CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	1 crisprs	WYL	2	1
NZ_CP031029	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-2, complete sequence	0 crisprs	NA	0	1
NZ_CP031027	Enterococcus faecalis strain TY1 isolate flatfish chromosome, complete genome	0 crisprs	csa3,cas3,cas14j,DinG,DEDDh	0	13

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031028_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031028_1

12152-12283

Orphan

Consensus_repeat	Method
GTTGGTTTTTCCCACTTTCGAACA	CRISPRCasFinder

2 spacers

WYL

The CRISPR arrays of NZ_CP031028_1

>merge|NZ_CP031028|1|12152-12283|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACAAAGTACTGGTATTATTGGATTCTTCTGGACGTTGGTTTTTCCCACTTTCGAAAGAAATGCCGATTTTATCATGTTTATCCGAAGGTTGGTTTTTCCCACTTTCGGGAA

>NZ_CP031028|1|1|12152-12283|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACA	AAGTACTGGTATTATTGGATTCTTCTGGAC
GTTGGTTTTTCCCACTTTCGAAAG	AAATGCCGATTTTATCATGTTTATCCGAAG
GTTGGTTTTTCCCACTTTCGGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031028.1\|WP_002383592.1\|10894_11563_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP031028.1\|WP_010708530.1\|10600_10852_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP031028.1\|WP_000933358.1\|19622_20372_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378937
NZ_CP031028.1\|WP_001096887.1\|6028_6823_+\|aminoglycoside-O-phosphotransferase-APH(3')-IIIa	unknown	unknown	gnl\|CDD\|270699
NZ_CP031028.1\|WP_114679443.1\|8963_9173_+\|peptide-binding-protein	unknown	unknown	gnl\|CDD\|311623
NZ_CP031028.1\|WP_010708525.1\|9463_9859_+\|zeta-toxin-family-protein	unknown	unknown	gnl\|CDD\|368892
NZ_CP031028.1\|WP_114679444.1\|14351_14642_-\|type-III-secretion-system-protein-PrgN	unknown	unknown	unknown
NZ_CP031028.1\|WP_000191454.1\|14665_15346_-\|IS6-like-element-ISEnfa1-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP031028.1\|WP_000191454.1\|17915_18596_+\|IS6-like-element-ISEnfa1-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP031028.1\|WP_000242080.1\|18792_19623_-\|undecaprenyl-diphosphate-phosphatase	unknown	unknown	gnl\|CDD\|234712
NZ_CP031028.1\|WP_002360663.1\|12966_13323_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031028.1\|WP_001015311.1\|9886_10567_+\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP031028.1\|WP_002334978.1\|7968_8865_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|366743
NZ_CP031028.1\|WP_012881081.1\|16408_16495_-\|type-I-toxin-antitoxin-system-Fst-family-toxin	unknown	unknown	unknown
NZ_CP031028.1\|WP_048951333.1\|15384_16032_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP031028.1\|WP_000627290.1\|5393_5936_+\|streptothricin-N-acetyltransferase-Sat4	unknown	unknown	gnl\|CDD\|366181
NZ_CP031028.1\|WP_001079938.1\|7098_7671_+\|HTH-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP031028.1\|WP_002369746.1\|13315_14098_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP031028.1\|WP_002331065.1\|9189_9462_+\|antitoxin	unknown	unknown	gnl\|CDD\|370234
NZ_CP031028.1\|WP_048951333.1\|17229_17877_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853

Protein	Function_ID	Function_description	E-value
NZ_CP031028.1\|WP_002383592.1\|10894_11563_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.62815e-13
NZ_CP031028.1\|WP_010708530.1\|10600_10852_-\|hypothetical-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.4221e-09
NZ_CP031028.1\|WP_000933358.1\|19622_20372_-\|ABC-transporter-permease	gnl\|CDD\|378937	pfam12730, ABC2_membrane_4, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	7.12632e-22
NZ_CP031028.1\|WP_001096887.1\|6028_6823_+\|aminoglycoside-O-phosphotransferase-APH(3')-IIIa	gnl\|CDD\|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	7.26961e-101
NZ_CP031028.1\|WP_010708525.1\|9463_9859_+\|zeta-toxin-family-protein	gnl\|CDD\|368892	pfam06414, Zeta_toxin, Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.	5.88359e-24
NZ_CP031028.1\|WP_000191454.1\|17915_18596_+\|IS6-like-element-ISEnfa1-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.02708e-90
NZ_CP031028.1\|WP_000191454.1\|14665_15346_-\|IS6-like-element-ISEnfa1-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.02708e-90
NZ_CP031028.1\|WP_000242080.1\|18792_19623_-\|undecaprenyl-diphosphate-phosphatase	gnl\|CDD\|234712	PRK00281, PRK00281, undecaprenyl-diphosphate phosphatase.	1.1504e-100
NZ_CP031028.1\|WP_001079938.1\|7098_7671_+\|HTH-domain-containing-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	5.30398e-39
NZ_CP031028.1\|WP_001015311.1\|9886_10567_+\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.15926e-92
NZ_CP031028.1\|WP_002334978.1\|7968_8865_+\|ParA-family-protein	gnl\|CDD\|366743	pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyze amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family.	1.86042e-45
NZ_CP031028.1\|WP_048951333.1\|15384_16032_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.06123e-87
NZ_CP031028.1\|WP_000627290.1\|5393_5936_+\|streptothricin-N-acetyltransferase-Sat4	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.87292e-21
NZ_CP031028.1\|WP_114679443.1\|8963_9173_+\|peptide-binding-protein	gnl\|CDD\|311623	pfam07764, Omega_Repress, Omega Transcriptional Repressor. The omega transcriptional repressor regulates expression of involved in copy number control and stable maintenance of plasmids. The omega protein belongs to the structural superfamily of MetJ/Arc repressors featuring a ribbon-helix-helix DNA-binding motif with the beta-ribbon located in and recognising the major groove of operator DNA.	1.6698e-34
NZ_CP031028.1\|WP_002369746.1\|13315_14098_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	2.16992e-71
NZ_CP031028.1\|WP_002331065.1\|9189_9462_+\|antitoxin	gnl\|CDD\|370234	pfam08998, Epsilon_antitox, Bacterial epsilon antitoxin. The epsilon antitoxin, produced by various prokaryotes, forms part of a postsegregational killing system which is involved in the initiation of programmed cell death of plasmid-free cells. The protein is folded into a three-helix bundle that directly interacts with the zeta toxin, inactivating it.	1.00207e-42
NZ_CP031028.1\|WP_048951333.1\|17229_17877_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.06123e-87

>NZ_CP031028.1|WP_002383592.1|10894_11563_-|CPBP-family-intramembrane-metalloprotease
MEYIKRFFIVIGLFLLSQIGMFTYGTLKQSSLQVGQGTMPLLSTLILIVIFIMNIGLLLVLANKLELLNFDSKFLNKKNILIIVIGVVIARLVAILGTILLNNQGIDSTANDAAINNLFTGENPLLIILILGISAPIMEEIVFRAGIIGYFLKDWPILGIALSSISFGLVHGPTDIISFFMYALIGLVLSIAYFKTSRLEVSILIHFFNNLIPAIVIAFGLI
>NZ_CP031028.1|WP_010708530.1|10600_10852_-|hypothetical-protein
MKKTEKILFLGFSALMFILIGCSNKDNLQENKKSSAVEQTANLTAATPIQSLDPATAVDQTSITLLANVMEGLYRLDGSVAKF
>NZ_CP031028.1|WP_001015311.1|9886_10567_+|IS6-like-element-IS1216-family-transposase
MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NZ_CP031028.1|WP_010708525.1|9463_9859_+|zeta-toxin-family-protein
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGFCCKVLNLLSNKVE
>NZ_CP031028.1|WP_002331065.1|9189_9462_+|antitoxin
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYSKQILNKEKVA
>NZ_CP031028.1|WP_114679443.1|8963_9173_+|peptide-binding-protein
MGNLGAQKAKRNDTPISAKKDIMGVKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
>NZ_CP031028.1|WP_002334978.1|7968_8865_+|ParA-family-protein
MIQYYYTKKEWGVVMEKEKLKILEELRRILNNKNEAIIILNNYFKGGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTFEVELPRVNFYEGLKNGNLASSIIHLTDNLDLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSATIKSNLEELYKEHKEDNLVFRNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYENVFFEMIERIIQLENEKE
>NZ_CP031028.1|WP_001079938.1|7098_7671_+|HTH-domain-containing-protein
MNRINRVTSILIQLQSKKIIPAKEIAQRFNISLRTVYRDIRTLEEAGIPIGSEAGKGYFLVEGFLLPPVMFTAAEVGALITAGKFLNCHGDESFIKDFDSAMYKIKSILKHGEKNYAQELENSINVYSTSGQKNTLADNVIAAIQTAICNKRVISIQYPASGGQEPESRMIEPISLGFYEQNWYLIGFAG
>NZ_CP031028.1|WP_001096887.1|6028_6823_+|aminoglycoside-O-phosphotransferase-APH(3')-IIIa
MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF
>NZ_CP031028.1|WP_000627290.1|5393_5936_+|streptothricin-N-acetyltransferase-Sat4
MITEMKAGHLKDIDKPSEPFEVIGKIIPRYENENWTFTELLYEAPYLKSYQDEEDEEDEEADCLEYIDNTDKIIYLYYQDDKCVGKVKLRKNWNRYAYIEDIAVCKDFRGQGIGSALINISIEWAKHKNLHGLMLETQDNNLIACKFYHNCGFKIGSVDTMLYANFENNFEKAVFWYLRF
>NZ_CP031028.1|WP_002360663.1|12966_13323_-|hypothetical-protein
MSNNRGKSAAERLLGAGKEDTNPTKATTSNEKELKTTHEHIVMNKKNIEKLIKQQGNSKRNADSIRINPILANALKYWTSIGEPEKSKPDVIEETLLKSIPEEYLIKGYEMAKKQNKI
>NZ_CP031028.1|WP_002369746.1|13315_14098_-|ParA-family-protein
MARIISVANQKGGVSKTTTSINLGAALHFTFNKSVLVIDMDPQGNATDNFGFDIDGTNVPTIYEVLKDEASITEAILNYKGIDVIPADIALSSAEREFTQVGSEHRLKRVLQPIEENYDYIIIDCPPSLGILTVNAFTVSDEIIIPVEAAYFSLKGLVKLNETIETVKEYTNESLIIRGVLFTKYNERFNISKEMNKTANQISDALHVNIFDTYIRRTITVDEAQAAGSDLISFNKTSTAEDDYIQFTKEFLEKVGDLNE
>NZ_CP031028.1|WP_114679444.1|14351_14642_-|type-III-secretion-system-protein-PrgN
MTFLRLCNRTNAYIIKHLGITVEEFCELHAFSQGTVSSWITRNKKIETLPISFIYSLSLSASKTMDQVYSDLLKLQDDYLLHLERHRRTKKIIDEE
>NZ_CP031028.1|WP_000191454.1|14665_15346_-|IS6-like-element-ISEnfa1-family-transposase
MTQFKGKQFQKDVIIVAVGYYLRYNLSYREVQEILYDRGIHVCHTTIYRWVQEYGKILYQIWKKKNKQSFYSWKMDETYIKIKGKWHYLYRAIDVDGLTLDIWLRKKRDTQAAYAFLKRLKNQFGEPKVLVTDKAPSIKSAFRKLQKNGLYITTEHRTIKYLNNLIEQDHRPIKRRNKFYQSLRTASTTIKGMEAIRGIYKKSRKEGSLFGFSVCTEIKGLLGIPA
>NZ_CP031028.1|WP_048951333.1|15384_16032_-|IS6-family-transposase
MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRGSVAKFPISSF
>NZ_CP031028.1|WP_012881081.1|16408_16495_-|type-I-toxin-antitoxin-system-Fst-family-toxin
MAEKLISLIIAPLLVGLVLLLVDRWLDD
>NZ_CP031028.1|WP_048951333.1|17229_17877_+|IS6-family-transposase
MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRGSVAKFPISSF
>NZ_CP031028.1|WP_000191454.1|17915_18596_+|IS6-like-element-ISEnfa1-family-transposase
MTQFKGKQFQKDVIIVAVGYYLRYNLSYREVQEILYDRGIHVCHTTIYRWVQEYGKILYQIWKKKNKQSFYSWKMDETYIKIKGKWHYLYRAIDVDGLTLDIWLRKKRDTQAAYAFLKRLKNQFGEPKVLVTDKAPSIKSAFRKLQKNGLYITTEHRTIKYLNNLIEQDHRPIKRRNKFYQSLRTASTTIKGMEAIRGIYKKSRKEGSLFGFSVCTEIKGLLGIPA
>NZ_CP031028.1|WP_000242080.1|18792_19623_-|undecaprenyl-diphosphate-phosphatase
MVLDFIEILKVIFLGIVEGITEWLPISSTGHMILADKFITLNMSEAFKEMFFVVIQLGAILAVVVMFWNKMFPFQLKDKSQPLVKKDTFSLWFKVAVACIPSGIMGILFDDYLDAYLQTPIVISIMLIFYGLLFILIENWNKKRTPTTMALSDISYKTAILIGAFQVLSLIPGTSRSGATIIGALLIGVSRVAAAEFTFFLAVPTMLGASAFKLLKFGFDFTSAELLALVLGMAVAFAVSVLVIKFLMNFIKKHDFKVFGWYRIVLGILVVLITVM
>NZ_CP031028.1|WP_000933358.1|19622_20372_-|ABC-transporter-permease
MLNLISCELLKLKRSKMVLISVAGVLSTPLLMLIEALQTHFDKPEIIFTLSDIYSDSVLYIMLLVNIMIYVAIAAYLFSREYTESTLKTILPIPISRTKLLIGKFCTLLLWIVMLTLVTWAGIFIACGLYHAVFTLEGYSLLVAIVWLPKFLFGSILMFLTVSPFVFVAMKTKGFVAPMIGSAVIVMGSAALSNQEWGALYPWTATYFLVQGKLQSTGYPTLLSVSIIILVSAVGFLMTFHHFKKEDLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5073-5102	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	602-631	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	515-544	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33709-33738	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	503-532	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	503-532	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5526-5555	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83505-83534	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9536-9565	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	827-856	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7643-7672	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66171-66200	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12176-12205	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60906-60935	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92754-92783	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43889-43918	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4944-4973	0	1.0
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7697-7726	0	1.0
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12230-12259	0	1.0
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60960-60989	0	1.0
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92808-92837	0	1.0
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	748-777	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43943-43972	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4998-5027	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	548-577	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	461-490	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33655-33684	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	449-478	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5472-5501	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83451-83480	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	773-802	1	0.967
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66225-66254	2	0.933
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	449-478	2	0.933
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	NC_023573	Staphylococcus phage phiSA012 DNA, complete genome	31963-31992	6	0.8
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	44093-44122	6	0.8
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	85626-85655	6	0.8
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	MT711976	Streptomyces phage Coruscant, complete genome	87401-87430	7	0.767
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	31080-31109	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP045813	Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence	22357-22386	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP041758	Bacillus sp. KBS0812 plasmid unnamed, complete sequence	54635-54664	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP010015	Bacillus sp. YP1 plasmid pBUYP1, complete sequence	19043-19072	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NC_021809	Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence	25434-25463	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP020103	Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence	16845-16874	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NC_015149	Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631	65777-65806	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP034485	Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence	65216-65245	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP045923	Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence	22456-22485	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP035412	Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence	75658-75687	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP028216	Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence	14293-14322	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP035398	Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence	81874-81903	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_CP030938	Bacillus sp. DM2 plasmid unnamed, complete sequence	50467-50496	8	0.733
NZ_CP031028_1	1.2\|12230\|30\|NZ_CP031028\|CRISPRCasFinder	12230-12259	30	NZ_AP019715	Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence	53778-53807	8	0.733
NZ_CP031028_1	1.1\|12176\|30\|NZ_CP031028\|CRISPRCasFinder	12176-12205	30	JQ660954	Clostridium phage PhiS63, complete genome	22890-22919	9	0.7

1. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

2. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

3. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

4. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

5. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

6. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

7. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

8. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

9. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

10. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

11. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

12. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

13. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

14. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

15. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

16. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

17. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

18. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

19. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

20. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

21. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

22. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.967

aagtactggtattattggattcttctggac	CRISPR spacer
aagtcctggtattattggattcttctggac	Protospacer
**** *************************

23. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

24. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

25. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

26. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

27. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

28. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

29. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

30. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

31. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

32. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.933

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
***.**.***********************

33. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
***.**.***********************

34. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to NC_023573 (Staphylococcus phage phiSA012 DNA, complete genome) position: , mismatch: 6, identity: 0.8

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattaaaggattcttcaaaat	Protospacer
**************  ********* ..*.

35. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.8

aaatgccgattttatcatgtttatccgaag---	CRISPR spacer
aaatgacgattttatcatcttta---gaaagca	Protospacer
***** ************ ****   ***.

36. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

aaatgccgattttatcatgtttatccgaag---	CRISPR spacer
aaatgacgattttatcatcttta---gaaagca	Protospacer
***** ************ ****   ***.

37. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to MT711976 (Streptomyces phage Coruscant, complete genome) position: , mismatch: 7, identity: 0.767

aagtactggtattattggattcttctggac	CRISPR spacer
acagagtggttttattggcttcttctggat	Protospacer
* . * **** ******* **********.

38. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

39. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP045813 (Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

40. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP041758 (Bacillus sp. KBS0812 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

41. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP010015 (Bacillus sp. YP1 plasmid pBUYP1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

42. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NC_021809 (Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

43. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP020103 (Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

44. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NC_015149 (Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

45. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP034485 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

46. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP045923 (Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

47. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP035412 (Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

48. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP028216 (Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

49. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP035398 (Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

50. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_CP030938 (Bacillus sp. DM2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

51. spacer 1.2|12230|30|NZ_CP031028|CRISPRCasFinder matches to NZ_AP019715 (Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

52. spacer 1.1|12176|30|NZ_CP031028|CRISPRCasFinder matches to JQ660954 (Clostridium phage PhiS63, complete genome) position: , mismatch: 9, identity: 0.7

aagtactggtattattggattcttctggac	CRISPR spacer
ttgtactgatattattggtttcttcgtttt	Protospacer
  ******.********* ******    .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

492 : 29252

Streptococcus_phage(85.0%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001038792.1\|492_1230_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_000567888.1\|2523_2769_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_000228166.1\|2871_3741_+	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000662263.1\|3721_4456_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_001255866.1\|4488_5397_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000627290.1\|5393_5936_+	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001096887.1\|6028_6823_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_001079938.1\|7098_7671_+	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	5.5e-102	99.5
WP_002334978.1\|7968_8865_+	ParA family protein	A0A1X9I765	Streptococcus_phage	9.0e-152	97.2
WP_114679443.1\|8963_9173_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	1.6e-30	97.1
WP_002331065.1\|9189_9462_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
WP_010708525.1\|9463_9859_+	zeta toxin family protein	NA	NA	NA	NA
WP_001015311.1\|9886_10567_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_010708530.1\|10600_10852_-	hypothetical protein	NA	NA	NA	NA
WP_002383592.1\|10894_11563_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002387529.1\|11693_12707_-	replication initiator protein A	NA	NA	NA	NA
WP_002360663.1\|12966_13323_-	hypothetical protein	NA	NA	NA	NA
WP_002369746.1\|13315_14098_-	ParA family protein	H7BUL8	unidentified_phage	3.8e-21	32.8
WP_114679444.1\|14351_14642_-	type III secretion system protein PrgN	NA	NA	NA	NA
WP_000191454.1\|14665_15346_-\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	3.7e-113	88.5
WP_048951333.1\|15384_16032_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-114	96.2
WP_012881081.1\|16408_16495_-	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_048951333.1\|17229_17877_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-114	96.2
WP_000191454.1\|17915_18596_+\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	3.7e-113	88.5
WP_000242080.1\|18792_19623_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_000933358.1\|19622_20372_-	ABC transporter permease	NA	NA	NA	NA
WP_002346952.1\|20364_21282_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-42	43.2
WP_000395511.1\|21464_22079_-	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	5.5e-07	46.8
WP_002387760.1\|22068_22395_-	DNA-binding protein	NA	NA	NA	NA
WP_001808810.1\|22431_22596_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000191454.1\|22634_23315_+\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	3.7e-113	88.5
WP_107196852.1\|23857_23944_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_002364281.1\|24462_24663_-	hypothetical protein	NA	NA	NA	NA
WP_085407408.1\|24751_26512_-	plasmid recombination protein	NA	NA	NA	NA
WP_002360723.1\|27208_27505_-	hypothetical protein	NA	NA	NA	NA
WP_002360724.1\|27631_28354_-	replication initiation protein	NA	NA	NA	NA
WP_000191454.1\|28571_29252_+\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	3.7e-113	88.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP031029

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

51096 : 58420

Streptococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001015311.1\|51096_51777_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_025193054.1\|51810_52155_-	protein rep	NA	NA	NA	NA
WP_001015311.1\|52560_53241_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000393259.1\|54258_54651_+	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	6.9e-72	100.0
WP_001028144.1\|54651_56091_+	aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A1X9I6C2	Streptococcus_phage	3.8e-285	100.0
WP_000195429.1\|56220_57393_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_001015311.1\|57739_58420_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP031027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

506615 : 598604

104

Enterococcus_phage(74.14%)

head,transposase,integrase,tail,tRNA,protease,holin,terminase,capsid

attL 506314:506335|attR 547871:547892

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
506314:506335	attL	NA	NA	NA	NA
WP_086281322.1\|506615_507797_-\|integrase	site-specific integrase	A0A126GGK4	Streptococcus_phage	1.6e-79	43.5
WP_114679335.1\|507906_508671_-	ImmA/IrrE family metallo-endopeptidase	A0A0A0YSF3	Streptococcus_phage	2.8e-21	34.6
WP_114679336.1\|508686_509040_-	helix-turn-helix transcriptional regulator	A0A1S5SC02	Streptococcus_phage	1.1e-20	44.6
WP_002370869.1\|509306_509483_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002370867.1\|509486_509774_+	hypothetical protein	NA	NA	NA	NA
WP_010830772.1\|509819_510554_+	phage antirepressor KilAC domain-containing protein	C9E2M3	Enterococcus_phage	8.1e-74	60.6
WP_002415146.1\|510698_510914_+	hypothetical protein	NA	NA	NA	NA
WP_114679337.1\|510897_511626_+	hypothetical protein	NA	NA	NA	NA
WP_114679338.1\|511762_511954_+	hypothetical protein	A0A0S2MYB0	Enterococcus_phage	2.8e-18	92.2
WP_114679339.1\|511974_512394_+	hypothetical protein	NA	NA	NA	NA
WP_002370860.1\|512377_512614_+	hypothetical protein	A0A0S2MYD6	Enterococcus_phage	2.4e-27	81.3
WP_114679340.1\|512614_513307_+	ERF family protein	Q6JM07	Lactococcus_phage	1.8e-22	44.0
WP_114679341.1\|513319_514213_+	DUF1351 domain-containing protein	A0A0S2MYB3	Enterococcus_phage	7.1e-48	43.0
WP_114679342.1\|514209_514890_+	hypothetical protein	A0A0S2MYA3	Enterococcus_phage	1.3e-121	92.9
WP_114679343.1\|514895_515381_+	hypothetical protein	A0A1C9LXV1	Streptococcus_phage	3.5e-33	47.3
WP_114679344.1\|515386_516343_+	phage replisome organizer N-terminal domain-containing protein	C9E2N2	Enterococcus_phage	1.5e-141	95.3
WP_010818749.1\|516342_516642_+	hypothetical protein	D2IZR4	Enterococcus_phage	1.0e-43	89.9
WP_114679345.1\|516663_517188_+	hypothetical protein	A0A0S2MYB8	Enterococcus_phage	1.2e-92	98.3
WP_010774467.1\|517314_517542_+	hypothetical protein	C9E2N4	Enterococcus_phage	1.0e-35	98.7
WP_016024375.1\|517598_518552_+	DNA cytosine methyltransferase	D2IZY5	Enterococcus_phage	9.2e-187	100.0
WP_016024376.1\|518557_518743_+	hypothetical protein	D2IZY6	Enterococcus_phage	2.1e-26	100.0
WP_016024377.1\|518936_519116_+	hypothetical protein	D2IZY7	Enterococcus_phage	1.2e-26	100.0
WP_016024378.1\|519099_519486_+	hypothetical protein	D2IZY8	Enterococcus_phage	7.5e-71	100.0
WP_016024379.1\|519482_519833_+	hypothetical protein	D2IZY9	Enterococcus_phage	6.0e-59	100.0
WP_016024380.1\|519832_519970_+	hypothetical protein	D2IZS3	Enterococcus_phage	2.8e-20	100.0
WP_016024381.1\|519966_520491_+	DUF1642 domain-containing protein	D2IZZ0	Enterococcus_phage	2.2e-97	100.0
WP_016024382.1\|520673_520874_+	hypothetical protein	D2IZZ2	Enterococcus_phage	9.3e-33	100.0
WP_016024383.1\|521018_521435_+	transcriptional regulator	D2IZZ3	Enterococcus_phage	5.8e-69	100.0
WP_016630622.1\|522252_522546_+	hypothetical protein	D2IZZ4	Enterococcus_phage	2.3e-40	100.0
WP_016024385.1\|522593_523928_+	DNA adenine methyltransferase	D2IZZ5	Enterococcus_phage	1.7e-255	100.0
WP_016024386.1\|523965_524157_+	hypothetical protein	D2IZZ6	Enterococcus_phage	1.1e-25	100.0
WP_016024387.1\|524292_524481_+	hypothetical protein	D2IZZ7	Enterococcus_phage	2.7e-26	100.0
WP_016024389.1\|524733_525177_+	hypothetical protein	D2IZZ9	Enterococcus_phage	3.7e-74	100.0
WP_114679348.1\|525225_526029_+\|terminase	small subunit of terminase	D2J000	Enterococcus_phage	1.6e-131	100.0
WP_002406139.1\|526000_527305_+\|terminase	PBSX family phage terminase large subunit	D2J001	Enterococcus_phage	7.7e-253	100.0
WP_016024394.1\|528725_529037_+\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	4.1e-51	100.0
WP_010821544.1\|529037_530186_+\|capsid	minor capsid protein	D2J004	Enterococcus_phage	4.9e-211	100.0
WP_002415687.1\|530328_530997_+	DUF4355 domain-containing protein	D2J005	Enterococcus_phage	2.4e-72	100.0
WP_010821546.1\|531012_532050_+	hypothetical protein	D2J006	Enterococcus_phage	6.5e-194	100.0
WP_002415688.1\|532063_532402_+\|head,tail	phage head-tail connector protein	D2J007	Enterococcus_phage	3.5e-56	100.0
WP_002406131.1\|532382_532724_+	hypothetical protein	D2J008	Enterococcus_phage	1.8e-60	100.0
WP_016024395.1\|532723_533263_+	hypothetical protein	D2J009	Enterococcus_phage	5.5e-96	100.0
WP_002415689.1\|533259_533622_+	hypothetical protein	D2J010	Enterococcus_phage	1.9e-60	100.0
WP_016024396.1\|533641_534100_+	hypothetical protein	D2J011	Enterococcus_phage	9.5e-81	100.0
WP_002406126.1\|534156_534567_+	hypothetical protein	D2J012	Enterococcus_phage	1.3e-68	100.0
WP_002406125.1\|534599_534959_+	hypothetical protein	D2J013	Enterococcus_phage	3.8e-61	100.0
WP_114679439.1\|534974_539504_+	transglycosylase SLT domain-containing protein	D2J014	Enterococcus_phage	0.0e+00	99.9
WP_010821551.1\|539514_539880_+	hypothetical protein	D2J015	Enterococcus_phage	9.9e-65	100.0
WP_016024398.1\|539896_542314_+\|tail	PblB-like tail protein	D2J016	Enterococcus_phage	0.0e+00	100.0
WP_002406119.1\|542473_543496_+	hypothetical protein	D2J018	Enterococcus_phage	3.4e-195	100.0
WP_002406118.1\|543575_543797_+	hypothetical protein	D2J019	Enterococcus_phage	6.0e-33	100.0
WP_002406117.1\|543789_544026_+\|holin	phage holin	D2J020	Enterococcus_phage	6.2e-36	100.0
WP_114679349.1\|544022_545282_+	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	1.0e-225	91.4
WP_114679350.1\|545328_545592_-	hypothetical protein	NA	NA	NA	NA
WP_114679352.1\|546314_546800_+	hypothetical protein	NA	NA	NA	NA
WP_070416175.1\|547063_547639_-	SHOCT domain-containing protein	X5JB37	Clostridium_phage	5.8e-19	39.1
WP_002355504.1\|548034_548268_+	hypothetical protein	NA	NA	NA	NA
547871:547892	attR	NA	NA	NA	NA
WP_002358657.1\|548432_548840_-	hypothetical protein	NA	NA	NA	NA
WP_010713561.1\|548912_549593_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	3.4e-127	99.1
WP_002355428.1\|549734_550709_+	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	2.1e-24	31.6
WP_002358658.1\|551152_551347_+	hypothetical protein	NA	NA	NA	NA
WP_002358659.1\|551359_551989_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.4e-100	78.3
WP_002358660.1\|552020_552206_-	hypothetical protein	NA	NA	NA	NA
WP_002358661.1\|552235_552565_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002335374.1\|552692_553631_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002358662.1\|553656_554694_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002358664.1\|556043_556316_+	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_002404695.1\|557384_558200_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002358667.1\|558286_560158_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002358669.1\|560179_561640_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_010713561.1\|561741_562422_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	3.4e-127	99.1
WP_002358670.1\|562823_563777_+	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	4.6e-13	30.1
WP_002355507.1\|563777_565295_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_002355509.1\|565436_565892_+	arginine repressor	NA	NA	NA	NA
WP_002398142.1\|565925_567434_+	phosphoglucomutase	NA	NA	NA	NA
WP_002358673.1\|567457_568012_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010708282.1\|568136_568988_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002358675.1\|569342_571529_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_002355518.1\|571591_571933_+	YlbF family regulator	A0A1X9I5Y8	Streptococcus_phage	2.5e-09	34.9
WP_002355519.1\|572088_573324_+	DNA repair exonuclease	NA	NA	NA	NA
WP_002358676.1\|573320_576032_+	AAA family ATPase	NA	NA	NA	NA
WP_002355522.1\|576028_576973_+	HD domain-containing protein	NA	NA	NA	NA
WP_002355524.1\|577012_578041_-	foldase	NA	NA	NA	NA
WP_002355526.1\|578204_578549_-	YtxH domain-containing protein	NA	NA	NA	NA
WP_002358677.1\|578549_578975_-	HIT family protein	NA	NA	NA	NA
WP_002363160.1\|579190_579928_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-27	29.8
WP_002358678.1\|579929_581141_+	ABC transporter permease	NA	NA	NA	NA
WP_002355531.1\|581269_582049_+	phosphotransferase family protein	NA	NA	NA	NA
WP_002355532.1\|582121_582766_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_002363162.1\|582825_583572_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002355534.1\|583750_584677_+	1-phosphofructokinase	NA	NA	NA	NA
WP_002355535.1\|584681_586100_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002358680.1\|586126_586588_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002358681.1\|586584_587562_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002355538.1\|587750_588284_+	DUF402 domain-containing protein	NA	NA	NA	NA
WP_002358682.1\|588371_588803_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002384914.1\|588878_590093_+	AI-2E family transporter	NA	NA	NA	NA
WP_002363168.1\|590267_591647_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002355543.1\|591820_593395_+	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	2.7e-34	26.1
WP_002355544.1\|593569_594013_+	DUF3290 domain-containing protein	NA	NA	NA	NA
WP_002355545.1\|594028_594676_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_002358683.1\|594742_595813_+	hypothetical protein	NA	NA	NA	NA
WP_002355547.1\|595854_596169_-	DUF1827 family protein	NA	NA	NA	NA
WP_002386935.1\|596363_598604_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	6.6e-127	39.9

DBSCAN-SWA_2

814075 : 821995

Planktothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002355794.1\|814075_815134_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.1
WP_114679359.1\|815133_816090_+	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	3.2e-06	23.9
WP_002355796.1\|816130_817201_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	7.6e-89	49.0
WP_002355797.1\|817600_818122_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.0e-14	33.3
WP_002355798.1\|818235_818436_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002355799.1\|818496_818856_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002425711.1\|818901_819282_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_002358829.1\|819349_819709_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_002368164.1\|819776_820271_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002361365.1\|820288_820804_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	7.7e-39	48.8
WP_002358831.1\|820819_821995_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.5e-85	47.7

DBSCAN-SWA_3

851171 : 914871

Enterococcus_phage(42.5%)

portal,head,integrase,tail,tRNA,protease,holin,plate,terminase,capsid

attL 868026:868053|attR 905355:905382

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002396467.1\|851171_851666_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_002358858.1\|851658_852180_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002355840.1\|852349_852559_+	hypothetical protein	NA	NA	NA	NA
WP_002358859.1\|852632_853643_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002404478.1\|853666_854674_-	galactose mutarotase	NA	NA	NA	NA
WP_002355844.1\|854663_855332_-	beta-phosphoglucomutase	A0A1D8KNV9	Synechococcus_phage	8.6e-06	24.6
WP_010708306.1\|855324_857619_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002358862.1\|857899_860068_+	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	7.3e-06	37.2
WP_002358863.1\|860133_860958_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_002358864.1\|861017_861833_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	5.5e-23	29.5
WP_002358865.1\|861958_862921_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002358867.1\|862901_863201_+	hypothetical protein	NA	NA	NA	NA
WP_002358868.1\|863193_863508_+	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_002404475.1\|863662_864343_-	peptide ABC transporter permease	NA	NA	NA	NA
WP_025186153.1\|864381_865023_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_002358871.1\|865024_865174_-	hypothetical protein	NA	NA	NA	NA
WP_002358872.1\|865520_866297_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002355866.1\|867068_867377_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_002358874.1\|867409_867754_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_002355868.1\|867766_868054_+	50S ribosomal protein L27	NA	NA	NA	NA
868026:868053	attL	NA	NA	NA	NA
WP_010784379.1\|868141_869296_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.2e-65	36.1
WP_002403734.1\|869364_869934_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_010784380.1\|870114_870543_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_010716842.1\|870560_870974_-	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	3.6e-31	53.2
WP_002406956.1\|871206_871416_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002406954.1\|871419_871704_+	hypothetical protein	NA	NA	NA	NA
WP_049093909.1\|871717_872440_+	ORF6C domain-containing protein	D2IYT0	Enterococcus_phage	1.9e-43	64.0
WP_002364224.1\|872479_872662_-	YegP family protein	NA	NA	NA	NA
WP_002364223.1\|872714_872909_+	hypothetical protein	D2IZ57	Enterococcus_phage	1.9e-27	90.6
WP_002364222.1\|872899_873085_+	hypothetical protein	D2IZ58	Enterococcus_phage	3.6e-23	94.7
WP_002380444.1\|873128_873452_+	hypothetical protein	D2IYT5	Enterococcus_phage	7.7e-45	86.9
WP_002364220.1\|873451_873679_+	hypothetical protein	D2IZX4	Enterococcus_phage	8.6e-35	97.3
WP_002364219.1\|873776_874718_+	YqaJ viral recombinase family protein	D2IZK1	Enterococcus_phage	3.8e-177	99.7
WP_002364218.1\|874720_875611_+	recombinase RecT	D2IYT9	Enterococcus_phage	1.3e-163	100.0
WP_002372048.1\|875624_876587_+	DUF4373 domain-containing protein	D2IZR2	Enterococcus_phage	3.0e-169	100.0
WP_002368214.1\|876590_876893_+	hypothetical protein	D2IZR3	Enterococcus_phage	1.6e-47	99.0
WP_002372047.1\|876893_877193_+	hypothetical protein	D2IZY1	Enterococcus_phage	1.3e-43	90.9
WP_002372046.1\|877201_877636_+	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	1.1e-57	80.0
WP_002372045.1\|878542_878959_+	autolysin	D2IZL7	Enterococcus_phage	1.6e-66	97.1
WP_114679360.1\|881056_881287_+	hypothetical protein	NA	NA	NA	NA
WP_010708333.1\|881317_881494_+	hypothetical protein	NA	NA	NA	NA
WP_010708334.1\|881511_881838_+	hypothetical protein	C5J957	Streptococcus_phage	3.7e-31	65.9
WP_010708335.1\|882027_882387_+\|terminase	P27 family phage terminase small subunit	A0A0U4JV93	Exiguobacterium_phage	9.9e-17	48.5
WP_010708336.1\|882391_884179_+\|terminase	terminase large subunit	Q9AZY8	Lactococcus_phage	2.6e-219	64.2
WP_025189047.1\|884189_885410_+\|portal	phage portal protein	Q0H263	Geobacillus_phage	2.7e-138	59.6
WP_010708338.1\|885406_885988_+\|head,protease	HK97 family phage prohead protease	Q0H262	Geobacillus_phage	7.6e-67	67.9
WP_010708339.1\|885990_887259_+\|capsid	phage major capsid protein	Q0H261	Geobacillus_phage	1.3e-92	54.8
WP_010708340.1\|887261_887405_+	hypothetical protein	NA	NA	NA	NA
WP_010708341.1\|887431_887707_+\|head,tail	phage head-tail connector protein	Q9AZY3	Lactococcus_phage	9.6e-12	44.4
WP_010708342.1\|887699_888020_+\|head	phage head closure protein	Q9AZY2	Lactococcus_phage	1.1e-19	46.9
WP_174222122.1\|888006_888393_+	HK97 gp10 family phage protein	A0A1S5SFC4	Streptococcus_phage	6.0e-20	51.8
WP_010708344.1\|888395_888713_+	hypothetical protein	Q9AZY0	Lactococcus_phage	1.8e-25	56.2
WP_010708345.1\|888729_889329_+\|tail	phi13 family phage major tail protein	Q9AZX9	Lactococcus_phage	1.8e-71	68.6
WP_114679361.1\|889331_889697_+	hypothetical protein	Q9AZX8	Lactococcus_phage	5.5e-39	67.2
WP_077143655.1\|889701_889905_+	hypothetical protein	NA	NA	NA	NA
WP_010708348.1\|889920_892443_+\|tail	phage tail tape measure protein	Q9AZX7	Lactococcus_phage	3.6e-89	32.3
WP_010708349.1\|892447_893197_+	hypothetical protein	Q9AZX6	Lactococcus_phage	1.1e-89	60.6
WP_010784389.1\|893193_895992_+\|tail	phage tail protein	Q9AZX5	Lactococcus_phage	3.4e-197	48.1
WP_002404576.1\|896010_896892_+\|plate	phage baseplate upper protein	Q9AYV5	Lactococcus_phage	4.0e-11	26.6
WP_002404577.1\|896884_897481_+	hypothetical protein	NA	NA	NA	NA
WP_002404578.1\|897477_897765_+	hypothetical protein	NA	NA	NA	NA
WP_002404579.1\|897764_898292_+	hypothetical protein	NA	NA	NA	NA
WP_002404580.1\|898310_898685_+	hypothetical protein	NA	NA	NA	NA
WP_002404581.1\|898684_898822_+	XkdX family protein	NA	NA	NA	NA
WP_010815473.1\|898855_899077_+	hypothetical protein	D2J019	Enterococcus_phage	3.9e-32	95.9
WP_002384371.1\|899069_899303_+\|holin	phage holin	D2J020	Enterococcus_phage	1.9e-29	87.8
WP_002394567.1\|899303_900545_+	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	8.9e-174	73.3
WP_002357053.1\|901381_901582_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-24	80.3
WP_002364188.1\|901653_901905_+	hypothetical protein	NA	NA	NA	NA
WP_002382622.1\|902719_902926_+	hypothetical protein	NA	NA	NA	NA
WP_002382623.1\|902892_903951_-	hypothetical protein	NA	NA	NA	NA
WP_162781809.1\|904638_904890_+	hypothetical protein	NA	NA	NA	NA
WP_002363390.1\|904910_905162_-	hypothetical protein	A0A097BYB1	Enterococcus_phage	4.6e-21	66.2
WP_002358876.1\|905582_906035_+	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
905355:905382	attR	NA	NA	NA	NA
WP_002355870.1\|906105_906921_-	metallophosphoesterase	NA	NA	NA	NA
WP_002391500.1\|907092_908157_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_002355872.1\|908170_908491_+	hypothetical protein	NA	NA	NA	NA
WP_002355874.1\|908823_909255_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002355875.1\|909247_909700_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_002355876.1\|909803_910649_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	9.7e-39	36.7
WP_002358878.1\|910658_912005_+	exodeoxyribonuclease VII large subunit	A0A160DEV2	Gordonia_phage	1.0e-29	32.8
WP_002355878.1\|912006_912237_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_002355879.1\|912236_913118_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_002355880.1\|913131_913947_+	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_002358879.1\|914361_914871_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

1219153 : 1236834

Enterococcus_phage(46.15%)

holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002360498.1\|1219153_1221550_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.9e-19	23.8
WP_002360497.1\|1221574_1221925_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002382232.1\|1222207_1222693_-	toxin	A0A097BY56	Enterococcus_phage	4.4e-60	70.5
WP_002360496.1\|1222727_1223210_-	helix-turn-helix domain-containing protein	R9QTP6	Staphylococcus_phage	2.6e-20	47.7
WP_002404499.1\|1223606_1224362_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	8.7e-31	56.0
WP_002384644.1\|1224380_1225223_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	5.7e-31	31.0
WP_002360492.1\|1225289_1225682_+	hypothetical protein	NA	NA	NA	NA
WP_002360491.1\|1225701_1226109_+	RinA family phage transcriptional activator	NA	NA	NA	NA
WP_002382237.1\|1226330_1226747_+	hypothetical protein	NA	NA	NA	NA
WP_114679366.1\|1226759_1227272_+\|tail	phage major tail protein, TP901-1 family	W6LP72	Streptococcus_phage	5.2e-35	49.4
WP_002357848.1\|1227304_1227664_+	hypothetical protein	A0A0F6N4J9	Staphylococcus_phage	7.6e-09	32.2
WP_002382238.1\|1227756_1228050_+	hypothetical protein	NA	NA	NA	NA
WP_002404500.1\|1228039_1230973_+	membrane protein	A0A1U9WR55	Streptococcus_virus	2.5e-09	25.0
WP_002360484.1\|1230974_1231901_+\|tail	phage tail family protein	C9E2K5	Enterococcus_phage	1.2e-146	78.6
WP_002360481.1\|1231913_1233371_+\|tail	phage tail protein	C9E2K6	Enterococcus_phage	4.2e-175	47.7
WP_002360478.1\|1233403_1235173_+	hypothetical protein	A0A097BYA8	Enterococcus_phage	9.8e-142	71.8
WP_002357842.1\|1235196_1235592_+\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	2.8e-33	48.9
WP_002404501.1\|1235736_1236834_+	SH3 domain-containing protein	A0A139ZVY1	Enterococcus_phage	4.0e-77	44.6

DBSCAN-SWA_5

1700944 : 1741076

Streptococcus_phage(56.25%)

transposase,integrase

attL 1710156:1710180|attR 1715222:1715246

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002360098.1\|1700944_1702123_-\|integrase	site-specific integrase	S6C485	Thermus_phage	2.0e-29	30.3
WP_002297662.1\|1702225_1702537_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002360096.1\|1702885_1703131_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297668.1\|1703124_1703526_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_010708157.1\|1706090_1707353_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002360092.1\|1707490_1707715_+	hypothetical protein	NA	NA	NA	NA
WP_002298159.1\|1707711_1707876_+	hypothetical protein	NA	NA	NA	NA
WP_002298157.1\|1707969_1709262_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-31	40.4
WP_010708156.1\|1709535_1709796_-	hypothetical protein	NA	NA	NA	NA
1710156:1710180	attL	NA	NA	NA	NA
WP_101495273.1\|1710400_1711562_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.0e-79	51.3
WP_077497620.1\|1711634_1711841_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	2.0e-06	53.3
WP_002383094.1\|1711844_1711958_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_002297874.1\|1712110_1712506_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_002287875.1\|1712518_1713367_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_002287874.1\|1713381_1714209_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	M4QNT1	Ostreococcus_lucimarinus_virus	5.4e-50	38.0
WP_002349114.1\|1714220_1715081_-	Rossmann-like and DUF2520 domain-containing protein	NA	NA	NA	NA
WP_010708154.1\|1716813_1718133_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
1715222:1715246	attR	NA	NA	NA	NA
WP_002285815.1\|1718129_1718783_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002330916.1\|1720353_1721730_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|1721729_1722386_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_010706480.1\|1724499_1724850_-	hypothetical protein	NA	NA	NA	NA
WP_002369219.1\|1725154_1725442_+	hypothetical protein	NA	NA	NA	NA
WP_002360081.1\|1725442_1725670_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_114679375.1\|1725740_1726931_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002298830.1\|1727965_1728970_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	1.4e-121	66.3
WP_002384404.1\|1728966_1731090_-\|transposase	transposase	A0A1S5SF30	Streptococcus_phage	2.4e-174	58.7
WP_002330910.1\|1731094_1733542_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.4
WP_002298826.1\|1733528_1733918_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	2.5e-42	66.7
WP_002383098.1\|1733969_1734710_+	hypothetical protein	NA	NA	NA	NA
WP_002360078.1\|1734716_1735553_-	abortive infection family protein	NA	NA	NA	NA
WP_002298823.1\|1735617_1736121_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	3.1e-56	61.2
WP_002298822.1\|1736133_1736355_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002360077.1\|1736751_1738002_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	6.1e-114	62.1
WP_002330905.1\|1738133_1738268_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002360076.1\|1738264_1739449_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	1.0e-142	62.1
WP_002298811.1\|1739797_1739965_-	hypothetical protein	NA	NA	NA	NA
WP_002298807.1\|1740719_1741076_-	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	2.0e-49	80.5

DBSCAN-SWA_6

1870716 : 1882056

Enterococcus_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002359997.1\|1870716_1871787_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.8e-29	34.7
WP_002359996.1\|1873144_1873393_+	hypothetical protein	A0A097BYB1	Enterococcus_phage	6.1e-34	91.5
WP_002399566.1\|1873411_1874410_-	Abi family protein	A0A059NT88	Lactococcus_phage	1.0e-79	43.5
WP_002399567.1\|1875190_1876192_-	endolysin	F0PIJ7	Enterococcus_phage	1.9e-86	68.4
WP_002359993.1\|1876163_1876442_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_002359992.1\|1876441_1876696_-	hypothetical protein	NA	NA	NA	NA
WP_002359991.1\|1876708_1877128_-	XkdX family protein	F0PIJ5	Enterococcus_phage	1.1e-56	85.4
WP_114679382.1\|1877115_1878303_-	collagen-like protein	F0PIJ4	Enterococcus_phage	8.8e-62	65.4
WP_002359989.1\|1878289_1878778_-	hypothetical protein	A0A1W6JI16	Lactococcus_phage	8.4e-35	46.0
WP_002359987.1\|1878790_1879483_-	hypothetical protein	NA	NA	NA	NA
WP_002359986.1\|1879479_1882056_-	endolysin	A0A1B1IM47	Lactococcus_phage	1.3e-30	46.6

DBSCAN-SWA_7

1900326 : 1913541

Enterococcus_phage(58.82%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002415447.1\|1900326_1900746_-	hypothetical protein	A0A2H4J1L3	uncultured_Caudovirales_phage	4.7e-18	51.0
WP_010708137.1\|1900735_1901932_-	ParB N-terminal domain-containing protein	Q708N6	Streptococcus_phage	1.8e-110	51.1
WP_002393643.1\|1902339_1902765_-	ArpU family transcriptional regulator	D2IYV6	Enterococcus_phage	9.9e-24	42.3
WP_010708136.1\|1903063_1903264_-	hypothetical protein	D2IYV2	Enterococcus_phage	2.4e-28	89.4
WP_010708135.1\|1903264_1903750_-	hypothetical protein	C9E2P0	Enterococcus_phage	1.7e-88	98.1
WP_010708134.1\|1903746_1904271_-	DUF1642 domain-containing protein	D2IZZ0	Enterococcus_phage	2.4e-35	51.1
WP_010708133.1\|1904252_1904609_-	DUF5406 family protein	F0PIH7	Enterococcus_phage	5.3e-47	78.4
WP_010708132.1\|1904605_1904872_-	hypothetical protein	A0A059T7S7	Listeria_phage	4.4e-14	48.3
WP_010708131.1\|1905342_1905486_-	hypothetical protein	D2IYU4	Enterococcus_phage	3.4e-13	85.1
WP_010708130.1\|1905478_1906114_-	DUF2187 domain-containing protein	D2IZY3	Enterococcus_phage	2.3e-69	89.2
WP_010708129.1\|1906127_1906460_-	hypothetical protein	A0A0S2MYB8	Enterococcus_phage	8.0e-21	55.7
WP_002399588.1\|1906456_1906882_-	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	1.2e-58	80.4
WP_114679385.1\|1906890_1907760_-	ATP-binding protein	U5PWH5	Bacillus_phage	3.6e-20	29.1
WP_114679386.1\|1907773_1908640_-	DUF4373 domain-containing protein	D2IZY0	Enterococcus_phage	2.8e-49	46.3
WP_029656691.1\|1908653_1909472_-	PD-(D/E)XK nuclease-like domain-containing protein	J7KGZ1	Streptococcus_phage	1.9e-63	50.8
WP_002393136.1\|1909431_1910355_-	recombinase RecT	A0A1S5S8V5	Streptococcus_phage	1.2e-66	53.6
WP_002359951.1\|1910344_1910677_-	hypothetical protein	NA	NA	NA	NA
WP_010708125.1\|1910707_1910998_-	hypothetical protein	NA	NA	NA	NA
WP_010708124.1\|1911082_1911409_-	hypothetical protein	NA	NA	NA	NA
WP_002380498.1\|1911409_1911619_-	hypothetical protein	NA	NA	NA	NA
WP_002393142.1\|1911761_1911995_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002393143.1\|1912027_1912555_-	hypothetical protein	NA	NA	NA	NA
WP_010708122.1\|1912612_1912786_-	hypothetical protein	NA	NA	NA	NA
WP_010708121.1\|1912825_1913011_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010708120.1\|1913163_1913541_+	helix-turn-helix transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	1.2e-12	37.0

DBSCAN-SWA_8

2064959 : 2075970

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002359823.1\|2064959_2065982_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	3.6e-120	65.4
WP_002383559.1\|2065978_2068093_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	7.0e-179	60.5
WP_002359821.1\|2068098_2070546_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.0
WP_002359820.1\|2070532_2070922_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.8e-43	68.3
WP_002359819.1\|2070998_2071613_+	hypothetical protein	NA	NA	NA	NA
WP_002359818.1\|2071628_2072201_+	hypothetical protein	NA	NA	NA	NA
WP_002359817.1\|2072233_2072734_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	6.8e-48	56.1
WP_002298822.1\|2072746_2072968_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002359816.1\|2072972_2073110_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002359815.1\|2073106_2074291_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	8.0e-140	61.1
WP_002359814.1\|2074547_2074802_-	hypothetical protein	NA	NA	NA	NA
WP_077143702.1\|2074827_2075970_-	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.4e-120	59.7

DBSCAN-SWA_9

2390432 : 2437662

Enterococcus_phage(37.14%)

portal,tail,tRNA,protease,holin,terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002359567.1\|2390432_2390939_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_002359566.1\|2391250_2392096_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002359565.1\|2392225_2392855_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002362548.1\|2392972_2394334_-	magnesium transporter	NA	NA	NA	NA
WP_002359563.1\|2394364_2395258_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002356486.1\|2395265_2396063_-	NAD kinase	NA	NA	NA	NA
WP_002381475.1\|2396075_2396780_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_002356483.1\|2396946_2397525_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_002359562.1\|2397588_2398248_+	DsbA family protein	NA	NA	NA	NA
WP_002404853.1\|2398530_2399226_-	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	7.6e-05	42.3
WP_002356480.1\|2399440_2401252_-	oligoendopeptidase F	NA	NA	NA	NA
WP_002359560.1\|2401299_2402484_-	competence protein ComA	NA	NA	NA	NA
WP_002356478.1\|2402572_2403235_-	adaptor protein MecA	NA	NA	NA	NA
WP_002356477.1\|2403577_2403976_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_002359559.1\|2404335_2405346_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_002359558.1\|2405388_2406726_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.0e-47	32.5
WP_002359557.1\|2406834_2407083_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	2.9e-36	97.6
WP_002359555.1\|2407238_2407907_-	hypothetical protein	NA	NA	NA	NA
WP_002359554.1\|2407911_2408289_-	hypothetical protein	NA	NA	NA	NA
WP_025186173.1\|2408272_2409121_-	ParA family protein	A0A1X9IGI7	Lactococcus_phage	2.6e-31	38.4
WP_002404849.1\|2409303_2410410_-	SH3 domain-containing protein	V5URN7	Enterococcus_phage	1.2e-84	47.7
WP_002358058.1\|2410463_2410862_-\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	1.6e-36	54.2
WP_114679394.1\|2410911_2411715_-	hypothetical protein	D2IYX9	Enterococcus_phage	5.9e-118	83.1
WP_085406754.1\|2411726_2412782_-	structural protein	D2J073	Enterococcus_phage	6.9e-50	37.2
WP_086328916.1\|2412792_2413917_-	siphovirus ReqiPepy6 Gp37-like family protein	Q77MU2	Lactococcus_phage	2.0e-87	45.3
WP_002371567.1\|2413919_2414819_-\|tail	phage tail family protein	D2J071	Enterococcus_phage	2.9e-49	37.4
WP_085408020.1\|2414818_2419570_-\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	7.2e-14	43.0
WP_002358069.1\|2419791_2420139_-	hypothetical protein	NA	NA	NA	NA
WP_002396881.1\|2420195_2420669_-	Ig domain-containing protein	A0A1D6Z291	Staphylococcus_phage	7.9e-22	44.4
WP_002358071.1\|2420742_2421336_-\|tail	tail protein	A0A060AKE9	Staphylococcus_phage	2.6e-22	35.1
WP_114679395.1\|2421368_2421764_-	hypothetical protein	A8ATA3	Listeria_phage	9.8e-18	45.0
WP_002359539.1\|2421760_2422153_-	hypothetical protein	A0A1S5SF89	Streptococcus_phage	1.3e-09	38.5
WP_002404844.1\|2422149_2422524_-	hypothetical protein	A8ATA1	Listeria_phage	1.5e-28	52.1
WP_002359536.1\|2422510_2422816_-	hypothetical protein	A0A0U4K528	Bacillus_phage	2.2e-09	47.5
WP_002359535.1\|2422893_2424039_-\|capsid	phage major capsid protein	A8AT98	Listeria_phage	2.1e-116	56.5
WP_174222124.1\|2424065_2424833_-\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	2.6e-54	50.4
WP_002359533.1\|2424810_2425986_-\|portal	phage portal protein	A0A068A211	Staphylococcus_phage	6.0e-79	41.3
WP_002359532.1\|2426018_2426201_-	hypothetical protein	NA	NA	NA	NA
WP_002358079.1\|2426215_2426383_-	hypothetical protein	NA	NA	NA	NA
WP_002359531.1\|2426395_2428036_-\|terminase	terminase large subunit	A0A1S5SF58	Streptococcus_phage	3.7e-183	58.9
WP_002359529.1\|2428032_2428386_-	hypothetical protein	A0A2H4JAH7	uncultured_Caudovirales_phage	2.7e-35	67.8
WP_002359528.1\|2428556_2428808_-	hypothetical protein	NA	NA	NA	NA
WP_114679397.1\|2428804_2429530_-	hypothetical protein	NA	NA	NA	NA
WP_002359526.1\|2429520_2429832_-	HNH endonuclease	A0A1S5SFB3	Streptococcus_phage	2.7e-31	63.1
WP_002359525.1\|2429824_2430139_-	hypothetical protein	NA	NA	NA	NA
WP_002359521.1\|2430131_2430320_-	hypothetical protein	NA	NA	NA	NA
WP_033655530.1\|2430813_2431344_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	5.4e-11	29.9
WP_002393129.1\|2431510_2431822_-	hypothetical protein	NA	NA	NA	NA
WP_162781814.1\|2431842_2432163_-	PcfU	D2IYU7	Enterococcus_phage	2.1e-55	97.2
WP_002359516.1\|2432180_2432387_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	7.4e-25	96.8
WP_002359515.1\|2432396_2432789_-	hypothetical protein	A0A0S2MYE6	Enterococcus_phage	1.8e-67	95.4
WP_002359514.1\|2432813_2432978_-	hypothetical protein	A0A0S2MYC2	Enterococcus_phage	3.1e-10	94.4
WP_002359512.1\|2432986_2433286_-	hypothetical protein	D2IZY1	Enterococcus_phage	5.5e-37	80.8
WP_114679399.1\|2433306_2433783_-	hypothetical protein	NA	NA	NA	NA
WP_002359510.1\|2433757_2434012_-	hypothetical protein	NA	NA	NA	NA
WP_025186167.1\|2434014_2434527_-	Holliday junction resolvase RecU	A0A2K9V2V4	Faecalibacterium_phage	1.8e-24	42.8
WP_002359508.1\|2434516_2434837_-	hypothetical protein	NA	NA	NA	NA
WP_002359505.1\|2434833_2435649_-	hypothetical protein	Q0SPI6	Clostridium_phage	6.3e-27	34.2
WP_114679400.1\|2435875_2436628_-	hypothetical protein	A0A1S5S8N0	Streptococcus_phage	5.1e-47	43.6
WP_002382539.1\|2436647_2437106_-	hypothetical protein	A0A097BY30	Enterococcus_phage	3.7e-24	45.4
WP_002382538.1\|2437162_2437441_-	hypothetical protein	A0A0A7S062	Clostridium_phage	1.3e-13	52.2
WP_002380711.1\|2437434_2437662_-	hypothetical protein	D2IZX4	Enterococcus_phage	3.2e-13	55.4

DBSCAN-SWA_10

2515322 : 2525062

Streptococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002385686.1\|2515322_2517506_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	3.1e-286	66.8
WP_002356379.1\|2517538_2518135_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	6.0e-51	56.4
WP_002359440.1\|2518179_2519298_-	DNA polymerase IV	NA	NA	NA	NA
WP_002356377.1\|2519423_2520182_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002359439.1\|2520165_2520828_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	5.1e-19	31.6
WP_002359438.1\|2520842_2521715_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.1e-80	57.2
WP_002356372.1\|2521826_2522174_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	8.1e-16	36.7
WP_002356371.1\|2522166_2523006_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002404418.1\|2523122_2524073_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.4e-33	33.0
WP_002356367.1\|2524074_2524404_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_002356366.1\|2524423_2525062_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.1e-54	53.8

DBSCAN-SWA_11

2546336 : 2594273

Enterococcus_phage(41.03%)

head,portal,integrase,tail,tRNA,protease,holin,terminase,capsid

attL 2558386:2558401|attR 2594909:2594924

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002367232.1\|2546336_2547047_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002404589.1\|2547057_2547600_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002356329.1\|2547686_2548457_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002356327.1\|2548622_2549198_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_002404588.1\|2549288_2550854_+	membrane protein	NA	NA	NA	NA
WP_002404587.1\|2550805_2551939_+	DUF4950 domain-containing protein	C9E2L5	Enterococcus_phage	6.1e-20	51.5
WP_002359404.1\|2552198_2553263_-	FUSC family protein	NA	NA	NA	NA
WP_002382470.1\|2553518_2553770_-	hypothetical protein	NA	NA	NA	NA
WP_002367242.1\|2554273_2554723_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_002367243.1\|2554722_2555004_-	hypothetical protein	NA	NA	NA	NA
WP_002367244.1\|2555000_2555582_-	hypothetical protein	NA	NA	NA	NA
WP_114679405.1\|2555987_2557289_-	LysM peptidoglycan-binding domain-containing protein	D2J077	Enterococcus_phage	2.5e-227	93.5
WP_010784229.1\|2557289_2557685_-\|holin	phage holin family protein	A0A097QQ04	Enterococcus_phage	2.3e-38	64.8
WP_162781816.1\|2557718_2560136_-	SGNH/GDSL hydrolase family protein	A0A0S2SXG8	Bacillus_phage	3.7e-06	22.1
2558386:2558401	attL	NA	NA	NA	NA
WP_114679406.1\|2560152_2562990_-\|tail	phage tail protein	D7RWE0	Brochothrix_phage	1.9e-86	43.2
WP_104847214.1\|2562986_2563691_-\|tail	phage tail protein	NA	NA	NA	NA
WP_114679407.1\|2563693_2565991_-\|tail	phage tail tape measure protein	V5UPR9	Enterococcus_phage	3.1e-79	56.0
WP_070363958.1\|2566182_2566638_-	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	3.4e-14	37.4
WP_002393808.1\|2566637_2567282_-\|tail	tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	9.1e-29	34.1
WP_002415252.1\|2567278_2567641_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_104847216.1\|2567630_2567969_-	hypothetical protein	A0A1B0T6B7	Bacillus_phage	1.9e-25	52.3
WP_104847217.1\|2567958_2568285_-\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	1.3e-20	52.4
WP_162781817.1\|2568262_2568553_-\|head,tail	phage head-tail connector protein	A0A1B1P7M9	Bacillus_phage	7.4e-23	64.3
WP_114679409.1\|2568545_2569910_-\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	2.2e-125	67.6
WP_002385658.1\|2569922_2570495_-\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	1.1e-62	62.4
WP_114679410.1\|2570466_2571693_-\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	4.6e-146	65.8
WP_104847219.1\|2571711_2573439_-\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	3.5e-253	70.4
WP_002365107.1\|2573435_2573888_-	hypothetical protein	A0A2H4JFK0	uncultured_Caudovirales_phage	8.0e-48	68.5
WP_010782959.1\|2574135_2574513_-	HNH endonuclease	A0A1B0T6C5	Bacillus_phage	1.5e-44	69.1
WP_114679411.1\|2574512_2574920_-	hypothetical protein	A0A1B1P7N8	Bacillus_phage	2.9e-12	38.6
WP_002367269.1\|2575442_2575910_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.9e-08	27.8
WP_114679412.1\|2576297_2576501_-	hypothetical protein	D2IZL5	Enterococcus_phage	8.8e-31	92.5
WP_162837175.1\|2576500_2576662_-	hypothetical protein	D2IZL4	Enterococcus_phage	2.0e-22	94.3
WP_010784246.1\|2576662_2577190_-	DUF1642 domain-containing protein	D2IZL3	Enterococcus_phage	1.8e-43	55.3
WP_002414787.1\|2577203_2577482_-	hypothetical protein	A0A0S2MYC7	Enterococcus_phage	6.9e-42	94.6
WP_033640479.1\|2577869_2578082_-	hypothetical protein	NA	NA	NA	NA
WP_033640481.1\|2578426_2578633_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	4.8e-24	95.2
WP_033640483.1\|2578648_2579254_-	hypothetical protein	NA	NA	NA	NA
WP_002415263.1\|2579302_2579683_+	hypothetical protein	NA	NA	NA	NA
WP_002415264.1\|2579683_2580154_-	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	6.4e-32	46.6
WP_002415266.1\|2580302_2580572_-	hypothetical protein	NA	NA	NA	NA
WP_002370005.1\|2580710_2581562_-	ATP-binding protein	U5PVD6	Bacillus_phage	6.4e-22	33.3
WP_114679413.1\|2581573_2582353_-	DnaD domain protein	Q6J1V6	Lactobacillus_phage	7.6e-38	58.5
WP_162781818.1\|2582367_2583183_-	PD-(D/E)XK nuclease-like domain-containing protein	J7KGZ1	Streptococcus_phage	1.3e-59	49.8
WP_114679414.1\|2583145_2584156_-	recombinase RecT	A0A1X9I5N6	Streptococcus_phage	9.7e-78	62.6
WP_002367281.1\|2584256_2584481_-	hypothetical protein	D2IZX4	Enterococcus_phage	3.7e-22	68.5
WP_114679415.1\|2584477_2584777_-	hypothetical protein	NA	NA	NA	NA
WP_114679416.1\|2584843_2585023_-	hypothetical protein	A0A0S2MY96	Enterococcus_phage	2.6e-18	77.2
WP_002367284.1\|2585057_2585327_-	hypothetical protein	NA	NA	NA	NA
WP_114679417.1\|2585402_2585717_+	hypothetical protein	NA	NA	NA	NA
WP_002385636.1\|2585841_2586018_-	helix-turn-helix domain-containing protein	D2IZW2	Enterococcus_phage	1.3e-14	65.5
WP_114679419.1\|2586105_2586384_+	hypothetical protein	D2IZW1	Enterococcus_phage	1.2e-38	87.0
WP_174089958.1\|2586380_2586542_-	hypothetical protein	D2IZW0	Enterococcus_phage	3.0e-18	90.6
WP_174089957.1\|2586848_2587172_+	helix-turn-helix transcriptional regulator	A0A097QQ00	Enterococcus_phage	1.0e-52	97.2
WP_114679421.1\|2587190_2587535_+	ImmA/IrrE family metallo-endopeptidase	D2IZV8	Enterococcus_phage	8.0e-40	70.2
WP_114679422.1\|2587593_2588322_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.3e-15	50.8
WP_114679423.1\|2588476_2589658_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	1.9e-48	31.8
WP_002356321.1\|2589760_2589910_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_174222123.1\|2590035_2592291_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_002359397.1\|2592335_2594273_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.1e-112	36.3
2594909:2594924	attR	NA	NA	NA	NA

DBSCAN-SWA_12

2907550 : 2947637

Enterobacteria_phage(14.29%)

holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354830.1\|2907550_2908234_-\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_002354829.1\|2908230_2908650_-\|holin	antiholin-like murein hydrolase modulator LrgA	NA	NA	NA	NA
WP_002358985.1\|2908801_2909530_-	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_002390682.1\|2909510_2911259_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	3.2e-60	28.4
WP_002354826.1\|2911371_2912190_-	membrane protein	NA	NA	NA	NA
WP_002354825.1\|2912202_2912874_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002354824.1\|2912870_2913593_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.2e-22	33.7
WP_002386234.1\|2913954_2914353_-	OsmC family protein	NA	NA	NA	NA
WP_002354822.1\|2914553_2914823_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_002354818.1\|2914933_2915083_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002379001.1\|2915098_2916073_+	GTP-binding protein	NA	NA	NA	NA
WP_002383181.1\|2916106_2916229_+	putative metal homeostasis protein	NA	NA	NA	NA
WP_010708369.1\|2916249_2917785_+	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002413934.1\|2917842_2918817_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_002354811.1\|2919005_2919776_-	ABC transporter permease	NA	NA	NA	NA
WP_002354809.1\|2919768_2920704_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.4e-22	29.4
WP_002354802.1\|2920961_2921381_+	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_002354800.1\|2921393_2921885_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002365419.1\|2921901_2922717_+	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_002358979.1\|2922713_2923541_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002358978.1\|2923688_2926208_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002354788.1\|2926354_2926915_-	hypothetical protein	NA	NA	NA	NA
WP_002354786.1\|2927093_2927486_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_002365424.1\|2927499_2927943_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_002354782.1\|2928164_2928632_-	DNA starvation/stationary phase protection protein	C1KFH1	Lactobacillus_virus	1.0e-05	25.9
WP_002358977.1\|2928759_2929479_-	DUF5105 domain-containing protein	NA	NA	NA	NA
WP_002358976.1\|2929562_2931083_-	gluconokinase	NA	NA	NA	NA
WP_002358975.1\|2931191_2931884_+	prepilin peptidase	NA	NA	NA	NA
WP_002354777.1\|2931933_2935587_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.4e-65	24.8
WP_002389470.1\|2935753_2939368_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	2.0e-48	24.5
WP_002354774.1\|2939738_2940080_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	5.5e-17	42.5
WP_002354773.1\|2940079_2940310_-	hypothetical protein	NA	NA	NA	NA
WP_002358974.1\|2940716_2940932_-	DNA-binding protein	NA	NA	NA	NA
WP_002358973.1\|2941070_2942063_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_002358972.1\|2942129_2942762_-	RloB domain-containing protein	NA	NA	NA	NA
WP_002396787.1\|2942770_2944066_-	AAA family ATPase	NA	NA	NA	NA
WP_002358967.1\|2944527_2946144_+	phosphatase PAP2/LCP family protein	NA	NA	NA	NA
WP_002404776.1\|2946498_2946621_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002358966.1\|2946806_2947004_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_077143780.1\|2947122_2947263_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002396786.1\|2947493_2947637_+\|holin	putative holin-like toxin	NA	NA	NA	NA

DBSCAN-SWA_13

3031188 : 3048726

Streptococcus_phage(100.0%)

integrase

attL 3026165:3026179|attR 3054976:3054990

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3026165:3026179	attL	NA	NA	NA	NA
WP_000420682.1\|3031188_3031503_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|3031518_3031905_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|3031933_3033319_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000879507.1\|3033321_3033474_+	hypothetical protein	NA	NA	NA	NA
WP_000398284.1\|3033496_3034702_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_001009056.1\|3034744_3034966_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000342539.1\|3035082_3035580_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_000506270.1\|3035554_3036061_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000331160.1\|3036044_3038492_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000804748.1\|3038494_3040672_+	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000769868.1\|3040668_3041670_+	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_001224318.1\|3041666_3042599_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_001814923.1\|3042843_3042960_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000691736.1\|3042975_3044895_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_000336323.1\|3045013_3045181_+	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_001227347.1\|3045240_3045594_-	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000804885.1\|3046098_3046521_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_114679434.1\|3046517_3046763_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-34	93.8
WP_000814511.1\|3047223_3047427_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001291561.1\|3047508_3048726_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
3054976:3054990	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031028

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP031029

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP031027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection