360.1\|102990_104502_+	accessory Sec system protein Asp1	NA	NA	NA	NA
WP_113896361.1\|104513_106001_+	accessory Sec system protein Asp2	NA	NA	NA	NA
WP_113896362.1\|106003_106891_+	accessory Sec system protein Asp3	NA	NA	NA	NA
WP_113896363.1\|106894_109249_+	accessory Sec system translocase SecA2	NA	NA	NA	NA
WP_113896364.1\|109263_110802_+	accessory Sec system glycosyltransferase GtfA	NA	NA	NA	NA
WP_113896365.1\|110794_112129_+	accessory Sec system glycosylation chaperone GtfB	NA	NA	NA	NA
WP_019253797.1\|112112_112313_+	hypothetical protein	NA	NA	NA	NA
WP_119206179.1\|112551_119451_+	serine-rich glycoprotein adhesin	NA	NA	NA	NA
WP_019252827.1\|119517_120921_-	C69 family dipeptidase	NA	NA	NA	NA
WP_113896367.1\|121058_122888_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_065533034.1\|122967_123153_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_113896368.1\|123288_124791_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_113896369.1\|124836_125349_+	hypothetical protein	NA	NA	NA	NA
WP_066036079.1\|125392_125629_-	hypothetical protein	NA	NA	NA	NA
WP_113896370.1\|125638_126214_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113896371.1\|126430_127153_+	hypothetical protein	NA	NA	NA	NA
WP_113896372.1\|127260_127659_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_113896373.1\|128055_129051_+	LCP family protein	NA	NA	NA	NA
WP_113896374.1\|129958_130702_+	CpsD/CapB family tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	3.9e-23	35.8
WP_113896375.1\|130718_131360_+	sugar transferase	NA	NA	NA	NA
WP_003663607.1\|131361_132330_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113896376.1\|132908_133841_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_113896377.1\|133833_135237_+	amino acid permease	NA	NA	NA	NA
WP_113896378.1\|135315_135573_+	hypothetical protein	NA	NA	NA	NA
WP_113896379.1\|136188_138081_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_113896380.1\|138179_138956_+	tyrosine protein phosphatase	NA	NA	NA	NA
WP_113896381.1\|139124_139517_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113896382.1\|139978_140692_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	2.5e-51	46.3
WP_113896383.1\|140835_141498_+	glycoside hydrolase family 25	A0A0A1ERA5	Lactobacillus_phage	4.6e-68	53.9
WP_113896384.1\|141519_141738_+	SH3 domain-containing protein	A0A0A1ERA5	Lactobacillus_phage	5.8e-20	61.8
WP_113896385.1\|141891_143010_+	exonuclease SbcCD subunit D	A0A222Z7Y3	Bacillus_phage	3.2e-05	25.3
WP_113896386.1\|143011_146113_+	SMC family ATPase	NA	NA	NA	NA
WP_003663607.1\|146460_147429_-\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

369192 : 377256

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019251613.1\|369192_370035_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	8.0e-17	34.1
WP_003666062.1\|370213_370858_+	hemolysin III family protein	NA	NA	NA	NA
WP_003666061.1\|370846_371335_-	dihydrofolate reductase	A0A1B2IBQ4	Erwinia_phage	4.3e-23	40.8
WP_035152640.1\|371350_372313_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.8e-113	60.3
WP_113896509.1\|372331_374242_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.7e-57	30.4
WP_113896510.1\|374243_375455_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	1.1e-35	39.7
WP_113896511.1\|375580_376846_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003666054.1\|376980_377256_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	2.6e-25	68.5

DBSCAN-SWA_4

436410 : 500496

Klosneuvirus(10.0%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113896493.1\|436410_438072_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.5e-99	40.2
WP_113896344.1\|438815_440102_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_035170602.1\|440449_440704_-	hypothetical protein	NA	NA	NA	NA
WP_113896542.1\|440733_441171_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_020843069.1\|441181_443419_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1V0SJX2	Klosneuvirus	1.1e-12	41.7
WP_003674298.1\|443437_443773_-	hypothetical protein	NA	NA	NA	NA
WP_065867360.1\|443851_444592_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_113896543.1\|444592_445552_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_020843066.1\|445629_445935_-	hypothetical protein	NA	NA	NA	NA
WP_020843065.1\|446131_446311_+	hypothetical protein	NA	NA	NA	NA
WP_003665815.1\|446417_447377_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_113896544.1\|447610_448687_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_113896545.1\|448759_450175_-	C69 family dipeptidase	NA	NA	NA	NA
WP_003665812.1\|450666_452502_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.5e-23	25.9
WP_003665811.1\|452632_453784_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.3e-30	27.1
WP_113896546.1\|453912_455778_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	1.4e-135	46.6
WP_003665807.1\|455802_456375_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_113896547.1\|456387_457440_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_003668175.1\|457560_457932_+	hypothetical protein	NA	NA	NA	NA
WP_113896548.1\|457992_458940_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_113896549.1\|458952_459858_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003665800.1\|460056_460416_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_065532820.1\|460435_462694_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	6.7e-18	24.8
WP_003665798.1\|462707_463019_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003668183.1\|463005_463308_-	YlxR family protein	NA	NA	NA	NA
WP_019254158.1\|463336_464524_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003674323.1\|464544_465018_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_113896550.1\|465151_469483_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	2.7e-15	29.7
WP_113896551.1\|469558_471292_-\|tRNA	proline--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.1e-07	22.0
WP_113896552.1\|471320_472595_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003665791.1\|472617_473403_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_113897585.1\|473422_474202_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.8e-22	41.8
WP_035157866.1\|474531_475095_-	ribosome recycling factor	NA	NA	NA	NA
WP_003666862.1\|475099_475822_-	UMP kinase	NA	NA	NA	NA
WP_003666861.1\|475903_476779_-	elongation factor Ts	NA	NA	NA	NA
WP_003666860.1\|476877_477666_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_113896553.1\|477828_478821_-	D-2-hydroxyacid dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	3.6e-40	32.2
WP_003668197.1\|478822_479113_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_113896554.1\|479102_479858_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003668200.1\|479952_480591_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003666855.1\|480634_480862_-	YneF family protein	NA	NA	NA	NA
WP_003674333.1\|480935_481187_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003666853.1\|481315_481942_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	5.6e-15	50.7
WP_191981125.1\|482029_482743_+	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	5.5e-27	34.8
WP_113896302.1\|482628_483591_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.2e-22	32.1
WP_113896555.1\|483660_484818_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_113896556.1\|484843_485512_-	viroplasmin family protein	C1KFJ1	Lactobacillus_virus	1.6e-31	34.3
WP_113896356.1\|485992_487321_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.3e-49	31.9
WP_113896557.1\|487377_487992_-	DUF308 domain-containing protein	NA	NA	NA	NA
WP_003666848.1\|488102_488621_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.7e-30	45.8
WP_113896558.1\|488637_490965_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.3e-74	30.9
WP_029507544.1\|491098_491932_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003666845.1\|491948_492878_-	ribonuclease Z	NA	NA	NA	NA
WP_113896559.1\|492910_494227_-	GTPase ObgE	NA	NA	NA	NA
WP_113896560.1\|494291_496103_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_162859759.1\|496246_496384_+	hypothetical protein	NA	NA	NA	NA
WP_113896561.1\|496467_497850_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.8e-29	27.0
WP_003674350.1\|498336_498636_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1S7FYY8	Listeria_phage	5.0e-22	49.0
WP_003668240.1\|498637_499228_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003666838.1\|499245_500496_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.3e-137	59.2

DBSCAN-SWA_5

575133 : 643819

Burkholderia_virus(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113896606.1\|575133_575643_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_113896607.1\|575814_576672_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_113896608.1\|576786_577815_+	lactonase family protein	NA	NA	NA	NA
WP_191981150.1\|578067_578340_+	hypothetical protein	NA	NA	NA	NA
WP_003663607.1\|579213_580182_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113896610.1\|581496_581853_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_003667696.1\|581842_582031_-	hypothetical protein	NA	NA	NA	NA
WP_113896611.1\|587693_588599_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003666883.1\|588598_589411_-	NAD kinase	NA	NA	NA	NA
WP_019251188.1\|589414_590068_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_113896612.1\|590232_590871_+	DsbA family protein	NA	NA	NA	NA
WP_113896613.1\|590913_592290_-	C69 family dipeptidase	NA	NA	NA	NA
WP_113896614.1\|592291_593326_-	competence protein CoiA	NA	NA	NA	NA
WP_113896615.1\|593409_594081_-	adaptor protein MecA	NA	NA	NA	NA
WP_003666877.1\|594205_594607_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_003666876.1\|594854_595346_+	hypothetical protein	NA	NA	NA	NA
WP_035162055.1\|597164_597764_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113896496.1\|597700_598606_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_113896616.1\|598681_600013_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	32.1
WP_113896617.1\|607643_608291_+	VTT domain-containing protein	NA	NA	NA	NA
WP_113896618.1\|608258_608912_-	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_113896619.1\|608895_609666_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_113896620.1\|609674_610211_-	YutD family protein	NA	NA	NA	NA
WP_113896621.1\|610231_610840_-	metallophosphoesterase	A0A076G7D9	Bacillus_phage	4.5e-30	37.7
WP_035162055.1\|611085_611685_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113896496.1\|611621_612527_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_113896622.1\|612613_613810_-	acetate kinase	NA	NA	NA	NA
WP_113896623.1\|613823_614657_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_113896624.1\|615071_615503_-	ComGF family competence protein	NA	NA	NA	NA
WP_113896625.1\|615499_615790_-	hypothetical protein	NA	NA	NA	NA
WP_113896626.1\|615776_616211_-	hypothetical protein	NA	NA	NA	NA
WP_003667658.1\|616207_616519_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_113896627.1\|616518_617589_-	type II secretion system F family protein	NA	NA	NA	NA
WP_113896628.1\|617506_618484_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_019252894.1\|618603_619350_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_113896629.1\|619424_620270_-	hypothetical protein	NA	NA	NA	NA
WP_113896630.1\|620283_621294_-	catabolite control protein A	NA	NA	NA	NA
WP_162859760.1\|621454_622555_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_113896632.1\|622699_624361_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.9e-99	40.2
WP_113896633.1\|624389_624848_-	hypothetical protein	NA	NA	NA	NA
WP_113896634.1\|624840_625281_-	DUF948 domain-containing protein	NA	NA	NA	NA
WP_113896635.1\|625423_626299_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_113896636.1\|626288_627125_+	HAD family phosphatase	NA	NA	NA	NA
WP_113896637.1\|627230_627674_-	CBS domain-containing protein	NA	NA	NA	NA
WP_029507422.1\|627688_628213_-	metallophosphoesterase	NA	NA	NA	NA
WP_113896638.1\|628216_628807_-	XTP/dITP diphosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	3.6e-08	31.4
WP_113896639.1\|628808_629612_-	glutamate racemase	NA	NA	NA	NA
WP_080707427.1\|629739_630321_+	YslB family protein	NA	NA	NA	NA
WP_113896640.1\|630414_631797_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-29	27.0
WP_003666692.1\|632285_632600_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	6.2e-15	40.4
WP_113896641.1\|632690_635066_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	6.6e-16	45.2
WP_003666690.1\|635067_635604_-	CvpA family protein	NA	NA	NA	NA
WP_003666689.1\|635698_635995_-	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_003666687.1\|636004_636448_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003666685.1\|636444_636711_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_113896642.1\|636983_639638_-\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	6.5e-65	32.5
WP_113896643.1\|639897_641271_-	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	1.6e-51	34.4
WP_113896644.1\|641284_642244_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_113896645.1\|642487_643819_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.6e-49	32.1

DBSCAN-SWA_6

766843 : 820593

Paenibacillus_phage(16.67%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113896708.1\|766843_767425_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_113896709.1\|767508_768411_+	EamA family transporter	NA	NA	NA	NA
WP_191981136.1\|768520_769234_+	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	6.5e-28	35.7
WP_172395775.1\|769158_770082_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.1e-22	32.1
WP_113896710.1\|770142_771075_-	carbamate kinase	NA	NA	NA	NA
WP_003670402.1\|771091_772099_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_019251320.1\|772351_773191_+	DNA-binding domain-containing protein	NA	NA	NA	NA
WP_113896711.1\|773303_774812_-	xylulokinase	NA	NA	NA	NA
WP_086120626.1\|774945_776295_-	xylose isomerase	NA	NA	NA	NA
WP_113896712.1\|776514_778809_-	alpha-xylosidase	NA	NA	NA	NA
WP_113896713.1\|778829_780236_-	MFS transporter	NA	NA	NA	NA
WP_113896714.1\|780410_781574_+	ROK family transcriptional regulator	NA	NA	NA	NA
WP_113896715.1\|781688_783728_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_191981146.1\|783747_785247_-	MFS transporter	NA	NA	NA	NA
WP_113896716.1\|785396_786311_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_113896717.1\|786596_787994_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_094504059.1\|788093_788393_+	hypothetical protein	NA	NA	NA	NA
WP_019252520.1\|788454_789636_-	ROK family transcriptional regulator	NA	NA	NA	NA
WP_113896718.1\|790021_791380_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_113896719.1\|791560_792175_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_056968813.1\|792221_793883_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	9.7e-99	40.0
WP_102816611.1\|794053_794914_-	sugar transporter	NA	NA	NA	NA
WP_113896720.1\|795081_796569_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.7e-35	32.9
WP_003670412.1\|796568_797288_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.7e-34	36.3
WP_035155145.1\|797897_798509_-	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	6.6e-29	54.1
WP_013923961.1\|798831_799638_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_042746466.1\|800108_801974_-	acetyltransferase	C6ZR20	Salmonella_phage	5.7e-23	28.1
WP_019253915.1\|802035_802347_-	hypothetical protein	NA	NA	NA	NA
WP_065532676.1\|802607_804428_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	1.4e-90	36.5
WP_113896344.1\|804696_805983_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_065532675.1\|806157_807513_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_003667494.1\|808423_809287_-	TIGR00159 family protein	NA	NA	NA	NA
WP_113896721.1\|809434_810790_-	L-fucose:H+ symporter permease	NA	NA	NA	NA
WP_003666460.1\|810809_811205_-	D-ribose pyranase	NA	NA	NA	NA
WP_003666459.1\|811216_812140_-	ribokinase	NA	NA	NA	NA
WP_003676233.1\|812472_813369_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_078009114.1\|813493_814033_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	3.7e-07	26.4
WP_019253908.1\|814044_814467_+	PAS domain-containing protein	NA	NA	NA	NA
WP_113896722.1\|814498_815008_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003667485.1\|815007_815466_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_003666452.1\|815749_816724_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_102816875.1\|816784_817474_-	uracil-DNA glycosylase	A0A0A8IL23	Epstein-Barr_virus	2.2e-41	49.2
WP_003667483.1\|817624_818209_+	hypothetical protein	NA	NA	NA	NA
WP_113896723.1\|818335_819691_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.4e-49	31.9
WP_113896496.1\|819687_820593_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6

DBSCAN-SWA_7

899761 : 908698

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020843070.1\|899761_901144_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-30	27.0
WP_113896763.1\|901645_902407_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_113896764.1\|902416_903283_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-76	54.3
WP_113896765.1\|903291_903642_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.0e-05	28.0
WP_113896766.1\|903652_904666_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	8.7e-34	32.8
WP_003666336.1\|904680_905004_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_113896767.1\|905023_905665_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.7e-56	55.7
WP_019253644.1\|905674_905923_-	YaaL family protein	NA	NA	NA	NA
WP_003666331.1\|905927_906530_-	recombination protein RecR	NA	NA	NA	NA
WP_003667377.1\|906533_906854_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_113896768.1\|906862_908698_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.0e-56	38.6

DBSCAN-SWA_8

1181669 : 1283649

Lactobacillus_phage(14.29%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113897003.1\|1181669_1182977_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.0e-95	45.1
WP_113897005.1\|1184627_1198820_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_003663607.1\|1207915_1208884_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_086878860.1\|1209062_1209989_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_113897008.1\|1209991_1211242_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	8.4e-39	44.9
WP_003665363.1\|1211241_1211814_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.2e-42	46.2
WP_113897009.1\|1212071_1213478_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.3e-80	36.4
WP_113897010.1\|1213611_1214622_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_113897011.1\|1214782_1216156_+	SLC45 family MFS transporter	NA	NA	NA	NA
WP_113897012.1\|1216535_1217624_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
WP_113897013.1\|1217616_1220787_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_113897014.1\|1220865_1222251_-	SLC45 family MFS transporter	NA	NA	NA	NA
WP_113897015.1\|1222268_1223951_-	alpha-glucosidase	NA	NA	NA	NA
WP_113897016.1\|1224133_1226077_-	fibrinogen-binding adhesin SdrG C-terminal domain-containing protein	NA	NA	NA	NA
WP_113897017.1\|1226188_1227691_-	glycosyltransferase	NA	NA	NA	NA
WP_113897018.1\|1227692_1229234_-	accessory Sec system glycosyltransferase Asp1	NA	NA	NA	NA
WP_003665350.1\|1229372_1229777_+	hypothetical protein	NA	NA	NA	NA
WP_109884254.1\|1229842_1230484_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003663607.1\|1230609_1231578_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897019.1\|1232274_1232661_+	hypothetical protein	NA	NA	NA	NA
WP_113897020.1\|1232755_1233292_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_113897021.1\|1233464_1234244_-	DUF5011 domain-containing protein	NA	NA	NA	NA
WP_113897022.1\|1234353_1235652_-	adenylosuccinate synthase	L7Y4J5	Megavirus	3.3e-70	36.4
WP_113897023.1\|1235847_1236822_+	GMP reductase	Q4ZCY7	Staphylococcus_virus	2.3e-132	66.9
WP_113897024.1\|1236881_1238231_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_113897025.1\|1238499_1238997_+	ECF transporter S component	NA	NA	NA	NA
WP_113897026.1\|1239049_1240804_-	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	NA	NA	NA	NA
WP_066035753.1\|1240942_1241809_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.3e-57	44.8
WP_065533524.1\|1241926_1242655_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	NA	NA	NA	NA
WP_113897027.1\|1242786_1244127_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_113897028.1\|1244278_1245460_-	chloride channel protein	NA	NA	NA	NA
WP_113897029.1\|1245462_1246728_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_113897030.1\|1246721_1247387_-	response regulator transcription factor	A0A1J0GWE0	Alteromonas_phage	1.0e-06	25.2
WP_003669576.1\|1247388_1248009_-	GTP pyrophosphokinase	NA	NA	NA	NA
WP_019253731.1\|1248096_1248582_-	hypothetical protein	NA	NA	NA	NA
WP_003669573.1\|1248658_1249321_-	beta-phosphoglucomutase	NA	NA	NA	NA
WP_113897031.1\|1249339_1251592_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_035154886.1\|1251680_1253030_-	SLC45 family MFS transporter	NA	NA	NA	NA
WP_113897032.1\|1253341_1254520_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_042746418.1\|1254583_1255519_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_113897033.1\|1255519_1259698_-	helicase-exonuclease AddAB subunit AddA	A7KV33	Bacillus_phage	1.2e-17	23.8
WP_113897034.1\|1259697_1263480_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_113896632.1\|1263593_1265255_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.9e-99	40.2
WP_113897035.1\|1265417_1266881_-	cardiolipin synthase	NA	NA	NA	NA
WP_113897036.1\|1266978_1267605_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_113897037.1\|1267688_1270607_-	hypothetical protein	NA	NA	NA	NA
WP_113897038.1\|1271418_1272573_+	o-succinylbenzoate synthase	NA	NA	NA	NA
WP_113897039.1\|1272636_1273965_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	31.9
WP_113897040.1\|1274090_1276328_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	7.1e-121	38.8
WP_003670244.1\|1276445_1276667_-	hypothetical protein	NA	NA	NA	NA
WP_113897041.1\|1277171_1278359_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_113897593.1\|1278360_1279356_+	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.4e-33	30.5
WP_113897042.1\|1279423_1279852_+	OsmC family protein	NA	NA	NA	NA
WP_113897044.1\|1280347_1282498_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	2.5e-46	27.4
WP_113897045.1\|1282680_1283649_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1316579 : 1381880

Bacillus_virus(15.79%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113896496.1\|1316579_1317485_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_035162055.1\|1317421_1318021_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_191981141.1\|1318468_1319353_-	polyphosphate kinase 2 family protein	NA	NA	NA	NA
WP_065533488.1\|1319529_1319856_-	hypothetical protein	NA	NA	NA	NA
WP_065533487.1\|1319868_1321071_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	5.4e-43	31.3
WP_003665244.1\|1321192_1322584_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	4.0e-122	52.5
WP_003665243.1\|1322617_1323070_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_113897063.1\|1323075_1325094_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_003665240.1\|1325310_1325547_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_065533485.1\|1325580_1326144_-	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	1.3e-42	51.9
WP_003665235.1\|1326181_1326478_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_113897064.1\|1326680_1329185_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.1e-114	37.1
WP_003669489.1\|1329227_1331177_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.0e-140	44.7
WP_003665231.1\|1331173_1332298_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003665230.1\|1332306_1332528_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_113897065.1\|1332776_1333919_-	DNA polymerase III subunit beta	D0R7I4	Paenibacillus_phage	1.1e-13	31.2
WP_003665228.1\|1334094_1335417_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_003665227.1\|1335912_1336047_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_003665224.1\|1336185_1336539_+	ribonuclease P protein component	NA	NA	NA	NA
WP_004562481.1\|1336542_1337376_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_113897067.1\|1337471_1338239_+	Jag N-terminal domain-containing protein	NA	NA	NA	NA
WP_113897068.1\|1338395_1339784_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_113897069.1\|1339795_1341739_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_113897070.1\|1341937_1343857_+	asparagine synthase (glutamine-hydrolyzing)	A0A1X9VNR2	Mimivirus	5.7e-18	28.9
WP_113897071.1\|1343994_1345545_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_113897072.1\|1345562_1346807_+	carboxylate--amine ligase	NA	NA	NA	NA
WP_113896632.1\|1347450_1349112_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.9e-99	40.2
WP_003665211.1\|1350440_1351046_+	signal peptidase I	NA	NA	NA	NA
WP_113897073.1\|1351578_1352442_+	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	7.1e-29	29.4
WP_113897074.1\|1352540_1353125_-	hypothetical protein	NA	NA	NA	NA
WP_113896640.1\|1355926_1357309_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-29	27.0
WP_113897075.1\|1358091_1358967_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_035156241.1\|1359155_1359989_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	3.9e-16	30.0
WP_113897076.1\|1359981_1360701_+	ABC transporter permease	NA	NA	NA	NA
WP_052040472.1\|1360697_1360913_+	hypothetical protein	NA	NA	NA	NA
WP_113897077.1\|1361247_1361520_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_113896496.1\|1361600_1362506_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_035162055.1\|1362442_1363042_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113897078.1\|1363275_1363929_+	glucose-6-phosphate 1-dehydrogenase family protein	NA	NA	NA	NA
WP_162859769.1\|1363975_1364122_+	hypothetical protein	NA	NA	NA	NA
WP_191981139.1\|1364870_1365548_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.2e-20	40.1
WP_113896632.1\|1365785_1367447_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.9e-99	40.2
WP_003665189.1\|1367481_1368018_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.3e-07	25.5
WP_113897079.1\|1368232_1369252_+	serine hydrolase	NA	NA	NA	NA
WP_113897080.1\|1369321_1369732_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	4.6e-26	49.6
WP_113897081.1\|1370092_1370587_-\|tRNA	prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_113897082.1\|1370800_1371091_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_113897083.1\|1371080_1371407_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_113897084.1\|1371593_1372016_-	hypothetical protein	NA	NA	NA	NA
WP_113897085.1\|1371990_1372761_-	response regulator transcription factor	NA	NA	NA	NA
WP_113897086.1\|1372773_1373763_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_113897087.1\|1374393_1374879_-	DUF3278 domain-containing protein	NA	NA	NA	NA
WP_113897088.1\|1375939_1376617_-	dihydrofolate reductase family protein	NA	NA	NA	NA
WP_003669430.1\|1376718_1377648_-	AEC family transporter	NA	NA	NA	NA
WP_113897089.1\|1378079_1379048_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897090.1\|1379682_1381014_+	GHKL domain-containing protein	W8CYF6	Bacillus_phage	2.0e-22	28.8
WP_113897091.1\|1381430_1381880_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.2e-34	53.8

DBSCAN-SWA_10

1402240 : 1472805

Staphylococcus_virus(10.53%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029507411.1\|1402240_1403539_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	2.1e-56	31.7
WP_003665121.1\|1403558_1404569_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	7.2e-65	43.1
WP_191981138.1\|1404945_1405506_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_113897105.1\|1405739_1408271_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	2.6e-63	25.4
WP_113897106.1\|1408416_1409058_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_113897107.1\|1409262_1410585_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	2.9e-66	31.5
WP_162859771.1\|1411088_1411241_+	hypothetical protein	NA	NA	NA	NA
WP_113896493.1\|1411237_1412899_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.5e-99	40.2
WP_113897108.1\|1413067_1414282_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.9e-29	27.2
WP_113897109.1\|1414454_1415630_+	MFS transporter	NA	NA	NA	NA
WP_113897110.1\|1415641_1416955_+	hypothetical protein	NA	NA	NA	NA
WP_003669387.1\|1416947_1417400_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_113897111.1\|1417464_1418067_-	nitroreductase family protein	NA	NA	NA	NA
WP_113897596.1\|1418164_1418476_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_113897112.1\|1418604_1419261_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_113897113.1\|1419438_1419876_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_113897114.1\|1420004_1420238_+	cytochrome B5	NA	NA	NA	NA
WP_172395775.1\|1420295_1421219_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.1e-22	32.1
WP_191981136.1\|1421143_1421857_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	6.5e-28	35.7
WP_003665104.1\|1422055_1422274_+	cytochrome b5	NA	NA	NA	NA
WP_113897115.1\|1422286_1422550_+	cytochrome B5	NA	NA	NA	NA
WP_113897116.1\|1424616_1425573_+	ketopantoate reductase family protein	NA	NA	NA	NA
WP_113897117.1\|1425638_1427033_-	amino acid permease	NA	NA	NA	NA
WP_113897118.1\|1427262_1428555_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_113897119.1\|1429857_1431741_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.8e-86	32.3
WP_113897120.1\|1431991_1432699_-	hypothetical protein	NA	NA	NA	NA
WP_191981137.1\|1432963_1434604_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_003665087.1\|1435126_1436137_+	zinc-dependent alcohol dehydrogenase family protein	A0A2K9L7I1	Tupanvirus	3.1e-07	26.8
WP_113897122.1\|1436347_1436860_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_113897123.1\|1436871_1437930_+	ABC transporter permease	NA	NA	NA	NA
WP_065533430.1\|1437948_1438638_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-33	38.5
WP_113897124.1\|1438734_1440717_+	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	1.4e-32	40.7
WP_113897125.1\|1440826_1441063_+	hypothetical protein	NA	NA	NA	NA
WP_003665080.1\|1441166_1441484_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003663607.1\|1441665_1442634_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897126.1\|1442750_1444460_-	LysM peptidoglycan-binding domain-containing protein	A0A249Y0X5	Enterococcus_phage	5.6e-25	40.9
WP_113897127.1\|1444886_1445831_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-16	27.1
WP_003665077.1\|1445963_1446149_-	hypothetical protein	NA	NA	NA	NA
WP_113897128.1\|1446373_1446994_+	hypothetical protein	NA	NA	NA	NA
WP_113897129.1\|1446995_1448192_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	7.5e-53	35.3
WP_003670084.1\|1448513_1449791_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_113897130.1\|1449909_1450404_-	hypothetical protein	NA	NA	NA	NA
WP_113897131.1\|1450507_1451146_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_113897132.1\|1451343_1452729_-	L,D-transpeptidase	NA	NA	NA	NA
WP_003665067.1\|1453245_1453902_+	L,D-transpeptidase	NA	NA	NA	NA
WP_113897133.1\|1454100_1454682_-	hypothetical protein	NA	NA	NA	NA
WP_003663607.1\|1454795_1455764_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897134.1\|1455831_1457043_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_113897135.1\|1457110_1457965_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_113896496.1\|1458029_1458935_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_035162055.1\|1458871_1459471_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113897136.1\|1459665_1460787_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_113897137.1\|1460944_1463074_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.3e-159	45.7
WP_113897138.1\|1463199_1463463_-	hypothetical protein	NA	NA	NA	NA
WP_113897139.1\|1463603_1464257_+	phosphoglycerate mutase family protein	NA	NA	NA	NA
WP_113897140.1\|1464425_1465979_+	YfcC family protein	NA	NA	NA	NA
WP_113897141.1\|1466140_1467550_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_113897142.1\|1467862_1469191_-	purine permease	Q9KX94	Enterobacteria_phage	2.1e-35	30.8
WP_113897143.1\|1469557_1470991_+	C69 family dipeptidase	NA	NA	NA	NA
WP_056968813.1\|1471143_1472805_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	9.7e-99	40.0

DBSCAN-SWA_11

1874766 : 1933868

Erysipelothrix_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113897346.1\|1874766_1875537_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_003672672.1\|1875642_1876086_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_003668771.1\|1876093_1876495_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_035157140.1\|1876609_1877383_+	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_153700582.1\|1877490_1878159_+	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	5.5e-29	48.3
WP_113897347.1\|1878176_1878752_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_113897348.1\|1878768_1879902_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_003664509.1\|1880058_1882332_+	DNA helicase PcrA	A7KV33	Bacillus_phage	5.5e-137	43.2
WP_113897349.1\|1882350_1884393_+	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	4.8e-100	34.9
WP_113897350.1\|1884396_1885512_+	CamS family sex pheromone protein	NA	NA	NA	NA
WP_113897351.1\|1885663_1885981_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_113897352.1\|1885980_1887453_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_113897353.1\|1887454_1888879_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_065533224.1\|1888890_1889904_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	6.0e-19	27.0
WP_191981131.1\|1889996_1891367_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.1e-136	53.5
WP_162859776.1\|1892337_1893672_+	site-specific DNA-methyltransferase	I7KLR2	Campylobacter_virus	6.7e-34	40.4
WP_113897355.1\|1894286_1896944_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_113897356.1\|1897648_1898050_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.5e-29	52.0
WP_113897601.1\|1898622_1898754_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_113897602.1\|1898970_1899156_-	hypothetical protein	NA	NA	NA	NA
WP_113897357.1\|1902864_1903098_-	hypothetical protein	NA	NA	NA	NA
WP_113897358.1\|1903197_1903497_+\|transposase	transposase	NA	NA	NA	NA
WP_113897359.1\|1904718_1905213_+	thiol peroxidase	NA	NA	NA	NA
WP_113897603.1\|1905700_1907083_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.1e-30	27.2
WP_050780398.1\|1907289_1907562_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_050780397.1\|1907552_1907909_+	hypothetical protein	NA	NA	NA	NA
WP_113897360.1\|1908045_1909902_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.5e-76	30.5
WP_003664466.1\|1909964_1910201_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_113897361.1\|1910193_1910739_+	DNA-binding protein	NA	NA	NA	NA
WP_113897362.1\|1910763_1911438_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_113897363.1\|1911443_1912772_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.2e-48	31.3
WP_003663607.1\|1913136_1914105_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897364.1\|1915234_1918780_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_113897365.1\|1918757_1919126_+	hypothetical protein	NA	NA	NA	NA
WP_113897366.1\|1919887_1920739_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.6e-27	29.0
WP_113897367.1\|1921032_1921347_+	multidrug transporter	NA	NA	NA	NA
WP_113897368.1\|1921402_1924180_+	DEAD/DEAH box helicase family protein	A0A2K9R7J3	Dishui_lake_phycodnavirus	3.9e-28	29.5
WP_029507439.1\|1925008_1925455_+	hypothetical protein	NA	NA	NA	NA
WP_113897604.1\|1925978_1926752_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_113897369.1\|1926886_1928068_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.8e-27	28.9
WP_113897370.1\|1928293_1929625_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.5e-28	27.3
WP_035154007.1\|1929768_1930251_+	GNAT family N-acetyltransferase	E9LUK4	Lactobacillus_phage	1.2e-25	43.8
WP_003663607.1\|1930368_1931337_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897371.1\|1931436_1931949_+	hydrophobic protein	NA	NA	NA	NA
WP_113897372.1\|1932691_1933132_+	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_113897373.1\|1933418_1933868_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.7e-32	50.8

DBSCAN-SWA_12

2040342 : 2084383

Staphylococcus_virus(25.0%)

tRNA,protease,integrase,transposase

attL 2072112:2072131|attR 2086427:2086446

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_056968813.1\|2040342_2042004_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	9.7e-99	40.0
WP_020843194.1\|2042178_2043027_-	aldo/keto reductase	NA	NA	NA	NA
WP_003664225.1\|2043159_2043591_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_113897435.1\|2043717_2045220_+	LytTR family transcriptional regulator	Q6DMX4	Streptococcus_phage	1.9e-32	27.0
WP_113897436.1\|2045219_2045663_+	hypothetical protein	NA	NA	NA	NA
WP_020843191.1\|2045686_2046211_-	DUF308 domain-containing protein	NA	NA	NA	NA
WP_003664220.1\|2046537_2046705_-	hypothetical protein	NA	NA	NA	NA
WP_113897437.1\|2046716_2047328_-	VanZ family protein	NA	NA	NA	NA
WP_113897438.1\|2047419_2048766_+	amino acid permease	NA	NA	NA	NA
WP_003664217.1\|2048797_2049253_-	transcriptional repressor	NA	NA	NA	NA
WP_113897439.1\|2049376_2050816_+	MFS transporter	NA	NA	NA	NA
WP_113897440.1\|2050890_2051430_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_003664212.1\|2051590_2052778_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.7e-148	67.7
WP_113897441.1\|2053099_2055520_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.7
WP_113897442.1\|2055582_2055846_+	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_113897443.1\|2055960_2057610_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_113897444.1\|2057673_2058534_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_113897445.1\|2058622_2060026_+	dipeptidase PepV	NA	NA	NA	NA
WP_081305735.1\|2060051_2060564_+	universal stress protein	NA	NA	NA	NA
WP_113897446.1\|2060652_2061696_+	glucosaminidase domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.5e-09	32.2
WP_113897447.1\|2061760_2062153_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162816324.1\|2062250_2063495_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_113896493.1\|2063603_2065265_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.5e-99	40.2
WP_003664204.1\|2065460_2066093_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	2.1e-46	46.4
WP_113897449.1\|2066308_2066917_+	hypothetical protein	NA	NA	NA	NA
WP_113897450.1\|2066998_2068015_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_113897451.1\|2068071_2068995_+	ribokinase	NA	NA	NA	NA
WP_113897452.1\|2069121_2069367_+	hypothetical protein	NA	NA	NA	NA
WP_113897453.1\|2069350_2070028_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003664194.1\|2070371_2070650_+	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_113897454.1\|2071146_2071329_-	hypothetical protein	NA	NA	NA	NA
WP_162859778.1\|2071330_2071507_-	hypothetical protein	NA	NA	NA	NA
2072112:2072131	attL	NA	NA	NA	NA
WP_113896493.1\|2072198_2073860_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.5e-99	40.2
WP_113897455.1\|2074261_2074441_-	hypothetical protein	NA	NA	NA	NA
WP_113897456.1\|2076254_2076656_-	hypothetical protein	NA	NA	NA	NA
WP_113897457.1\|2076676_2077078_-	hypothetical protein	NA	NA	NA	NA
WP_113897458.1\|2077098_2078106_-	hypothetical protein	NA	NA	NA	NA
WP_113897459.1\|2078105_2078576_-	hypothetical protein	NA	NA	NA	NA
WP_113897460.1\|2078566_2078851_-	hypothetical protein	NA	NA	NA	NA
WP_113897461.1\|2078843_2079119_-	hypothetical protein	NA	NA	NA	NA
WP_065532702.1\|2079290_2079605_-	hypothetical protein	NA	NA	NA	NA
WP_162859779.1\|2079618_2079756_-	hypothetical protein	NA	NA	NA	NA
WP_162816323.1\|2079799_2080075_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113897463.1\|2080092_2080713_-	Rha family transcriptional regulator	R9QNB1	Lactococcus_phage	2.2e-27	41.4
WP_113897464.1\|2080779_2081136_-	hypothetical protein	NA	NA	NA	NA
WP_113897465.1\|2081148_2081367_-	hypothetical protein	NA	NA	NA	NA
WP_113897466.1\|2081492_2082164_+	helix-turn-helix transcriptional regulator	L0P7E1	Lactobacillus_phage	2.5e-13	57.4
WP_113897467.1\|2082800_2083886_+\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	6.5e-88	48.5
WP_113897468.1\|2084026_2084383_-\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	1.8e-26	45.6
2086427:2086446	attR	NA	NA	NA	NA

DBSCAN-SWA_13

2128839 : 2189541

Bacillus_phage(17.65%)

tRNA,protease,integrase,transposase

attL 2140447:2140462|attR 2194282:2194297

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113897496.1\|2128839_2129487_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_113897497.1\|2129613_2130918_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_113897498.1\|2131009_2131723_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_035162055.1\|2131945_2132545_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113896496.1\|2132481_2133387_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_020843164.1\|2133441_2134116_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_113897499.1\|2134239_2136906_+	DNA polymerase I	F8WQ35	Bacillus_phage	9.5e-48	35.0
WP_113897500.1\|2136920_2137751_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.9e-26	28.8
WP_113897501.1\|2137754_2138354_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_113897502.1\|2138399_2138864_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_113897503.1\|2138881_2140237_+	DnaD domain protein	NA	NA	NA	NA
WP_113897504.1\|2140257_2141199_+	primosomal protein DnaI	S5MU12	Brevibacillus_phage	1.3e-28	35.1
2140447:2140462	attL	NA	NA	NA	NA
WP_003664107.1\|2141424_2141937_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.0e-11	29.2
WP_003664106.1\|2141959_2142157_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_003664105.1\|2142201_2142555_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_113897505.1\|2142707_2143238_+	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_019253098.1\|2143230_2144358_+	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
WP_003664099.1\|2144381_2144693_+	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_113897506.1\|2144714_2145359_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_102816573.1\|2145351_2145966_+	bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK	NA	NA	NA	NA
WP_003670865.1\|2145965_2146322_+	ribosome silencing factor	NA	NA	NA	NA
WP_113897507.1\|2146321_2147062_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_113897508.1\|2147073_2148207_+	nucleotidyltransferase	NA	NA	NA	NA
WP_003664093.1\|2148336_2148894_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_003664092.1\|2148948_2149128_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_113897509.1\|2149349_2150036_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-30	32.4
WP_003668473.1\|2150048_2151524_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.8e-25	32.1
WP_113897510.1\|2151712_2153206_+	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_113897511.1\|2153178_2154903_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.4e-99	40.2
WP_113897512.1\|2155122_2156502_-	MATE family efflux transporter	NA	NA	NA	NA
WP_113897513.1\|2156580_2156991_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	3.0e-09	38.0
WP_113897514.1\|2157054_2158005_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_113897515.1\|2158103_2158379_-	acylphosphatase	NA	NA	NA	NA
WP_113897516.1\|2158477_2159254_+	RNA methyltransferase	NA	NA	NA	NA
WP_003664081.1\|2159967_2160306_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_035156926.1\|2160599_2161646_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	9.0e-26	36.5
WP_113897517.1\|2161652_2164070_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_113897518.1\|2164255_2164894_+	C40 family peptidase	M9MUG9	Rhodococcus_phage	3.6e-09	33.3
WP_113897519.1\|2165005_2165662_+	uridine kinase	A0A1V0SAA3	Catovirus	2.1e-36	37.1
WP_003664064.1\|2165725_2166202_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_113896667.1\|2166348_2167680_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.3e-49	32.1
WP_113897520.1\|2167774_2169412_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.1e-97	39.1
WP_113897521.1\|2169645_2170035_+	heme biosynthesis protein HemY	NA	NA	NA	NA
WP_113897522.1\|2170102_2172718_-	YfhO family protein	NA	NA	NA	NA
WP_113897605.1\|2172968_2175026_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_003664049.1\|2175164_2175314_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_035156916.1\|2175451_2176006_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_113897523.1\|2176009_2176669_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_035156913.1\|2176675_2176915_+	YqgQ family protein	NA	NA	NA	NA
WP_003664041.1\|2176939_2177911_+	ROK family glucokinase	NA	NA	NA	NA
WP_003672480.1\|2177924_2178344_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_113897524.1\|2178933_2180316_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.1e-30	27.2
WP_003664039.1\|2180417_2180594_-	DUF3042 family protein	NA	NA	NA	NA
WP_035156911.1\|2180708_2181632_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003668435.1\|2181801_2183145_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_035156909.1\|2183389_2184895_+\|tRNA	glutamate--tRNA ligase	A0A2K9L0I5	Tupanvirus	1.3e-09	31.9
WP_113897525.1\|2185008_2186190_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_113897526.1\|2186871_2187723_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_063164476.1\|2188291_2188696_-	hypothetical protein	NA	NA	NA	NA
WP_113897527.1\|2188794_2189541_-\|integrase	site-specific integrase	Q37880	Lactobacillus_phage	3.4e-43	42.9
2194282:2194297	attR	NA	NA	NA	NA

DBSCAN-SWA_14

2195231 : 2255915

Lactobacillus_phage(31.58%)

protease,integrase,transposase

attL 2227701:2227760|attR 2244589:2246419

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113897533.1\|2195231_2196482_+\|transposase	transposase	A0A286QQE5	Streptococcus_phage	1.9e-54	36.5
WP_113897534.1\|2196678_2196867_+	hypothetical protein	NA	NA	NA	NA
WP_063164500.1\|2196893_2197331_+	hypothetical protein	NA	NA	NA	NA
WP_113897535.1\|2197361_2199374_+	hypothetical protein	NA	NA	NA	NA
WP_113897536.1\|2199455_2199638_+	hypothetical protein	NA	NA	NA	NA
WP_113897537.1\|2199874_2200225_-	hypothetical protein	NA	NA	NA	NA
WP_003663607.1\|2200549_2201518_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897538.1\|2201665_2201953_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_113897539.1\|2201939_2202209_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_113897540.1\|2202331_2202868_+	hypothetical protein	NA	NA	NA	NA
WP_162859781.1\|2202977_2203985_+	hypothetical protein	NA	NA	NA	NA
WP_113897542.1\|2204057_2205722_+	hypothetical protein	NA	NA	NA	NA
WP_113896496.1\|2205718_2206624_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.8e-07	24.6
WP_035162055.1\|2206560_2207160_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_113897543.1\|2207411_2209136_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.9e-81	36.6
WP_086118111.1\|2209159_2209456_+	hypothetical protein	NA	NA	NA	NA
WP_113897544.1\|2209557_2209875_+	hypothetical protein	NA	NA	NA	NA
WP_003663607.1\|2210039_2211008_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_113897545.1\|2211120_2213541_+	hypothetical protein	NA	NA	NA	NA
WP_113897546.1\|2213701_2214775_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_113897547.1\|2214879_2217819_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_113897548.1\|2217822_2220534_+	hypothetical protein	NA	NA	NA	NA
WP_086118391.1\|2220657_2221002_+	hypothetical protein	NA	NA	NA	NA
WP_113897549.1\|2220991_2221663_+	hypothetical protein	NA	NA	NA	NA
WP_113897550.1\|2221677_2223606_+	conjugal transfer protein	NA	NA	NA	NA
WP_086878936.1\|2223605_2223854_+	hypothetical protein	NA	NA	NA	NA
WP_086118394.1\|2223869_2225069_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	2.4e-27	46.5
WP_086878938.1\|2225087_2225666_+	hypothetical protein	NA	NA	NA	NA
WP_113897551.1\|2225667_2226309_+	hypothetical protein	NA	NA	NA	NA
WP_113897552.1\|2226318_2226999_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_113897553.1\|2227261_2227729_+\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	3.1e-18	37.0
2227701:2227760	attL	NA	NA	NA	NA
WP_113896493.1\|2227725_2229387_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.5e-99	40.2
WP_113897554.1\|2229931_2231206_+	hypothetical protein	NA	NA	NA	NA
WP_113897555.1\|2231265_2231862_+	hypothetical protein	NA	NA	NA	NA
WP_162859782.1\|2232026_2232224_+	hypothetical protein	NA	NA	NA	NA
WP_113897556.1\|2232282_2233053_+	Fic family protein	NA	NA	NA	NA
WP_113897557.1\|2233279_2233807_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_042746122.1\|2233809_2234124_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_016496718.1\|2234431_2235319_+	hypothetical protein	NA	NA	NA	NA
WP_113897558.1\|2235308_2236337_+	hypothetical protein	NA	NA	NA	NA
WP_113897559.1\|2236366_2236873_+	hypothetical protein	NA	NA	NA	NA
WP_113897560.1\|2236959_2238342_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-30	27.0
WP_003668419.1\|2239448_2240081_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003664009.1\|2240292_2240601_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_113897561.1\|2240616_2240940_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_019254008.1\|2240965_2241247_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_113897562.1\|2241336_2242449_-\|integrase	site-specific integrase	A0A1P8BMN3	Lactococcus_phage	4.5e-52	37.2
WP_113897563.1\|2242451_2242769_-	hypothetical protein	NA	NA	NA	NA
WP_113896493.1\|2242961_2244623_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.5e-99	40.2
WP_113897564.1\|2244664_2245219_-	SHOCT domain-containing protein	NA	NA	NA	NA
WP_113897565.1\|2245273_2245720_-	ImmA/IrrE family metallo-endopeptidase	A0A2P1JU12	Anoxybacillus_phage	3.2e-09	35.1
WP_113897566.1\|2245739_2246171_-	helix-turn-helix transcriptional regulator	A0A1C8E9A4	Bacillus_phage	3.6e-21	43.6
WP_113897567.1\|2246324_2246564_+	helix-turn-helix transcriptional regulator	A0A1B0Y2Q9	Lactobacillus_phage	4.4e-05	41.3
2244589:2246419	attR	NA	NA	NA	NA
WP_113897568.1\|2246560_2247289_+	Rha family transcriptional regulator	A0A0P0IDD0	Lactobacillus_phage	1.6e-29	37.6
WP_113897569.1\|2247313_2247667_+	hypothetical protein	NA	NA	NA	NA
WP_113897570.1\|2247796_2248003_+	DNA-binding protein	NA	NA	NA	NA
WP_113897571.1\|2248017_2248266_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_113897572.1\|2248243_2248429_+	hypothetical protein	NA	NA	NA	NA
WP_162816322.1\|2248462_2248615_+	hypothetical protein	NA	NA	NA	NA
WP_019253372.1\|2248674_2248896_+	hypothetical protein	NA	NA	NA	NA
WP_019253371.1\|2248897_2249485_+	host-nuclease inhibitor Gam family protein	NA	NA	NA	NA
WP_066035675.1\|2249484_2250258_+	ERF family protein	D6PSU1	Lactobacillus_phage	2.0e-43	59.9
WP_019253369.1\|2250269_2250932_+	hypothetical protein	U5U4M2	Lactobacillus_phage	6.4e-54	46.2
WP_113897573.1\|2250924_2251299_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	9.2e-42	63.3
WP_066035677.1\|2251311_2252118_+	conserved phage C-terminal domain-containing protein	Q8SDH3	Lactococcus_phage	5.2e-58	51.5
WP_113897574.1\|2252136_2252940_+	ATP-binding protein	B4XYS7	Lactobacillus_phage	3.3e-52	45.4
WP_162859783.1\|2252963_2253110_+	hypothetical protein	NA	NA	NA	NA
WP_066035678.1\|2253099_2253372_+	hypothetical protein	NA	NA	NA	NA
WP_135950863.1\|2253368_2253818_+	hypothetical protein	NA	NA	NA	NA
WP_113897575.1\|2253817_2254279_+	hypothetical protein	NA	NA	NA	NA
WP_113897576.1\|2254278_2254746_+	hypothetical protein	NA	NA	NA	NA
WP_019253361.1\|2254738_2254993_+	hypothetical protein	NA	NA	NA	NA
WP_019253360.1\|2255005_2255218_+	hypothetical protein	NA	NA	NA	NA
WP_113897577.1\|2255204_2255399_+	hypothetical protein	NA	NA	NA	NA
WP_029507471.1\|2255591_2255915_+	MazG-like family protein	A0A2K9VC24	Lactobacillus_phage	1.1e-19	50.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP029615

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection