CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	1 crisprs	NA	1	2	0
NZ_CP022244	Vibrio parahaemolyticus strain PB1937 chromosome II, complete sequence	2 crisprs	DEDDh,WYL,csa3,cas3	0	0	2
NZ_CP022246	Vibrio parahaemolyticus strain PB1937 plasmid p1937-2, complete sequence	0 crisprs	NA	0	0	0
NZ_CP022243	Vibrio parahaemolyticus strain PB1937 chromosome I, complete sequence	1 crisprs	DinG,csa3,cas3,cas5f,cas6f,csx1,DEDDh,PD-DExK,WYL	0	1	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022245_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022245_1

24457-24609

Orphan

Consensus_repeat	Method
TTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP022245_1

>merge|NZ_CP022245|1|24457-24609|CRISPRCasFinder
ATATTTATTTTGTTTTTATTAATTATCTTATTTATGAAAATAATATAATTATGATAAATTGATTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCT

>NZ_CP022245|1|1|24457-24609|CRISPRCasFinder
ATATTTATTTTGTTTTTATTAATTATCTTATTTA	TGAAAATAATATAATTATGATAAATTGA
TTGTTTTTCTTGTTTTTCTTGTTTTTCTTGTTTT	TCTTGTTTTTCTTGTTTTTCTTG
TTTTTCTTGTTTTTCTTGTTTTTCTTGTTTTTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022245.1\|WP_023624625.1\|32022_32688_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022245.1\|WP_023624635.1\|20279_21119_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377386
NZ_CP022245.1\|WP_158090022.1\|34286_34442_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379554
NZ_CP022245.1\|WP_032072624.1\|18861_19014_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022245.1\|WP_023624634.1\|23354_24299_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|182167
NZ_CP022245.1\|WP_010446562.1\|35037_35958_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP022245.1\|WP_017449280.1\|18156_18471_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184348
NZ_CP022245.1\|WP_025788935.1\|29714_32048_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379210
NZ_CP022245.1\|WP_025789132.1\|11100_11973_-\|P-type-conjugative-transfer-protein-TrbG	unknown	unknown	gnl\|CDD\|274292
NZ_CP022245.1\|WP_025789130.1\|12685_13993_-\|P-type-conjugative-transfer-protein-TrbL	unknown	unknown	gnl\|CDD\|131830
NZ_CP022245.1\|WP_025788934.1\|32668_33898_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022245.1\|WP_023624628.1\|27410_28085_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239905
NZ_CP022245.1\|WP_025788937.1\|25315_25636_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022245.1\|WP_025789131.1\|11981_12656_-\|type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|226224
NZ_CP022245.1\|WP_017449279.1\|18481_18811_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184376
NZ_CP022245.1\|WP_023624629.1\|26370_27357_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP022245.1\|WP_025789746.1\|15701_18116_-\|DUF87-domain-containing-protein	unknown	unknown	gnl\|CDD\|184375
NZ_CP022245.1\|WP_023624627.1\|28501_29326_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022245.1\|WP_025789747.1\|14946_15705_-\|P-type-conjugative-transfer-protein-TrbJ	unknown	unknown	gnl\|CDD\|131827
NZ_CP022245.1\|WP_031419872.1\|24666_25332_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854

Protein	Function_ID	Function_description	E-value
NZ_CP022245.1\|WP_023624635.1\|20279_21119_+\|hypothetical-protein	gnl\|CDD\|377386	pfam04566, RNA_pol_Rpb2_4, RNA polymerase Rpb2, domain 4. RNA polymerases catalyze the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Domain 4, is also known as the external 2 domain.	0.00768285
NZ_CP022245.1\|WP_158090022.1\|34286_34442_-\|hypothetical-protein	gnl\|CDD\|379554	pfam14319, Zn_Tnp_IS91, Transposase zinc-binding domain. This domain is likely to be a zinc-binding domain. It is found at the N-terminus of transposases belonging to the IS91 family.	3.13263e-07
NZ_CP022245.1\|WP_017449279.1\|18481_18811_-\|hypothetical-protein	gnl\|CDD\|184376	PRK13892, PRK13892, conjugal transfer protein TrbC; Provisional.	4.11293e-17
NZ_CP022245.1\|WP_023624634.1\|23354_24299_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|182167	PRK09956, PRK09956, ISNCY family transposase.	1.03043e-110
NZ_CP022245.1\|WP_010446562.1\|35037_35958_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	6.1046e-58
NZ_CP022245.1\|WP_017449280.1\|18156_18471_-\|hypothetical-protein	gnl\|CDD\|184348	PRK13823, PRK13823, conjugal transfer protein TrbD; Provisional.	5.22125e-19
NZ_CP022245.1\|WP_025788935.1\|29714_32048_-\|AAA-family-ATPase	gnl\|CDD\|379210	pfam13476, AAA_23, AAA domain.	2.72397e-08
NZ_CP022245.1\|WP_025789132.1\|11100_11973_-\|P-type-conjugative-transfer-protein-TrbG	gnl\|CDD\|274292	TIGR02775, probable_conjugal_transfer_protein_TrbG, P-type conjugative transfer protein TrbG. The TrbG protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbG is a homolog of the F-type TraK protein (which is believed to be an outer membrane pore-forming secretin, TIGR02756) as well as the vir system VirB9 protein. [Cellular processes, Conjugation].	1.30588e-90
NZ_CP022245.1\|WP_025789130.1\|12685_13993_-\|P-type-conjugative-transfer-protein-TrbL	gnl\|CDD\|131830	TIGR02783, probable_conjugal_transfer_protein_TrbL, P-type conjugative transfer protein TrbL. The TrbL protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbL is a homolog of the F-type TraG protein (which is believed to be a mating pair stabilization pore-forming protein, pfam07916) as well as the vir system VirB6 protein. [Cellular processes, Conjugation].	2.5491e-64
NZ_CP022245.1\|WP_023624628.1\|27410_28085_+\|hypothetical-protein	gnl\|CDD\|239905	cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea. CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA. CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.	0.00024285
NZ_CP022245.1\|WP_025789131.1\|11981_12656_-\|type-IV-secretion-system-protein	gnl\|CDD\|226224	COG3701, TrbF, Type IV secretory pathway, TrbF components [Intracellular trafficking and secretion].	2.934e-46
NZ_CP022245.1\|WP_025789746.1\|15701_18116_-\|DUF87-domain-containing-protein	gnl\|CDD\|184375	PRK13891, PRK13891, conjugal transfer protein TrbE; Provisional.	0
NZ_CP022245.1\|WP_025789747.1\|14946_15705_-\|P-type-conjugative-transfer-protein-TrbJ	gnl\|CDD\|131827	TIGR02780, TrbJ_protein, P-type conjugative transfer protein TrbJ. The TrbJ protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbJ is a homolog of the F-type TraE protein (which is believed to be an inner membrane pore-forming protein, TIGR02761) as well as the vir system VirB5 protein.	1.39658e-33
NZ_CP022245.1\|WP_023624629.1\|26370_27357_+\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	1.3834e-10
NZ_CP022245.1\|WP_031419872.1\|24666_25332_+\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	6.37484e-41

>NZ_CP022245.1|WP_023624634.1|23354_24299_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MKAPTSIHDGLFKSFLTVPETAKDFLDIHLPGHIKQICNLDTLQLQSGSFLEDELVPYYSDVLYSMETDSGVGYVYALIEHQSSPDKHMGFRLMRYAIAAMQQHLDAGNEKLPLVVPLLFYHGKTSPYPYSTNWLDEFEKPEIAQLLYGQSFPLVDVTVIPDDDIIRHKRVALLELVQKHVRQRDLLDFTDTLVTLLLERLITSKQLDSLVEYLLRVGETSNLEDLMRTLAKQVPEHEERFMTVAEQLEARGREQGLKQGLQQGRQEGEKLGRKQGSQETQLAIAKKMLSAGIDIALVAQTTELTEDEISKLIN
>NZ_CP022245.1|WP_023624635.1|20279_21119_+|hypothetical-protein
MLISEQQTLTQAQQKAATEAAYRARRKARKHELVELHKAVVAAENAKKPKTPFLIAFRSRRLRRDGVVETLPQEFARILKACEELITNKKRFPALYAWGGDGVNNIQCRTNIARVLACILVNTDLIGGRIGEPTEAGIKTISWDQVQEDYALRFGEFIAPKSFAKALKYLRRAGYLHCERINVNVDEEEGAVRSAPAYKQLTERFFSDLKVVRYPNIVELILATRKRQESKGLRFKWLSFRDIAKKVQEIYNGKKLDGYAEATASIFQAFSPTPAFTPH
>NZ_CP022245.1|WP_032072624.1|18861_19014_-|hypothetical-protein
MKAYGQRKKLSKKEMEHLARQARARRQLEIMQELKGIGLNPYLDAKLITQ
>NZ_CP022245.1|WP_017449279.1|18481_18811_-|hypothetical-protein
MSLIQKLKRSGEHLLLGVSVGLCSFAANASSTGLPWESPLERIVDSITGPVAFGASALGIVAASVGLIFGGEMDGFVRTLMMIGLVVAVIVGAVNLLTMLFGVSGALVV
>NZ_CP022245.1|WP_017449280.1|18156_18471_-|hypothetical-protein
MDDDDELQFTPIYPFNRANLFMGGDRFLVMGAGCLALVLVVLQNIYTAVIGVVLFLVMLLITRLMAKNDAQLRPVYRRYAKFQRYYPAAGVKYLHKPSHSLRAR
>NZ_CP022245.1|WP_025789746.1|15701_18116_-|DUF87-domain-containing-protein
MLSLKSYRDTAKGLPDLLNWAALVDDGVMLGKDGSFTAGWRFTGMDVDTATNLERNAMTARLNQTLSSLGSGYMLHVDTIREIADSYPDVESSAFPHPVMQMMDDSRRLFFESQGDKFATRSVLFITWRPTAKRLSKVTDLLFDHGDTKRVSLAQRNLALFKERMSELEKSFTNVFSSITRLKLVERDGQPFDELLSYLRYSLTGQWHPVSAACTPLPLDSLLGSVECWPGFQPKIGEQYTSVISIDGFPDFSHPNMLHHLSLMNVEFRWSTRFIFFDSREAHQLLDKERKNWDQKVTSFRDKLLKNPDPKVDEDALEMVTQYQAAQNEVSAGRLNYGQYTSTFVLRHVDREVLQEVTEFVVSVLNNTLGLTCRVESLNATEALLGTLPSDSLYNIRRPLLSTLNLCHLLPIASIWTGEAHCPCPFYPMASPPMMMCTATGNTPFRLNLHVDDVGHTLIFGPTGAGKSTLLAMLVAQMHRYPNARVFAFDKKYSMFAMSQLGGLHLDIGSVGSREAPAFAPLADLDNDFEWCCEYIEQLLVLQGETITPEMRESIFKALSDMRGSSRLSMTEFCAQVQDQRIKTAVGYYTINGRAGDLLDAESSSLSFADFTVFEIDQLMKRGDRDLVPVLSYLFRTIERRLDGNPSFILIDEGWIALKHPVFKDMLVEWLKELRKLNCLVLLATQALNEAIKSGILDVLMESCPTQVFLPNPKAGQFAKTYHQFGLNDKQIDLLKNAVRKRDYYVHQPTGSRLVDLSLDKLALAFVGASDKESVNTIRQLVSEHGENWYLPYLKQQHILEDDE
>NZ_CP022245.1|WP_025789747.1|14946_15705_-|P-type-conjugative-transfer-protein-TrbJ
MKRTLSALTLCSVLVSFDSSALFCVNCASFTQMMTSNLNQAQSYVEEVQQTLNSVKNVQYQVQNLKNLKNMEWGDIQSQLRNLNTIASRGQSISFAMANMNQQFEQLFGGTEAYQGQSISDMNSVSTYQQQGNALRDTAQSSLALAQQMSQYQVDDHQTVASIQSHVQGADGAMEIAQANAELLAQLAQQLQKLQTLMQTQIQMSATQMAADADTVERQRVAEEKMLTQPLNVDPTDGKDWSQEWQHPSMKW
>NZ_CP022245.1|WP_025789130.1|12685_13993_-|P-type-conjugative-transfer-protein-TrbL
MKKGLVLLALLSHPALAADNNNALDTILDKFNAITATWEPIITDAVTNLFWLLVIASFTWSAIKLWLHQKGLEHFIAELFERVMTVGFCWFLVVNASPLAWTVLNSMQEVASRLSGSEAKLSPSNIVELGLTLAHQIWESSAGFDAGQFVIIGFSGLIVLITLALIAAQLTILLIGSFIILNGGVIVMGFLGSEWTRDHGMNYFTTVLGMSVQIFIMQLLVIIGNETFLSFINNPGAGSADYLMMVVMSVIYYSLVNTVPAIASSLATGRFVFNAAGAVNSAAGLLGAMAGVGLAAASLAKGGIGKAAQLAGKTSPGKKVASGIDQLAKSSPVFKGAAAGAKAMTKGSGKLGKAALSAMASQSPVGRAFKEMSNSRSVPKNGHQQLVKAMKQGVASALSQNDAVKQATQNIKPTSNHDALKARLQQQRQQTRMRK
>NZ_CP022245.1|WP_025789131.1|11981_12656_-|type-IV-secretion-system-protein
MSNPESPSDYSILYQRAREEWDERLGSIVKQAHNWKMCAFFSMFVAAIAVGSTGYIGAQSKIEPYVIGVKNGEEVVGVASVQKLPTSQLEALKVNDLERFVEDIRSVYLDVEVEDKAVRRAYARLVPNSPAQTQISQAFKEENPFERAARELVKVDIKSTLPLSDNTWQMEWVETITDRQGNVLDTPRFKATITTQTVQPKNKAEMNQNPLGLWIATFNDVQIN
>NZ_CP022245.1|WP_025789132.1|11100_11973_-|P-type-conjugative-transfer-protein-TrbG
MNVVKPLSLWVGIVLTSGVMAAPVPPITGSSLIEMPQTLTTSEQAGLDIAKRWINGTDKPIRSPDGAITYFFGKSLPSVVCAPLKTCDIQLEPGEQISKNGLNAGDTVRWGFTPTVSGQGSDAVTHILVKPTDVNIETTLQIATNRRSYLIKLTAKHNDWMPIVRFDYPETLQIAMDSMYERQQTEQHSKEIADGLNIDDLDFDYDIEGNTRFTPVRVYNNSVKTILEMPRSVATGKLPSLLVINAGQRELINYRYRNGKFVVDGLPEQIALLLGAGKHQQTVLIKRKEG
>NZ_CP022245.1|WP_031419872.1|24666_25332_+|AAA-family-ATPase
MKKIILLGHQKGGVGKSNTACNLAVALAHEKYQEDTSRILLLDADPQGTLYRWNQRRIEIGGALKEFPCIRLDGNITKQLQREIENYDFIIVDAAGRDSREMRSAMLAADLMIMPTKASHADLELLEHMAETVESARDFNDALEVAVFINMAPTNTHAERQTAKQLLSEYPEFHLMRTVVADRKAHRDAFHHACGVHEWKDNKAKSEISCLTKEILDAFSI
>NZ_CP022245.1|WP_025788937.1|25315_25636_+|hypothetical-protein
MLSRSNLKAQEKKVKEADAFVDGADSKVSRTVGRPKQKGEKREPVTVSLTKSEAQQLDKIHKRLNVISYSKDEDFSLDRSSFIRAIAERCENMSDEELWKWFNYHK
>NZ_CP022245.1|WP_023624629.1|26370_27357_+|hypothetical-protein
MARERAFSDLQVKEAANALLVEGKNINGTSLRNKIGTGRPSALMSAFKALEDSGEILAPMLPDSNEQTIVHQELPPEIAERLSLMLGDVEQLVHQINDHAHYTVEQRLNQAIAEANERAANAAKREAESIQEQDKAFEQLEDALEANADLQEQLKLEHKENSQLNAALNVAKSETKAALDTVSERDERLAEMQKQITSMQQQLNNAESDKAKAQGQVEQLVKQLGEKSDEMAELNANLKNSEKELGSLQGQLGSLTEQIANQKAANEQLQGKFDEEKAAYIRAESRIESLNSELNKKNEALLETQASLGEVQKLNAKLEGQLMHYQEQ
>NZ_CP022245.1|WP_023624628.1|27410_28085_+|hypothetical-protein
MQQLKFGKIKNYKDDRGFGFIFSECKFIHYVIMGSKEVFFHIKQAKQFESVLKTTTLQEDLCFWFTTEITPKGEAVKQMWSKLSEIPQDIREGNADFINQVAENIKLYEVAKAEKHAREAVLQEALRKARETRDSELNALIVAARSQGFSTSGQLSAWIRANKLWTKYPTLTGDLTMHDGEESWSFGAAIDPQYYKLVCQALDLHNARSSARAGAFRSYASMGS
>NZ_CP022245.1|WP_023624627.1|28501_29326_-|hypothetical-protein
MDVSQVKMPFAISNQTGHIIGIAEVERGDDCDCRCLSCGTLVTARQGSSNQWHFGHRTCEVSTSNECRFSPVTALALIIRQELPQLVQFDLDEWTFSDTLWELEVIKHGFRCDAYAKDAETGISVLVEIPFADGKMNDVDQIPEEIDLVLRVDTHLMANALYVNKPKDKVYRADEVFCLLLEHWGKWVSMERWPEQKSDNIAPEEVTDKYEAIDRDEGITASHPLQSSTKLCIYCDVEPGFHAKGLLCRTCVRRYVGPRFNSISEMASHYKKLK
>NZ_CP022245.1|WP_025788935.1|29714_32048_-|AAA-family-ATPase
MNWKISKIEVSSFKAFKHIYLDLGESALLTLDGPNGYGKTSIFDAIELLLTGQVSRIQNLFSTLLSNRTKNYADNLFWNNRSGENDLCIKIEFTNDDRKLVLARHCPTVIFKKPANNRADNYENFKLYELPTFESFDFTKANLRDNNFLDEVFGKNFRENFSFLNYLEQGQNRLLHTRVDQRKDKLGNLFNISDIEAEIESCNNIYSKLTKHINDPERKAKIESLKEEIATLRDTLQAEAGIVGYKKLSTTDVQPGWDKENIFSTYSAVDHAAYQESVRKIIALLPLKATIKTRVHNEVIDADIKRNEESLRSLAQFGKDLNKLDELEAIKKGIDELERSAAIIKRGASMIKVEEAQSLPNWADGRLESFELQIESRNNLRDKSSANANAIAELERLKTQLIDEHKKSYPDDHLCPLCGTDWEDHKSMVGAIEARTKQISESLSKDGKELVNLIAAMDAELKLIDTHIQNNLKVLKPTFEPNLHAELTKIKLRLPAITLLMEKLKSDNLQFTDTFTESNDVVNERLEKLKEILRNKKQTEVDALALPEDWRETTISAFKDLEDFYIITAEDLRDKEQYISIKANEAQNARLQTCISALKLIEKETLAAQKAQEKIKKLRDTLKDTEQRYTDQTISAIELIFHIYSGRLIQNYQRGLGLFIESRDGTQLRFLTAEKSEHDAVMSMSSGQVCALGLAFFLSLNKVYAKVPLILIDDPSQSLDEINVASLTDLLRCELKHCQLIVSSHEDDISAYMRYRFDRAGLKTSSLNMQLLAKEAL
>NZ_CP022245.1|WP_023624625.1|32022_32688_-|hypothetical-protein
MIKQLIDEALVDHGFVSKRELDNTSFYIRDSGSAIRFAVVHNLDELITPTELNSQINQLAPEDFLRNPSFKKNCDLICIYRLDVLAEFKEHEEGIFSIEEDPHFYKKYVLYYSIAEESALTDFTYEKLVSVISDKKEFIGYKENPLVASQYSFAAKTFIKLPFLELPIHQGNLVSLRQQAIEAVAEAGRSDTYATIQQVTNANADEVIKEMIKNELENIQD
>NZ_CP022245.1|WP_025788934.1|32668_33898_-|hypothetical-protein
MSQQEEKYPASAISSWSGFVYQGKVALYHSLKLILDDDLDFELQLDSSDDFAIYKAGKLHSAHQVKAKISKYRSGYAKALEQSTLIEYDKAKGTTRYFHVSVPLENTDDHIGNNGETVKFYRYGNNFHCGLGEIEGLTKALIKNICEKQSITVSDNLINFNYCLLSEKISTKAIHNHKLNQEDGFSENKAAYEGRIEAKDILEELLTENPYQNRDYYAVELKARLQTYLEERLEQALPTMNDTTYERARRLCEHMRNTHINELKNLCQMMKPSERFQDIQKNDIRRYTKLIQAISVEPIFNHLPHYIDRENRFYVPTALDVDASEECESDMNHEMKNNGDLLRLLFEYNHLIASKAEASFTFDTKFTNSDDFDDKRATEKLESNITKSLCISVITKDDAEDRLNDKATH
>NZ_CP022245.1|WP_158090022.1|34286_34442_-|hypothetical-protein
MLACGSASMGSRLYKCKNSGCTYYTKYLNQSCKSRACCSGGVKSTERWMVA
>NZ_CP022245.1|WP_010446562.1|35037_35958_-|IS5-family-transposase
MPKPRYKTTNWKQYNKSLINRGSLTFWIDEEAIAEWKQNKQGKRGRPRRFSDLAITTALMVKRVFSMPLRALQGFLDSVFKLANIPLVCPHYTCISRRAKEVEVSFKTKTRGAIQHLAIDATGLKVYGEGEWKVKKHGTDGKRRVWRKLHIAVDTSTHEIVAAELSLSNVTDAEVLPNLLKQTRRKIIEISGDGAYDTRNCHDAIRIKRAVPLIPPREGAAFWEQGHPRNLAVGCQKLYGSNKKWKKRYGYHKRSLSETAMYRVKQLLGGKLSLRNYNAQVGETYAMIKALNKLTGLGMPETQYIV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245.1	24589-24611	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245.1	24598-24620	0	1.0

1. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to position: 24589-24611, mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

2. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to position: 24598-24620, mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_KY498540	Vibrio parahaemolyticus v110 plasmid pV110, complete sequence	4709-4736	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP028346	Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence	61711-61738	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033136	Vibrio campbellii strain 170502 plasmid pVCZS, complete sequence	62305-62332	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP045861	Vibrio owensii strain SH14 plasmid pVHvo, complete sequence	45693-45720	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP020078	Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence	4212-4239	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP021148	Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence	49607-49634	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_025152	Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence	4212-4239	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24491-24518	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP020036	Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence	4212-4239	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP034293	Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence	36004-36031	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP034297	Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence	22025-22052	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	AP014860	Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61	4212-4239	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP043423	Vibrio parahaemolyticus strain MVP1 plasmid pVa, complete sequence	2689-2716	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033140	Vibrio owensii strain 1700302 plasmid pVOWZ2, complete sequence	40426-40453	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_KP324996	Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence	48313-48340	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP034571	Vibrio parahaemolyticus strain 160807 plasmid pVPWZ2, complete sequence	37853-37880	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP034304	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence	72234-72261	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP028145	Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence	7516-7543	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP034308	Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence	61435-61462	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	AP014859	Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61	39683-39710	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46261-46288	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046414	Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence	28999-29026	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_MH890610	Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence	16420-16447	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_KP324996	Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence	48274-48296	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_KP324996	Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence	48283-48305	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP033146	Vibrio owensii strain V180403 plasmid pVOWZ3, complete sequence	29867-29889	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034571	Vibrio parahaemolyticus strain 160807 plasmid pVPWZ2, complete sequence	37823-37845	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034304	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence	72195-72217	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034304	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence	72204-72226	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028145	Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence	7468-7490	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028145	Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence	7477-7499	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028145	Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence	7486-7508	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034308	Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence	61396-61418	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034308	Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence	61405-61427	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AP014859	Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61	39644-39666	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AP014859	Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61	39653-39675	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46186-46208	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46195-46217	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46204-46226	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46213-46235	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46222-46244	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46231-46253	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP046414	Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence	28960-28982	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP046414	Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence	28969-28991	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_MH890610	Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence	16381-16403	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_MH890610	Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence	16390-16412	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_KY498540	Vibrio parahaemolyticus v110 plasmid pV110, complete sequence	4744-4766	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_KY498540	Vibrio parahaemolyticus v110 plasmid pV110, complete sequence	4753-4775	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028346	Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence	61746-61768	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028346	Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence	61755-61777	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028346	Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence	61764-61786	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP033136	Vibrio campbellii strain 170502 plasmid pVCZS, complete sequence	62340-62362	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP045861	Vibrio owensii strain SH14 plasmid pVHvo, complete sequence	45728-45750	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP020078	Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence	4247-4269	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP020078	Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence	4256-4278	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP021148	Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence	49642-49664	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP021148	Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence	49651-49673	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP021148	Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence	49660-49682	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_025152	Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence	4247-4269	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_025152	Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence	4256-4278	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_025152	Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence	4265-4287	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24526-24548	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24535-24557	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24544-24566	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24553-24575	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24562-24584	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24571-24593	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24580-24602	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24589-24611	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24598-24620	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP020036	Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence	4247-4269	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP020036	Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence	4256-4278	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034293	Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence	36039-36061	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034293	Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence	36048-36070	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034293	Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence	36057-36079	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034297	Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence	22060-22082	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034297	Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence	22069-22091	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034297	Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence	22078-22100	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AP014860	Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61	4247-4269	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AP014860	Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61	4256-4278	0	1.0
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP033140	Vibrio owensii strain 1700302 plasmid pVOWZ2, complete sequence	40461-40483	0	1.0
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033146	Vibrio owensii strain V180403 plasmid pVOWZ3, complete sequence	29897-29924	1	0.964
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_AP018282	Chondrocystis sp. NIES-4102 plasmid plasmid1 DNA, complete genome	79497-79519	1	0.957
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_KP324996	Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence	48292-48314	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP033146	Vibrio owensii strain V180403 plasmid pVOWZ3, complete sequence	29876-29898	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034571	Vibrio parahaemolyticus strain 160807 plasmid pVPWZ2, complete sequence	37832-37854	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034304	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence	72213-72235	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028145	Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence	7495-7517	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034308	Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence	61414-61436	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AP014859	Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61	39662-39684	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034288	Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence	46240-46262	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP046414	Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence	28978-29000	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_MH890610	Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence	16399-16421	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_KY498540	Vibrio parahaemolyticus v110 plasmid pV110, complete sequence	4735-4757	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP028346	Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence	61737-61759	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP033136	Vibrio campbellii strain 170502 plasmid pVCZS, complete sequence	62331-62353	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP045861	Vibrio owensii strain SH14 plasmid pVHvo, complete sequence	45719-45741	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP020078	Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence	4238-4260	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP021148	Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence	49633-49655	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_025152	Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence	4238-4260	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP022245	Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence	24517-24539	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP020036	Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence	4238-4260	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034293	Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence	36030-36052	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034297	Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence	22051-22073	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AP014860	Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61	4238-4260	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP033140	Vibrio owensii strain 1700302 plasmid pVOWZ2, complete sequence	40452-40474	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP019919	Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence	27743-27765	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_017402	Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence	27165-27187	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP019757	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence	27743-27765	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MT375525	Pelagibacter phage Greip EXVC02, complete genome	24503-24525	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MK376340	Pseudomonas sp. strain ANT_H6 plasmid pA6H3, complete sequence	318-340	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MK376348	Pseudomonas sp. strain ANT_H46 plasmid pA46H2, complete sequence	291-313	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MK376350	Pseudomonas sp. strain ANT_H62 plasmid pA62H1, complete sequence	318-340	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_AP017376	Stanieria sp. NIES-3757 plasmid plasmid1 DNA, complete genome	131362-131384	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_019765	Stanieria cyanosphaera PCC 7437 plasmid pSTA7437.01, complete sequence	125585-125607	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MN694696	Marine virus AFVG_250M540, complete genome	21607-21629	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	11990-12012	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP013139	Pseudoalteromonas sp. Bsw20308 plasmid pPBSW1, complete sequence	341631-341653	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP007006	Vibrio parahaemolyticus UCM-V493 plasmid pVPUCMV, complete sequence	35754-35776	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_021529	Vibrio phage nt-1, complete genome	166585-166607	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MH552499	Podoviridae sp. isolate ctcf755, complete genome	6181-6203	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_023691	Mycobacterium phage Patience, complete genome	64588-64610	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_011398	Clostridium phage phiCD27, complete genome	16933-16955	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MN694085	Marine virus AFVG_250M500, complete genome	12117-12139	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP031072	Bacillus mycoides strain BPN401 plasmid pl395, complete sequence	318884-318906	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_AP019844	Leptotrichia wadei strain JMUB3936 plasmid pJMUB3936p3, complete sequence	4982-5004	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_022111	Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence	1033382-1033404	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP034112	Staphylococcus epidermidis strain CDC120 plasmid pSTA491, complete sequence	44843-44865	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MN694471	Marine virus AFVG_250M232, complete genome	31058-31080	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MK796797	Shewanella phage X14, complete genome	9061-9083	2	0.913
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MN694202	Marine virus AFVG_250M1202, complete genome	38482-38504	2	0.913
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007391	Spiroplasma citri pSci5 plasmid	5232-5259	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007391	Spiroplasma citri pSci5 plasmid	12633-12660	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007392	Spiroplasma citri plasmid pSci6	14700-14727	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007392	Spiroplasma citri plasmid pSci6	17277-17304	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047431	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-3, complete sequence	8940-8967	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047431	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-3, complete sequence	16142-16169	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046369	Spiroplasma citri strain BR12 plasmid pScpBR12-1, complete sequence	7421-7448	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046369	Spiroplasma citri strain BR12 plasmid pScpBR12-1, complete sequence	14623-14650	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP042474	Spiroplasma citri strain CC-2 plasmid pScpCC2-2, complete sequence	35812-35839	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP031089	Spiroplasma phoeniceum P40 plasmid pSPh535, complete sequence	36949-36976	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046372	Spiroplasma citri strain LB 319 plasmid pScpLB319-1, complete sequence	32015-32042	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046372	Spiroplasma citri strain LB 319 plasmid pScpLB319-1, complete sequence	39217-39244	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047439	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence	57697-57724	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047439	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence	64899-64926	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047440	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence	8235-8262	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047427	Spiroplasma citri strain C189 plasmid pScpC189-1, complete sequence	5528-5555	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047427	Spiroplasma citri strain C189 plasmid pScpC189-1, complete sequence	33020-33047	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP053310	Spiroplasma citri strain C5 plasmid pScpC5-6, complete sequence	10664-10691	3	0.893
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP053310	Spiroplasma citri strain C5 plasmid pScpC5-6, complete sequence	17881-17908	3	0.893
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP021671	Bacillus licheniformis strain SRCM100141 plasmid pBL141-1 sequence sequence	37371-37393	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP038626	Arsenophonus nasoniae strain FIN plasmid pArsFIN14, complete sequence	4599-4621	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_010290	Enterococcus faecium plasmid pJS33, complete sequence	747-769	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_LR135381	Enterococcus faecium isolate E8172 plasmid 10	844-866	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MN831412	Enterococcus faecalis strain M18/0011 plasmid pM18/0011, complete sequence	13810-13832	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MK448714	Streptococcus phage Javan241, complete genome	8585-8607	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	KT997872	Uncultured Mediterranean phage uvDeep-CGR2-AD8-C175, complete genome	29818-29840	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MH617746	Microviridae sp. isolate ctcg947, complete genome	2381-2403	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MH617013	Microviridae sp. isolate ctdb584, complete genome	3371-3393	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	166744-166766	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	166749-166771	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_021211	Pseudomonas sp. GLE121 plasmid pGLE121P2, complete sequence	1447-1469	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_022111	Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence	703836-703858	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NC_020554	Enterococcus faecium strain HB6 plasmid pAR6, complete sequence	1725-1747	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	166571-166593	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	AF511037	Enterococcus faecium plasmid pEFR, complete sequence	2413-2435	3	0.87
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	MN693525	Marine virus AFVG_25M131, complete genome	26206-26228	3	0.87
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP053307	Spiroplasma citri strain C5 plasmid pScpC5-3, complete sequence	2936-2963	4	0.857
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046370	Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence	18544-18571	4	0.857
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047441	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence	16723-16750	4	0.857
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047432	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence	15712-15739	4	0.857
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP053311	Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence	18613-18640	4	0.857
NZ_CP022245_1	1.2\|24553\|23\|NZ_CP022245\|CRISPRCasFinder	24553-24575	23	NZ_CP015497	Lactobacillus helveticus strain FAM8105 plasmid pFAM8105, complete sequence	5153-5175	4	0.826
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	KX229736	Campylobacter phage PC5, complete genome	34158-34185	5	0.821
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_042112	Campylobacter phage CP81, complete genome	61844-61871	5	0.821
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	KX879627	Campylobacter phage vB_CjeM_Los1, complete genome	66339-66366	5	0.821
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	MH107028	Campylobacter phage CP39, partial genome	3541-3568	5	0.821
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007391	Spiroplasma citri pSci5 plasmid	2978-3005	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007391	Spiroplasma citri pSci5 plasmid	27449-27476	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_KU525621	Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence	50457-50484	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	51151-51178	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	49100-49127	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	50680-50707	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	51025-51052	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	80889-80916	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	86668-86695	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	50677-50704	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046370	Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence	40144-40171	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP046370	Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence	36846-36873	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	38970-38997	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	51723-51750	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	50680-50707	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	50840-50867	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	26258-26285	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	50595-50622	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	50628-50655	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047441	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence	38323-38350	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047441	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence	35025-35052	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	50677-50704	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	50599-50626	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	51170-51197	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	50679-50706	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	57527-57554	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	50680-50707	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_008442	Borrelia duttonii plasmid DNA, complete sequence, strain: Ly	148-175	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	73178-73205	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	35715-35742	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	69962-69989	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	78273-78300	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	47876-47903	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	84953-84980	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	50678-50705	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	50612-50639	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047432	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence	37780-37807	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP047432	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence	34438-34465	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP053311	Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence	309-336	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	53108-53135	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	78668-78695	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	49844-49871	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	78638-78665	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	22803-22830	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP039706	Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence	720534-720561	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	489206-489233	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	489255-489282	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP045273	Bacillus megaterium strain FDU301 plasmid pFDU301A, complete sequence	32828-32855	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_011774	Bacillus cereus G9842 plasmid pG9842_140, complete sequence	119220-119247	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP042651	Staphylococcus aureus strain X22 plasmid unnamed, complete sequence	2075-2102	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP042473	Spiroplasma citri strain CC-2 plasmid pScpCC2-1, complete sequence	28290-28317	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP014175	Clostridium argentinense strain 89G plasmid pRSJ17_1, complete sequence	104009-104036	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	AP019525	Tenacibaculum phage PTm5 DNA, complete genome	152413-152440	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	MF001358	Enterococcus phage EF1, partial genome	22678-22705	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	AP019524	Tenacibaculum phage PTm1 DNA, complete genome	151509-151536	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_020227	Staphylococcus aureus strain CH-91 plasmid pCH91, complete sequence	7805-7832	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	89965-89992	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	MF001361	Enterococcus phage EF5, partial genome	94641-94668	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	JX569801	Campylobacter phage CP30A, complete genome	29463-29490	6	0.786
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP039703	Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence	783345-783372	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP039706	Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence	702848-702875	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	469714-469741	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	469764-469791	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP013238	Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence	118123-118150	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	CP031730	Stenotrophomonas rhizophila strain GA1 plasmid unnamed1, complete sequence	38200-38227	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP026601	Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence	22599-22626	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	420533-420560	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NZ_AP019717	Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence	740357-740384	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_023917	Clostridium perfringens plasmid pCP-OS1 DNA, complete sequence, strain: OS1	13953-13980	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	NC_023918	Clostridium perfringens plasmid pCP-TS1 DNA, complete sequence, strain: TS1	13935-13962	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	MN693101	Marine virus AFVG_25M559, complete genome	27419-27446	7	0.75
NZ_CP022245_1	1.1\|24491\|28\|NZ_CP022245\|CRISPRCasFinder	24491-24518	28	MN694811	Marine virus AFVG_250M587, complete genome	24807-24834	8	0.714

1. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_KY498540 (Vibrio parahaemolyticus v110 plasmid pV110, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

2. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028346 (Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

3. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033136 (Vibrio campbellii strain 170502 plasmid pVCZS, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

4. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP045861 (Vibrio owensii strain SH14 plasmid pVHvo, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

5. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020078 (Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

6. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP021148 (Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

7. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_025152 (Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

8. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

9. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020036 (Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

10. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034293 (Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

11. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034297 (Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

12. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to AP014860 (Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

13. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP043423 (Vibrio parahaemolyticus strain MVP1 plasmid pVa, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

14. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033140 (Vibrio owensii strain 1700302 plasmid pVOWZ2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

15. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_KP324996 (Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

16. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034571 (Vibrio parahaemolyticus strain 160807 plasmid pVPWZ2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

17. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034304 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

18. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028145 (Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

19. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034308 (Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

20. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to AP014859 (Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

21. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

22. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046414 (Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

23. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_MH890610 (Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatgataaattga	Protospacer
****************************

24. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_KP324996 (Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

25. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_KP324996 (Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

26. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033146 (Vibrio owensii strain V180403 plasmid pVOWZ3, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

27. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034571 (Vibrio parahaemolyticus strain 160807 plasmid pVPWZ2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

28. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034304 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

29. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034304 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

30. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028145 (Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

31. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028145 (Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

32. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028145 (Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

33. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034308 (Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

34. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034308 (Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

35. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AP014859 (Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

36. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AP014859 (Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

37. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

38. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

39. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

40. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

41. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

42. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

43. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046414 (Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

44. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046414 (Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

45. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_MH890610 (Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

46. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_MH890610 (Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

47. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_KY498540 (Vibrio parahaemolyticus v110 plasmid pV110, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

48. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_KY498540 (Vibrio parahaemolyticus v110 plasmid pV110, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

49. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028346 (Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

50. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028346 (Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

51. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028346 (Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

52. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033136 (Vibrio campbellii strain 170502 plasmid pVCZS, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

53. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP045861 (Vibrio owensii strain SH14 plasmid pVHvo, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

54. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020078 (Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

55. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020078 (Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

56. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP021148 (Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

57. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP021148 (Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

58. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP021148 (Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

59. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_025152 (Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

60. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_025152 (Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

61. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_025152 (Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

62. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

63. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

64. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

65. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

66. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

67. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

68. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

69. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

70. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

71. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020036 (Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

72. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020036 (Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

73. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034293 (Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

74. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034293 (Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

75. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034293 (Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

76. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034297 (Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

77. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034297 (Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

78. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034297 (Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

79. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AP014860 (Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

80. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AP014860 (Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

81. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033140 (Vibrio owensii strain 1700302 plasmid pVOWZ2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcttg	Protospacer
***********************

82. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033146 (Vibrio owensii strain V180403 plasmid pVOWZ3, complete sequence) position: , mismatch: 1, identity: 0.964

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataattatggtaaattga	Protospacer
*******************.********

83. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_AP018282 (Chondrocystis sp. NIES-4102 plasmid plasmid1 DNA, complete genome) position: , mismatch: 1, identity: 0.957

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttctcgtttttcttg	Protospacer
************.**********

84. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_KP324996 (Vibrio parahaemolyticus strain 3HP plasmid pVA1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

85. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033146 (Vibrio owensii strain V180403 plasmid pVOWZ3, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

86. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034571 (Vibrio parahaemolyticus strain 160807 plasmid pVPWZ2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

87. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034304 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-5, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

88. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028145 (Vibrio parahaemolyticus strain R14 plasmid pVpR14_74Kb, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

89. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034308 (Vibrio parahaemolyticus strain 20151116002-3 plasmid pVPGX2015-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

90. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AP014859 (Vibrio parahaemolyticus plasmid pVP2HP DNA, complete sequence, strain: VPE61) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

91. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034288 (Vibrio parahaemolyticus strain 20140624012-1 plasmid pVPHB2014-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

92. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046414 (Vibrio parahaemolyticus strain 19-021-D1 plasmid pVp_Kor-D1-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

93. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_MH890610 (Vibrio campbellii strain LMB29 plasmid pVCON1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

94. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_KY498540 (Vibrio parahaemolyticus v110 plasmid pV110, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

95. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP028346 (Vibrio parahaemolyticus isolate R13 plasmid pVpR13_71Kb, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

96. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033136 (Vibrio campbellii strain 170502 plasmid pVCZS, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

97. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP045861 (Vibrio owensii strain SH14 plasmid pVHvo, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

98. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020078 (Vibrio campbellii strain 20130629003S01 plasmid pVCGX1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

99. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP021148 (Vibrio campbellii strain LA16-V1 plasmid pLA16-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

100. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_025152 (Vibrio parahaemolyticus strain 13-028/A3 plasmid pVPA3-1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

101. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP022245 (Vibrio parahaemolyticus strain PB1937 plasmid p1937-1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

102. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP020036 (Vibrio parahaemolyticus strain 20130629002S01 plasmid pVPGX1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

103. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034293 (Vibrio parahaemolyticus strain 20140722001-1 plasmid pVPCZ2014-3, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

104. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034297 (Vibrio parahaemolyticus strain 20140829008-1 plasmid pVPGD2014-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

105. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AP014860 (Vibrio parahaemolyticus plasmid pVPE61a DNA, complete sequence, strain: VPE61) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

106. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033140 (Vibrio owensii strain 1700302 plasmid pVOWZ2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
gattgtttttcttgtttttcttg	Protospacer
  *********************

107. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP019919 (Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttcttc	Protospacer
************* ********

108. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_017402 (Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttcttc	Protospacer
************* ********

109. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP019757 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttcttc	Protospacer
************* ********

110. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MT375525 (Pelagibacter phage Greip EXVC02, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtctttcttgtttttcttt	Protospacer
******.***************

111. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MK376340 (Pseudomonas sp. strain ANT_H6 plasmid pA6H3, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcctt	Protospacer
********************.*

112. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MK376348 (Pseudomonas sp. strain ANT_H46 plasmid pA46H2, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcctt	Protospacer
********************.*

113. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MK376350 (Pseudomonas sp. strain ANT_H62 plasmid pA62H1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttcctt	Protospacer
********************.*

114. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_AP017376 (Stanieria sp. NIES-3757 plasmid plasmid1 DNA, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
ccttgtttttctagtttttcttg	Protospacer
.*********** **********

115. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_019765 (Stanieria cyanosphaera PCC 7437 plasmid pSTA7437.01, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
ccttgtttttctagtttttcttg	Protospacer
.*********** **********

116. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MN694696 (Marine virus AFVG_250M540, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttcttc	Protospacer
************* ********

117. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tctcgtttttcttgattttcttg	Protospacer
***.********** ********

118. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP013139 (Pseudoalteromonas sp. Bsw20308 plasmid pPBSW1, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttttgtttcttgtttttcttg	Protospacer
**** * ****************

119. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP007006 (Vibrio parahaemolyticus UCM-V493 plasmid pVPUCMV, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgttgttcttgttgttcttg	Protospacer
******* ******** ******

120. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_021529 (Vibrio phage nt-1, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tctagtttttctagtttttcttg	Protospacer
*** ******** **********

121. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MH552499 (Podoviridae sp. isolate ctcf755, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttatcttgtttttattg	Protospacer
******** ********** ***

122. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_023691 (Mycobacterium phage Patience, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgttgttcttgttcttcttg	Protospacer
******* ********.******

123. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_011398 (Clostridium phage phiCD27, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgttttttttgttcttcttg	Protospacer
**********.*****.******

124. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MN694085 (Marine virus AFVG_250M500, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgttttgcttgattttcttg	Protospacer
********* **** ********

125. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP031072 (Bacillus mycoides strain BPN401 plasmid pl395, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgttttacctgtttttcttg	Protospacer
********* *.***********

126. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_AP019844 (Leptotrichia wadei strain JMUB3936 plasmid pJMUB3936p3, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
ttttctttttcttgtttttcttg	Protospacer
*.** ******************

127. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_022111 (Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttctttttcttgtttttattg	Protospacer
**** ************** ***

128. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP034112 (Staphylococcus epidermidis strain CDC120 plasmid pSTA491, complete sequence) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgttcttcttgtttttgttg	Protospacer
*******.*********** ***

129. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MN694471 (Marine virus AFVG_250M232, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttttttttcttgtttgtcttg	Protospacer
**** ************ *****

130. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MK796797 (Shewanella phage X14, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttgttgttttttttg	Protospacer
********** ********.***

131. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MN694202 (Marine virus AFVG_250M1202, complete genome) position: , mismatch: 2, identity: 0.913

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttgtcttgtttgtcttg	Protospacer
******** ******** *****

132. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007391 (Spiroplasma citri pSci5 plasmid) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

133. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007391 (Spiroplasma citri pSci5 plasmid) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

134. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007392 (Spiroplasma citri plasmid pSci6) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

135. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007392 (Spiroplasma citri plasmid pSci6) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

136. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047431 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-3, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

137. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047431 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-3, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

138. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046369 (Spiroplasma citri strain BR12 plasmid pScpBR12-1, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

139. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046369 (Spiroplasma citri strain BR12 plasmid pScpBR12-1, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

140. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP042474 (Spiroplasma citri strain CC-2 plasmid pScpCC2-2, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

141. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP031089 (Spiroplasma phoeniceum P40 plasmid pSPh535, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

142. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046372 (Spiroplasma citri strain LB 319 plasmid pScpLB319-1, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

143. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046372 (Spiroplasma citri strain LB 319 plasmid pScpLB319-1, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

144. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047439 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

145. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047439 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-2, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

146. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047440 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

147. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047427 (Spiroplasma citri strain C189 plasmid pScpC189-1, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

148. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047427 (Spiroplasma citri strain C189 plasmid pScpC189-1, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

149. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP053310 (Spiroplasma citri strain C5 plasmid pScpC5-6, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

150. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP053310 (Spiroplasma citri strain C5 plasmid pScpC5-6, complete sequence) position: , mismatch: 3, identity: 0.893

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaattta	Protospacer
*.********* ************** *

151. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP021671 (Bacillus licheniformis strain SRCM100141 plasmid pBL141-1 sequence sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
gcttgttttttttgtttttcttt	Protospacer
 *********.***********

152. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP038626 (Arsenophonus nasoniae strain FIN plasmid pArsFIN14, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
taatgtttttcttgtttttcttc	Protospacer
*  *******************

153. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_010290 (Enterococcus faecium plasmid pJS33, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttctaa	Protospacer
************* ******* .

154. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_LR135381 (Enterococcus faecium isolate E8172 plasmid 10) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttctaa	Protospacer
************* ******* .

155. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MN831412 (Enterococcus faecalis strain M18/0011 plasmid pM18/0011, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttctaa	Protospacer
************* ******* .

156. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MK448714 (Streptococcus phage Javan241, complete genome) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
ttccgtttttcttgtttttcttg	Protospacer
*...*******************

157. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to KT997872 (Uncultured Mediterranean phage uvDeep-CGR2-AD8-C175, complete genome) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
atttgtttttcttgcttttcttg	Protospacer
 .************.********

158. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MH617746 (Microviridae sp. isolate ctcg947, complete genome) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
agttgttttttttgtttttcttg	Protospacer
  ********.************

159. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MH617013 (Microviridae sp. isolate ctdb584, complete genome) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttgtct	Protospacer
******************* *.

160. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
atttgttttccttgtttttcttg	Protospacer
 .*******.*************

161. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
atttgttttccttgtttttcttg	Protospacer
 .*******.*************

162. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_021211 (Pseudomonas sp. GLE121 plasmid pGLE121P2, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttgtttttactt	Protospacer
******************* .*

163. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_022111 (Prevotella sp. oral taxon 299 str. F0039 plasmid, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
ttttgtttttcttgtttttctaa	Protospacer
*.******************* .

164. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NC_020554 (Enterococcus faecium strain HB6 plasmid pAR6, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttctaa	Protospacer
************* ******* .

165. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
atttgttttccttgtttttcttg	Protospacer
 .*******.*************

166. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to AF511037 (Enterococcus faecium plasmid pEFR, complete sequence) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
tcttgtttttcttttttttctaa	Protospacer
************* ******* .

167. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to MN693525 (Marine virus AFVG_25M131, complete genome) position: , mismatch: 3, identity: 0.87

tcttgtttttcttgtttttcttg	CRISPR spacer
ccttctttttcttgtttttcttc	Protospacer
.*** *****************

168. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP053307 (Spiroplasma citri strain C5 plasmid pScpC5-3, complete sequence) position: , mismatch: 4, identity: 0.857

tgaaaataatataattatgataaattga	CRISPR spacer
tgaaaataatataaatatgaaaaatata	Protospacer
************** ***** ****  *

169. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046370 (Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence) position: , mismatch: 4, identity: 0.857

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaagtta	Protospacer
*.********* ************ * *

170. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047441 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence) position: , mismatch: 4, identity: 0.857

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaagtta	Protospacer
*.********* ************ * *

171. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047432 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence) position: , mismatch: 4, identity: 0.857

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaagtta	Protospacer
*.********* ************ * *

172. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP053311 (Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence) position: , mismatch: 4, identity: 0.857

tgaaaataatataattatgataaattga	CRISPR spacer
taaaaataataaaattatgataaagtta	Protospacer
*.********* ************ * *

173. spacer 1.2|24553|23|NZ_CP022245|CRISPRCasFinder matches to NZ_CP015497 (Lactobacillus helveticus strain FAM8105 plasmid pFAM8105, complete sequence) position: , mismatch: 4, identity: 0.826

tcttgtttttcttgtttttcttg	CRISPR spacer
aattgtttttcttgtttttctgt	Protospacer
  *******************

174. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to KX229736 (Campylobacter phage PC5, complete genome) position: , mismatch: 5, identity: 0.821

tgaaaataatataattatgataaattga	CRISPR spacer
ttacaaaattataattatgataaattgt	Protospacer
* * ** * ******************

175. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_042112 (Campylobacter phage CP81, complete genome) position: , mismatch: 5, identity: 0.821

tgaaaataatataattatgataaattga	CRISPR spacer
ttacaaaattataattatgataaattgt	Protospacer
* * ** * ******************

176. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to KX879627 (Campylobacter phage vB_CjeM_Los1, complete genome) position: , mismatch: 5, identity: 0.821

tgaaaataatataattatgataaattga	CRISPR spacer
ttacaaaattataattatgataaattgt	Protospacer
* * ** * ******************

177. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to MH107028 (Campylobacter phage CP39, partial genome) position: , mismatch: 5, identity: 0.821

tgaaaataatataattatgataaattga	CRISPR spacer
ttacaaaattataattatgataaattgt	Protospacer
* * ** * ******************

178. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007391 (Spiroplasma citri pSci5 plasmid) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

179. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007391 (Spiroplasma citri pSci5 plasmid) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

180. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_KU525621 (Bacillus anthracis strain P.NO2 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

181. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

182. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

183. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

184. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

185. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

186. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

187. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

188. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046370 (Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

189. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP046370 (Spiroplasma citri strain BR12 plasmid pScpBR12-2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

190. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

191. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

192. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

193. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

194. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

195. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

196. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

197. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047441 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

198. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047441 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-4, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

199. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

200. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

201. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

202. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

203. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

204. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

205. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_008442 (Borrelia duttonii plasmid DNA, complete sequence, strain: Ly) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
acaaaataatataattaaaataaattct	Protospacer
  *************** .*******

206. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

207. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

208. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

209. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

210. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

211. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

212. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

213. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

214. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047432 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

215. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP047432 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-4, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

216. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP053311 (Spiroplasma citri strain C5 plasmid pScpC5-7, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

217. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

218. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

219. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

220. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

221. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
gccaaataatataattatcataaataaa	Protospacer
   *************** ****** .*

222. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP039706 (Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tataaattatataattatgataaaggaa	Protospacer
*. **** ****************  .*

223. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tataaattatataattatgataaaggaa	Protospacer
*. **** ****************  .*

224. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tataaattatataattatgataaaggaa	Protospacer
*. **** ****************  .*

225. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP045273 (Bacillus megaterium strain FDU301 plasmid pFDU301A, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ccaaaagaatataattatgataactcaa	Protospacer
. **** **************** *..*

226. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_011774 (Bacillus cereus G9842 plasmid pG9842_140, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tttacataatataattatgattaattac	Protospacer
*  * **************** ****.

227. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP042651 (Staphylococcus aureus strain X22 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
aaaaaataatataactattataaatagt	Protospacer
 .************.*** ****** *

228. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP042473 (Spiroplasma citri strain CC-2 plasmid pScpCC2-1, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
ttaaaaaaatataaatatgataaatatt	Protospacer
* **** ******* **********

229. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP014175 (Clostridium argentinense strain 89G plasmid pRSJ17_1, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
aaaaaataatataattatgttatatata	Protospacer
 .***************** ** **  *

230. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to AP019525 (Tenacibaculum phage PTm5 DNA, complete genome) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
acaaaatattataattatgaaaaataca	Protospacer
  ****** *********** ****  *

231. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to MF001358 (Enterococcus phage EF1, partial genome) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tttctataatataattataacaaattga	Protospacer
*    *************.*.*******

232. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to AP019524 (Tenacibaculum phage PTm1 DNA, complete genome) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
acaaaatattataattatgaaaaataca	Protospacer
  ****** *********** ****  *

233. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_020227 (Staphylococcus aureus strain CH-91 plasmid pCH91, complete sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
aaaaaataatataactattataaatagt	Protospacer
 .************.*** ****** *

234. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tgcgaataatataattacgataaataat	Protospacer
** .*************.******* .

235. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to MF001361 (Enterococcus phage EF5, partial genome) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
tttctataatataattataacaaattga	Protospacer
*    *************.*.*******

236. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to JX569801 (Campylobacter phage CP30A, complete genome) position: , mismatch: 6, identity: 0.786

tgaaaataatataattatgataaattga	CRISPR spacer
aaattatgatataattctgataaattga	Protospacer
 .*  **.******** ***********

237. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP039703 (Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
attatttaatattattatgataaattgt	Protospacer
   *  ****** **************

238. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP039706 (Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
attatttaatattattatgataaattgt	Protospacer
   *  ****** **************

239. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
attatttaatattattatgataaattgt	Protospacer
   *  ****** **************

240. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
attatttaatattattatgataaattgt	Protospacer
   *  ****** **************

241. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP013238 (Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
attatttaatattattatgataaattgt	Protospacer
   *  ****** **************

242. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to CP031730 (Stenotrophomonas rhizophila strain GA1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
aaaaaattacataattatgataaatgtc	Protospacer
 .***** *.***************

243. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP026601 (Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
gataaagattataattatgataaattct	Protospacer
 . *** * *****************

244. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
gttaaaaaatataattatgataattttt	Protospacer
   *** **************** **

245. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NZ_AP019717 (Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
attatttaatattattatgataaattgt	Protospacer
   *  ****** **************

246. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_023917 (Clostridium perfringens plasmid pCP-OS1 DNA, complete sequence, strain: OS1) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
ctataataatataattattataaatgac	Protospacer
. * ************** ****** .

247. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to NC_023918 (Clostridium perfringens plasmid pCP-TS1 DNA, complete sequence, strain: TS1) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
ctataataatataattattataaatgac	Protospacer
. * ************** ****** .

248. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to MN693101 (Marine virus AFVG_25M559, complete genome) position: , mismatch: 7, identity: 0.75

tgaaaataatataattatgataaattga	CRISPR spacer
agaaaattagataattatgataaagaag	Protospacer
 ****** * **************  ..

249. spacer 1.1|24491|28|NZ_CP022245|CRISPRCasFinder matches to MN694811 (Marine virus AFVG_250M587, complete genome) position: , mismatch: 8, identity: 0.714

tgaaaataatataattatgataaattga	CRISPR spacer
cttttataatataattataataaatttt	Protospacer
.    *************.*******

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022244_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022244_1

89063-89160

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP022244_1

>merge|NZ_CP022244|1|89063-89160|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP022244|1|1|89063-89160|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022244.1\|WP_005460779.1\|90932_91568_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP022244.1\|WP_005482916.1\|89259_90021_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP022244.1\|WP_031776724.1\|79044_79449_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022244.1\|WP_114868009.1\|85556_86267_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP022244.1\|WP_005487072.1\|99483_101256_+\|Na+:solute-symporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP022244.1\|WP_005464972.1\|84686_85556_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP022244.1\|WP_005464959.1\|79458_80550_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP022244.1\|WP_025591661.1\|88221_89004_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP022244.1\|WP_005467181.1\|90571_90892_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP022244.1\|WP_005460834.1\|93596_94220_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP022244.1\|WP_005482833.1\|80549_81011_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP022244.1\|WP_025628843.1\|96954_99183_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022244.1\|WP_025501296.1\|90039_90564_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP022244.1\|WP_005482884.1\|92655_93585_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP022244.1\|WP_114868010.1\|91645_92557_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP022244.1\|WP_069539386.1\|86269_88138_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP022244.1\|WP_005464962.1\|82357_83506_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP022244.1\|WP_006740949.1\|83799_84606_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP022244.1\|WP_005482845.1\|96261_96939_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP022244.1\|WP_005464966.1\|81456_82296_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061

Protein	Function_ID	Function_description	E-value
NZ_CP022244.1\|WP_005460779.1\|90932_91568_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP022244.1\|WP_005482916.1\|89259_90021_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP022244.1\|WP_005482884.1\|92655_93585_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP022244.1\|WP_114868009.1\|85556_86267_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	3.79011e-39
NZ_CP022244.1\|WP_005487072.1\|99483_101256_+\|Na+:solute-symporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	5.61429e-121
NZ_CP022244.1\|WP_005464972.1\|84686_85556_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP022244.1\|WP_005464959.1\|79458_80550_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.06677e-44
NZ_CP022244.1\|WP_025591661.1\|88221_89004_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP022244.1\|WP_005467181.1\|90571_90892_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP022244.1\|WP_005460834.1\|93596_94220_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP022244.1\|WP_005482833.1\|80549_81011_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP022244.1\|WP_025501296.1\|90039_90564_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.26013e-50
NZ_CP022244.1\|WP_114868010.1\|91645_92557_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	2.34686e-18
NZ_CP022244.1\|WP_069539386.1\|86269_88138_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.87776e-139
NZ_CP022244.1\|WP_005464962.1\|82357_83506_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP022244.1\|WP_006740949.1\|83799_84606_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.88138e-97
NZ_CP022244.1\|WP_005482845.1\|96261_96939_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.08357e-24
NZ_CP022244.1\|WP_005464966.1\|81456_82296_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	5.2905e-143

>NZ_CP022244.1|WP_025591661.1|88221_89004_-|DNA-binding-transcriptional-regulator-KdgR
MEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRNFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP022244.1|WP_069539386.1|86269_88138_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAVQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP022244.1|WP_114868009.1|85556_86267_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVVDDWPIVLKDYLQQPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFVDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP022244.1|WP_005464972.1|84686_85556_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP022244.1|WP_006740949.1|83799_84606_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP022244.1|WP_005464962.1|82357_83506_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP022244.1|WP_005464966.1|81456_82296_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP022244.1|WP_005482833.1|80549_81011_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP022244.1|WP_005464959.1|79458_80550_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP022244.1|WP_031776724.1|79044_79449_-|hypothetical-protein
MMRKFMQILLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGRIYQYHNDLWVPKSDGKLQHFLVSATANYVR
>NZ_CP022244.1|WP_005482916.1|89259_90021_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP022244.1|WP_025501296.1|90039_90564_+|YgjV-family-protein
MVDTSILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP022244.1|WP_005467181.1|90571_90892_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP022244.1|WP_005460779.1|90932_91568_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP022244.1|WP_114868010.1|91645_92557_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFEITHPEMVVFEPEQSNGMGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSIVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLTEKARR
>NZ_CP022244.1|WP_005482884.1|92655_93585_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP022244.1|WP_005460834.1|93596_94220_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP022244.1|WP_005482845.1|96261_96939_+|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP022244.1|WP_025628843.1|96954_99183_+|hypothetical-protein
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGDAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNDKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDLATAVELLPAGGTIILKDGDYQGMEIPLTASGSADKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKTLAPLKQASVIDTQQAIPGKQEAMQLKQLIH
>NZ_CP022244.1|WP_005487072.1|99483_101256_+|Na+:solute-symporter
MEYDYLVIAGYFALMVAISLLFKKMASNSTSDYFRGGGKMLWWMVGATAFMTQFSAWTFTGAAGKAFNDGFAVLAVFVGNMVAYVFAYFYFARRFRQMRVDTPTEGVKRRFGNTNEQFFTWVIIPLSVINAGVWLNGLGVFASAVFNADIVTTIWVTGLAVLAISLLSGAWGVVASDFIQTLVVAVISIACAAVALYVVGGPGEIVENFPGGFIMGPDMNYPLLLVCTFIFFVVKQLQSINNMQESYRFLNAKDSKNASKAALMALVMMLFGAVIWFIPPWASAILYPDAATQYSSLGAKASDAVYLVFARETMPLGTVGLLMAGLFAATMSSMDSALNRNSGIFVRSFYSNIVRKGQASDKELLRAGQIACLVNGILVIMMAQFFNSLKHLSLFDLMMQVATLLQSPILVPLFLGIIIRRTPKWAPWATVVVGMFVSWSVVKIFTPEFVGSWFGMDELTRREAGEMRTMITIAAHLVFTAGFFCLSTLFYKEETDTHKETTAEFFKDVDTECVAEEGQDIVDRMQRAKLGTLVIYMAAGLTLMVLIPNPLWGRLLFLACAASVFAVGYGLKKSAKLDTQPSKVAATTTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022244_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022244_2

640884-641017

Orphan

Consensus_repeat	Method
GGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022244_2

>merge|NZ_CP022244|2|640884-641017|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAAGGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

>NZ_CP022244|2|2|640884-641017|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGG	TCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAA
GGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022244.1\|WP_025789592.1\|650798_651170_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|226653
NZ_CP022244.1\|WP_025794814.1\|649546_650314_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022244.1\|WP_162814244.1\|641221_642760_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP022244.1\|WP_005376117.1\|650470_650668_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022244.1\|WP_162814243.1\|631005_632244_-\|anaerobic-sulfatase-maturase	unknown	unknown	gnl\|CDD\|188457
NZ_CP022244.1\|WP_114868129.1\|633777_634458_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NZ_CP022244.1\|WP_025789591.1\|651400_652402_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022244.1\|WP_025794811.1\|647848_649237_+\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP022244.1\|WP_025789590.1\|652648_655276_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|372509
NZ_CP022244.1\|WP_114868132.1\|643120_644320_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|183528
NZ_CP022244.1\|WP_114868128.1\|632379_633333_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP022244.1\|WP_005462123.1\|635596_635950_+\|DUF3024-domain-containing-protein	unknown	unknown	gnl\|CDD\|371425
NZ_CP022244.1\|WP_005462121.1\|634512_635340_-\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270371
NZ_CP022244.1\|WP_114868130.1\|636829_638836_-\|exoribonuclease-II	unknown	unknown	gnl\|CDD\|179920
NZ_CP022244.1\|WP_005482632.1\|628628_630998_-\|arylsulfatase	unknown	unknown	gnl\|CDD\|293749
NZ_CP022244.1\|WP_025538535.1\|647313_647859_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022244.1\|WP_014234481.1\|644496_646293_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|238206
NZ_CP022244.1\|WP_025553393.1\|635954_636758_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP022244.1\|WP_050505278.1\|627671_628607_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP022244.1\|WP_162814242.1\|625777_627328_+\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|214599

Protein	Function_ID	Function_description	E-value
NZ_CP022244.1\|WP_025789592.1\|650798_651170_+\|transcriptional-regulator	gnl\|CDD\|226653	COG4190, COG4190, Predicted transcriptional regulator [Transcription].	5.7366e-11
NZ_CP022244.1\|WP_162814244.1\|641221_642760_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.44144e-91
NZ_CP022244.1\|WP_162814243.1\|631005_632244_-\|anaerobic-sulfatase-maturase	gnl\|CDD\|188457	TIGR03942, sulfatase_rSAM, anaerobic sulfatase-maturating enzyme. Members of this protein family are radical SAM family enzymes, maturases that prepare the oxygen-sensitive radical required in the active site of anaerobic sulfatases. This maturase role has led to many misleading legacy annotations suggesting that this enzyme maturase is instead a sulfatase regulatory protein. All members of the seed alignment are radical SAM enzymes encoded next to or near an anaerobic sulfatase. Note that a single genome may encode more than one sulfatase/maturase pair. [Protein fate, Protein modification and repair].	0
NZ_CP022244.1\|WP_114868129.1\|633777_634458_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	2.21623e-68
NZ_CP022244.1\|WP_025794811.1\|647848_649237_+\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	6.4905e-08
NZ_CP022244.1\|WP_025789590.1\|652648_655276_-\|AAA-family-ATPase	gnl\|CDD\|372509	pfam13166, AAA_13, AAA domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. This family includes the PrrC protein that is thought to be the active component of the anticodon nuclease.	2.75342e-09
NZ_CP022244.1\|WP_114868132.1\|643120_644320_+\|acetate/propionate-family-kinase	gnl\|CDD\|183528	PRK12440, PRK12440, acetate/propionate family kinase.	0
NZ_CP022244.1\|WP_114868128.1\|632379_633333_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.44878e-31
NZ_CP022244.1\|WP_005462123.1\|635596_635950_+\|DUF3024-domain-containing-protein	gnl\|CDD\|371425	pfam11225, DUF3024, Protein of unknown function (DUF3024). This family of proteins has no known function.	1.37712e-19
NZ_CP022244.1\|WP_005462121.1\|634512_635340_-\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.95335e-86
NZ_CP022244.1\|WP_114868130.1\|636829_638836_-\|exoribonuclease-II	gnl\|CDD\|179920	PRK05054, PRK05054, exoribonuclease II; Provisional.	0
NZ_CP022244.1\|WP_005482632.1\|628628_630998_-\|arylsulfatase	gnl\|CDD\|293749	cd16025, PAS_like, Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	0
NZ_CP022244.1\|WP_014234481.1\|644496_646293_+\|recombinase-family-protein	gnl\|CDD\|238206	cd00338, Ser_Recombinase, Serine Recombinase family, catalytic domain; a DNA binding domain may be present either N- or C-terminal to the catalytic domain. These enzymes perform site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and serine recombinase. Serine recombinases demonstrate functional versatility and include resolvases, invertases, integrases, and transposases. Resolvases and invertases (i.e. Tn3, gamma-delta, Tn5044 resolvases, Gin and Hin invertases) in this family contain a C-terminal DNA binding domain and comprise a major phylogenic group. Also included are phage- and bacterial-encoded recombinases such as phiC31 integrase, SpoIVCA excisionase, and Tn4451 TnpX transposase. These integrases and transposases have larger C-terminal domains compared to resolvases/invertases and are referred to as large serine recombinases. Also belonging to this family are proteins with N-terminal DNA binding domains similar to IS607- and IS1535-transposases from Helicobacter and Mycobacterium.	9.64013e-19
NZ_CP022244.1\|WP_025553393.1\|635954_636758_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	4.0993e-25
NZ_CP022244.1\|WP_050505278.1\|627671_628607_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.91909e-26
NZ_CP022244.1\|WP_162814242.1\|625777_627328_+\|PAS-domain-containing-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	3.44995e-62

>NZ_CP022244.1|WP_114868130.1|636829_638836_-|exoribonuclease-II
MFQDNPLLAQLKQQIQENLPKKEGSIKATDKGFGFLEVDSKTSFFIPPAYMKKCIHGDKVVAIIRTENEREVAEPQELIEQSLTRFIGRVKMFKGKLNVVPDHPQLKKLSLKAKLKKGLKPDNFAEGDWVVAHLVRHPLKGDNTFFVEISEKITDADDKIAPWWVTLAQNDLPNSEPAGIENWELKDDADLERIDMTHVPFVTIDGDSTKDMDDALYAKKTESGDFELTIAIADPTAYITPEDEMDKVARERGYTIYLPGRNIPMLPRDLADNLCSLIEGEIRPAICCTVTVSKDGVIGDDIKFFAANIKSHARLAYDHVSDWLENGNSDAWQPSEEIATIVRDLYEFSLARAEWREKNAVVFPDRPDYRFELSEDNDVIAIHADMRRSANRLVEESMITANICAGRTLREKFETGVFNTHAGLKPEKIEEVVQLVNPEGTLEFTAESIATLEGFAALRRWLAVQETSYLDNRIRKFQAYSEVGNQPLPHYAMGLDIYATWTSPIRKYGDMINHRMLKAVILDKEPVQKPDDQVGEELALHRKHHKIAERNVSDWLYARTLADEPSKQTCFTGEIFDINRAGARVRLLENGAAAFIPGALILDNKERIECNGDNGTISIDKEVVYKLGDTLEIVLADVNQENRSLVAKPTQVFADQPAAQTEQTVSEE
>NZ_CP022244.1|WP_025553393.1|635954_636758_-|helix-turn-helix-domain-containing-protein
MPNIEIIRFNHFTARKSERYTATHNGLYVVEEGALVVHQPNGEQFELKAGDFTLYNSSDLRSAEAIPGENGFKAVALVFDISLFCEFKKAHPGLHSEAEHRRFYPFSPESNSEITQLKNTLLVLASRNAPDYTQSHIAMALLSLMVEVQPDILSIIDDASSLTASQKAIKYIEKNIEKDITLEGLAAHMSMSIATLKRRLAAENLSFSQILKVKRINYAATQLRVSQKSITEIAFESGFKSAAHFSTAFKSIYNITPKDFRNQVVRG
>NZ_CP022244.1|WP_005462123.1|635596_635950_+|DUF3024-domain-containing-protein
MSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVELHHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEEIRWIPYKKLPHSHTLEDLLAELESDPQACFWE
>NZ_CP022244.1|WP_005462121.1|634512_635340_-|phosphate-ABC-transporter-substrate-binding-protein
MLRFTVATLLAMAVSLPSAMAKEVNISGSTSVARVMDVLAEEYNKTHPDNYIAVQGIGSSAGITMVNKGVVKLGMSSRYLTESEKGEDLNVFPIAYDGLAVVVNRTNSVTNLSAQQLFDIYKGEIKNWKEVGGADQPIAVVTREASSGSRYSFESLLGLTKIINDRLVSDISPNNLVVNSNSMVKTIVNHNTRAIGFISVGSVDLSVKAIQFNGIEPTAANIANHKYKLARPFLVLYKVDSLDQAGKDFVAFLKSEAGQKTIADYGYIPVKNFNQ
>NZ_CP022244.1|WP_114868129.1|633777_634458_+|MaoC-family-dehydratase
MKVTNLFKDKVDAISAHQSEFMNWMSPTLRDYWSDFLGKAQNSFLFSNVRDHNQPAVNEEVAPQPAPIVLQPEAQKLHDELSGKIGEVIHTGDWVHVSQERINQFGAVTEDMQWIHTDPERASVESPFKTTIAHGFLTLALLPKLTDSVDADKPLFPTAKLVVNLGLNQVRFPYPVKAGNNVRAVSTLTKVTPIKKGLEIEREIKVEIEGVRRPGAVVVSVIQLHF
>NZ_CP022244.1|WP_114868128.1|632379_633333_+|LysR-family-transcriptional-regulator
MIFNYNLLKSLALLLETKSITATANQMSTSASAVSRTLRSLREIFQDELLTRKNGRMELTPKAISIRAKLNNIIHDIDELTEDMSFDPSTSDIKINIAMNSYIAYWLAPEIIQYFSENAPNIELTIEDWNELTPDRINNQLVHFGIHYFPLNLNKNLVQRKVGKDMSVMVCRKDHPINNESISLETIASYPLAIHLQKHWNERQDKLSRLLLSHGIDFKVKLKTTHINVIINAVETTDLLFPCSIYIAEQLGEKFSYITSSDEVFLPLQEKEFGFIYDKAYKNDPMIVWLHSTISKLMNDFLDVYNKKFDSRYEKSR
>NZ_CP022244.1|WP_162814243.1|631005_632244_-|anaerobic-sulfatase-maturase
MAGLHTTVKVVGSKCNYDCQYCFYLEKDLLLKSKKSMNIETLETYIKNYISSQDTPIVEFAWHGGEPTLIGIDFYEKAVEFQKQYANGKLIKNTIQTNGSKLNSDWCRFFRENNFLVGLSLDGPEWLQEKYRTKQGKSAFKESFSALKLLQKMNVEYNVLACVTKEYCKHAEAIYSFFRKNKVKHIQFSPLVESSPLETEQARGQHFGSNLIFSTDKHHTDPQKYEPIAWSVDAKEYGRFLTDVFHLWVSQDVGKVFISNFEQALTQYLGNPSPNCIHAKKCGSSYAVEANGDVYFCDHVAYPESRLGNVFETSLHEMSLNHELQFNKESRLSMRCKQCQFLSLCNGGCPKHRYLSDTGEYENVLCDGYFYFFSSVQKYLQAMTTLLAHGYPASYVMQALDGPLILTPSNKR
>NZ_CP022244.1|WP_005482632.1|628628_630998_-|arylsulfatase
MDILKTTVTITGALAPCLVAAGTVDRTKLPIPDIEPQTYTQLDVRDVQRPEPTRRIAAPKDAPNVLVILLDDVGFSQSSLFGGAVDMPTLDALAKQGLIYNQFHTTGVSSATRTALLTGRNHHQNNMGSIAETSTAFPGNTSVRPNYIAALPKILKYNGYSTAMFGKNHEIPAWETGPAGNQTLWPSEVGFDKFYGFFGGETDQFQPVLIDGNTRIKTPRKKNYHFTADMTDQTIKWLNLQHSYNADQPFFAYYAPGAAHAPHQAPREWIDKFKGKFSMGWDKLRQESFERQKKLGIIPQDTVLPPMPDFVPRWDSLSSDEKRVFERQMEVYAGFLAHTDHEIGRVIDTLKKNGEFDNTLIFYIVGDNGASAEGNRNGSFNSLAFYNLITEDPNRVLENIDKLGGPDSFPHYASGWAVAGDSPFTWTKGMSSDFGGTRNGMVVSWPAGIDNKGQPLRDQWSHVVDIAPTVLEAANLPVPKEVDGVEQIPMAGVSFTNTFKETKAQTRHKPQYFELGGNRAIYHEGWLARVTHWALTEGSTKFRDLQDDKWELYDTTKDFSLANDLAKSNPQKLEELKKLFDKEAEKNHVYPIDDRTMERVNAEIAGRPDALFGKKSLTLYEGARGIPENSFLNIKNKSFDIVADISTDNASKTNGVIIAQGGNFGGWTLYVKNGVPTFEYNWLTYEYTKVSGSKLKEGKNEIKVAFRYDENGQGGKGNAAGRGKGGNVYLYVNDKLVEKKLIPNTNSRLFSLDDGVGIGEDEGGAVSKDYQAPFEFNQKIEQVTTSIVQ
>NZ_CP022244.1|WP_050505278.1|627671_628607_-|LysR-family-transcriptional-regulator
MLIVAQESLLTPVDFPNNSLLEFKMSKAIDLNLINTFIVVTECLSYTKAADKLGVTQPAISASIKRLERTTNTKLFTKRGRNIELTSTAQKWLPQLQQALSVIDSVITQPAPYNVYCSNIYPAQQSKLENVFFHESTLSENHLFSLLYSNEADLLLGDIESREASIIVEDVCREPCVVICRNGHPRIGDHISTEMLSDEKHCVLASKWSFDTEFEKHLGLIVKSNNIDSIASNYLGILTHVAQNDCIGVIPLSLAKKWGKTFNIKHFTSPLGACFIQYQIAYHQRKVNCKRHGAMRALIKSKVLEGQQRII
>NZ_CP022244.1|WP_162814242.1|625777_627328_+|PAS-domain-containing-protein
MSEKEYDYPASYSLVSITDPSSYIKYASAHFNEVAGFEEGELIGKPHNVVRHPDMPKQAFKDLWSHLKAGKHWMGMVKNRRKNGGYYWVDAFASPIKYNGEIVEYQSVRFKPERIYVKRAEKAYAKLRNDKKPLQLYLPRTRLWMRAAFFLFISNFLGLLLLEMNQSPMVAFSAAALLSALSIYMLTRPIQKLAKQARQDFNNPLMEYIYCGKVNDLAEIELAMKMRKQFANALLGRVGVSVKDSCEETKTNADSAAYNSERVTENLSAQKIEIDSVATAVNEMQASSSEISHNAQATADATLKAQNTMTDSRNVIDNVNHSVLDLVGELGEISKVVMRLNQQTDQIGTVIEVINGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAKRTQESTTEIKSAIESIQHGSKSAVSALEKGNEMSTGTVTLLGTALESIQQLESLIQDVVERNQQIAVAIEEQVYVTDEINENIQSLNLKYSESYDLMTETNQMNSRVQNCTNELSDMIKKFA
>NZ_CP022244.1|WP_162814244.1|641221_642760_-|EAL-domain-containing-protein
MTKNICSKTEVPGWTWLLMLISCFIFAYAAFLHAIMKKPVASLLETGVSLLLFGGSIFVVLVIKWSNDSILELHSVAEREKRNAVHDSLTGLPNRKYCFELIDDRIQSGDPFSVILFDVVNFKQVNDAMGHFCGDQLLIQIGQRLQDKLKGNDKIFRVGGDEFVILTSSACEKTGTELIESLDCALSARFHLDEFQVSSRVVFGISTYPYDAISNDLLIKHADIAMYHAKRNGNLFAFYHDDMNVGAKYQLEISSRIQCALEKEEFQLYYQPLIDANTNLAVGFEAVIRWHDENGKTISPNDFIPIAERSNQVHNITMWVLGQVEKDLKTFIETGIKLPVHVNLSAKDLSSNLLFHRLEKLLENNPQFADLISLEITETMAIDRVVELNPLIHQIKGLGIKISLDDFGTGYSSLSLLRDLPVDQIKIDRSFLCTANRTEGSRSIVENTIALAHGLGYSVVAEGVQDMDTLYFLRSRGCDIIQGYLFCPALPLNEVINWVNEHDDKQSHTRRA
>NZ_CP022244.1|WP_114868132.1|643120_644320_+|acetate/propionate-family-kinase
MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARMSWKFNGEKKEISIEGDDSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTKTVRITEEVTQEIEKLADLAPLHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFTGAIAKELYTDFGIRRYGFHGTSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAINNGESVDTSMGFTPLSGLMMGTRCGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVSGLTSDARGILEAMEEGHEGAALAFQVFTYRVSKYIASYLAALDSFDGIIFTGGIGENSMPIRREILKNLKLLGFVEDVKGNEDARFGNAGVVATSELLGAKALVIPTNEEWVIASQSVELLNQ
>NZ_CP022244.1|WP_014234481.1|644496_646293_+|recombinase-family-protein
MDEKPRIAHIYSRVSKGTQVKGDGLRRQIEIASKFIEDVNISNSRDGLPVYTLADSPIYDRGLSAYFGLNTDENAGLGAFLKAAENGQVEKGTLLIVEAIDRISRLPVDDARALFARFKKYGIDVAICRFNLIIYHDKSSDLGQDLLITTAIHLAHLESEQKSKRIRARFTHKRLLEKEGGERRTSMSPSWIELSKDKTHFVLIPERARIVRKMVDLKLQGWGAHRITVYLNEQGYPCWNRSNTWYTKIVEKYLKMIQLVGDFQPVEHVHGEKGVRKEPVGDVIKGYYPALITEEEWIRLKASFKRSGGRQTGAFSNLFSCMLYCPTCGSCMSYFKPNRGRIKVRCRKQIDKQGCDQRALNYEEIEPRLIKALAGLDYAKINNNSFASLQKELNTLEAQVAELEASADDIKTQMLEESDPRIISVYVNKLKAIYTEQDKAKARFEKLSTQTSDYDVNTLEQLQLERNEDRERYNGFVRSFVKYVIASDSKLGKPLRIVFKSEAVGEVPVFFNDDKNNKAISDIFTAQKDVNEAAPIRLINMSRVHGNLGKLAAIDTVPVPDDLGDALERIKYLFAVRQAVLQNPEKWQAIADDARLFE
>NZ_CP022244.1|WP_025538535.1|647313_647859_+|hypothetical-protein
MKHDMLDILRSVGAKDFRAIETAIKTVKKEKYKPRKEPGDLQIKSVKTNLTEKEYQELVKKQCMAGYSKLSAFTRDVINNAVKVKPIILEASKEFFTETSELSDQIKTIATDIENSKALTRDEIESTLVILAGLLREFQATRHLLVNSFTQEAAYEIAKQHLSEDKLVQALKEFRGSSHDL
>NZ_CP022244.1|WP_025794811.1|647848_649237_+|relaxase/mobilization-nuclease-domain-containing-protein
MIYKEPAQKGGEHTEQTVDALIKYVAGDDERVAKYLVNYGAGITKSADAVTEFIYANNIIHIPVNAKNAPGEMLDMALAIREMQESIRLNPTAKQQFKHMIVSLDTNESLTNFQWCKTAKKLMNHLGYANCRYIAFKHNDTDEQHIHVVTSTIDIVTRKRIKDSYSKIRAQEVMRELEIEFGLRQLVSSNKIGYDSYADINDAKIFNKKAQIARLVKTGINKLKPRSNLAEFVTAVESTHSSLKVELQTKKGVAVGIVFNLDGVRMSASQLGGNRKYTLGKLIGNGILHDACKDLSNYEEELERAAAHAQEQSDNALRVYESKQDQDMRSYLVMLSVNVRYRKEVEQFIDDMKWNLRARKRLKGASDVVYVVEMISMLKDVEMGFETVIEALFLDTLDKAFSCITKRKTMENVFENLSTKQISESDYKTFIATAHVDILHKNDKPQRSSVNKLLESIISQDH
>NZ_CP022244.1|WP_025794814.1|649546_650314_+|hypothetical-protein
MANYADAMNVAIDKKRNNILDDGKNFTPYRHRKGMTLYLRLNIKRCDEEVRNGCPKNKVVIVAKKRIDDIPKYTFEEFLENDVTECVKSGEYNVTKGAYDKFIAKHKSYYRIYHEAKVNECRGYFDIDRAGIKKEAAKISKPIHDVADIVEKLALDGLLTAVEAQDLYQSMYRIKQVLDAYVMPDILFQNMLFYDKKLTDKIKTYNHLSNFKISSKANADRFVKHMSKIDSFETGNRVKKLSTERKVLESLCSSL
>NZ_CP022244.1|WP_005376117.1|650470_650668_+|hypothetical-protein
MNDDIHEQLGVNKSFLNETFAMIRISKNGEVWVQYQDKMDIPSGSKAINITADVLKIIALYKSSE
>NZ_CP022244.1|WP_025789592.1|650798_651170_+|transcriptional-regulator
MKARIGIADEELVRKYMLDVSAGKLNHVENFPHLWFTSLTELAQVLTNENIKLLYMISRDRANNVRKLSEITGRSVEELSISIDDLASKGFVRIDRCGNEECLTAIYTSFEVLMGKELEDLLL
>NZ_CP022244.1|WP_025789591.1|651400_652402_-|hypothetical-protein
MNKNLVNISLEEQQAQLESRKHYTFFKDGYIDGYSFAFGLFESLWLDGFDVKNPTDLLNALCLLIENEHVEQKKVFETHINDMTPEAYAMYPEGKTILFHCTFFLHNIHNYISHIGERVIQIPRTEKDMLYSWWLKRENVYTYTYLDTFMKQFTEILDSMPSFRPMVMNLHISRHIPDEEFSAYSTIIKKEERSKHIVERINEAINQEFYLEAIALEESCISDRLSLVLYLKGQKAGTKSFAKLTELCDEFLPKNLKRDVDSWRKERNRSIHNLVRSSPLEEMIDLEELDLLSVYTAKKGLKLLDDVNIWFEEFILSEMNPFCLRLQEEVTLN
>NZ_CP022244.1|WP_025789590.1|652648_655276_-|AAA-family-ATPase
MIKNEYLRFLQTLNAEEVSAGVRKVANLVFAHFEEVYPLGTTQGKRVKKVASLASNQWANLSDAIAEVTYETGNAGKMFKQLKSIEIGPFRGFAKKESLSLHSLLVLIYGPNGTGKSSFCEALEYGLLGAVEEAQNKRFRNQDDYLKNAHTNSFSPPQILGVDHQGNDVVLQPDESLYRFCFVEKNRIDSFSRIAAQAPAKQMELISTLFGLDSFNEFVKNFSPEIDGKYIDLVGEKSVQLNLKRQTLVGHQQQIEQNNTNLKQLGGEEAALAQQYRLGCTYNQMMIELNGDDQNPGLISKLETDLQQPVYAKSGLTQARLAIIRSEINTNLANYNASQQELVNASQQVSFKQLYESVSKLQANSPDKCPACKTPLTQTALNPYAHADEELQKLQHLAVLQAKSQEYYQSLNQSLAELSQVINVSCDRLTANPLHKFRLASNIQPTIKWFNSMLQPSQGGYTAWQHLEAQVQQLEQSDTAIEQQVQVRTAKQQELNRLRGFAKSITVLQTRRQTAQTTFEKATQAIASFDQENAELISSVEGEKHVVARNKEIVSAYASFVEKLNAYKNALPVKLVADLSEKVTELYNAFNRYDSPNDKLAAVQLPLGQNQRLKISFQAEPEKHFDALHVLSEGHIRCLGLAILLAKNIKTDCPLLIFDDPVNAIDDEHRQAIRETLFKDEFFNAKQIIMACHGEEFFKDTHQTIGSKAAKSAESYIFMPQKGERHVQVLSLQRPKNYVLAASELYAQAEYRDALMSSRRALEHLCEKAWLHYGKHCDNTDKPISVSRRTPHAPWDLRALADNLRSKLNKSKAAIPNKADIVVALDSLLGVGGQDPHWVYLNKGTHEETDRVEFENGTVGTIVSSLDALDKALEV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1029215 : 1037846

Vibrio_phage(87.5%)

coat

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_114868423.1\|1029215_1029584_-	hypothetical protein	Q858Q3	Vibrio_phage	1.2e-41	71.2
WP_114868204.1\|1029767_1030385_+	3'-5' exonuclease	W6ASW5	Vibrio_phage	5.4e-39	48.7
WP_114868205.1\|1030388_1032419_+	replication endonuclease	A0A0F6YPA7	Vibrio_phage	9.4e-197	53.2
WP_005389159.1\|1032502_1032808_+	hypothetical protein	Q2PZB5	Vibrio_virus	1.1e-19	51.0
WP_114868206.1\|1033078_1033342_+	hypothetical protein	R9TI50	Vibrio_phage	3.4e-06	41.7
WP_024701224.1\|1035043_1035403_+\|coat	minor coat protein	R9TIT8	Vibrio_phage	4.6e-22	45.6
WP_025816149.1\|1035402_1036476_+	hypothetical protein	O80263	Vibrio_phage	2.1e-126	63.1
WP_025522920.1\|1036493_1037846_+	type II secretory pathway protein	R9TEZ5	Vibrio_phage	3.0e-122	57.2

DBSCAN-SWA_2

1583824 : 1644098

Bacillus_phage(18.18%)

coat,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005462928.1\|1583824_1585294_+\|transposase	transposase	NA	NA	NA	NA
WP_025553720.1\|1585457_1586942_+	hypothetical protein	NA	NA	NA	NA
WP_005478159.1\|1586925_1588509_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-16	39.5
WP_114868354.1\|1588754_1589135_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_005478401.1\|1589134_1590265_+	HlyD family secretion protein	NA	NA	NA	NA
WP_005375133.1\|1590602_1591151_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_114868355.1\|1591157_1592897_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-20	35.1
WP_023623825.1\|1592893_1593733_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_005499771.1\|1593815_1594997_-	MFS transporter	NA	NA	NA	NA
WP_114868356.1\|1595199_1596054_-	quinol dehydrogenase ferredoxin subunit NapH	NA	NA	NA	NA
WP_015313573.1\|1596053_1596824_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	7.3e-09	28.1
WP_017447264.1\|1597219_1597720_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_047731639.1\|1597766_1598741_-	phosphotransferase	NA	NA	NA	NA
WP_114868357.1\|1598743_1599019_-	N-acetyltransferase	NA	NA	NA	NA
WP_011106523.1\|1599160_1599904_+	flagellar brake protein	NA	NA	NA	NA
WP_017447262.1\|1600027_1601656_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-20	38.8
WP_015313576.1\|1604437_1604935_+	hypothetical protein	NA	NA	NA	NA
WP_114868358.1\|1606891_1608925_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	4.8e-68	31.9
WP_005499789.1\|1609040_1609940_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005462890.1\|1610102_1611794_+	L-lactate permease	NA	NA	NA	NA
WP_005462889.1\|1612108_1613248_+	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_005462888.1\|1613341_1613689_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005462887.1\|1613948_1615046_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_005485792.1\|1615129_1615846_-	carbonic anhydrase	NA	NA	NA	NA
WP_114868359.1\|1615987_1616956_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_162814271.1\|1616952_1619328_-	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_025523328.1\|1619387_1620167_-	molecular chaperone	NA	NA	NA	NA
WP_031777419.1\|1620167_1620665_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_025636109.1\|1620704_1621250_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_005478141.1\|1621650_1622682_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
WP_005485813.1\|1622847_1624041_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	3.6e-39	28.5
WP_114868361.1\|1624253_1626578_-	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
WP_005462861.1\|1626574_1627507_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_010446562.1\|1628788_1629709_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7
WP_005462859.1\|1630585_1631101_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	5.5e-45	59.6
WP_114868362.1\|1631128_1632502_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_162814272.1\|1632526_1633258_-	response regulator	W8CYM9	Bacillus_phage	2.5e-27	30.5
WP_025555830.1\|1633430_1634126_-	hypothetical protein	NA	NA	NA	NA
WP_024702149.1\|1634135_1634819_-	hypothetical protein	NA	NA	NA	NA
WP_114868364.1\|1635039_1635513_+	hypothetical protein	NA	NA	NA	NA
WP_162814273.1\|1635590_1636895_+	VOC family protein	NA	NA	NA	NA
WP_114868365.1\|1636942_1638382_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_072828667.1\|1638532_1638892_-	hypothetical protein	NA	NA	NA	NA
WP_021450562.1\|1639055_1639445_-	cytochrome b562 family protein	NA	NA	NA	NA
WP_031832216.1\|1639598_1640351_-	phosphatase	NA	NA	NA	NA
WP_005462830.1\|1640490_1640943_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_114868366.1\|1641043_1641970_-	DMT family transporter	NA	NA	NA	NA
WP_114868367.1\|1642082_1642973_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017447239.1\|1643060_1644098_+\|protease	trypsin-like serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	4.6e-14	28.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP022243

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022243_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022243_1

1014530-1014738

Unclear

Consensus_repeat	Method
GTGTCCTGCCGAATAGGCAGCTAAGAATG	CRISPRCasFinder
GTGTCCTGCCGAATAGGCAGCTAAGAATG	CRT

3 spacers

cas6f,cas5f

The CRISPR arrays of NZ_CP022243_1

>merge|NZ_CP022243|1|1014530-1014738|CRISPRCasFinder,CRT
GTGTCCTGCCGAATAGGCAGCTAAGAATGCGTCCCGAGTTTTTGGGCATGATGCACGACGGTGTCCTGCCGAATAGGCAGCTAAGAATGCTCGATGCAAGTCGAGAGTTTTTGCAGGATCGTGTCCTGCCGAATAGGCAGCTAAGAATGTCGTGAAATAGAACATTTTGAACAAAAGTCTGTGTCCTGCCGCGTAGGCAGCTAGGAATA

>NZ_CP022243|1|1|1014530-1014738|CRISPRCasFinder
GTGTCCTGCCGAATAGGCAGCTAAGAATG	CGTCCCGAGTTTTTGGGCATGATGCACGACG
GTGTCCTGCCGAATAGGCAGCTAAGAATG	CTCGATGCAAGTCGAGAGTTTTTGCAGGATC
GTGTCCTGCCGAATAGGCAGCTAAGAATG	TCGTGAAATAGAACATTTTGAACAAAAGTCT
GTGTCCTGCCGCGTAGGCAGCTAGGAATA

>NZ_CP022243|1|1|1014530-1014738|CRT
GTGTCCTGCCGAATAGGCAGCTAAGAATG	CGTCCCGAGTTTTTGGGCATGATGCACGACG
GTGTCCTGCCGAATAGGCAGCTAAGAATG	CTCGATGCAAGTCGAGAGTTTTTGCAGGATC
GTGTCCTGCCGAATAGGCAGCTAAGAATG	TCGTGAAATAGAACATTTTGAACAAAAGTCT
GTGTCCTGCCGCGTAGGCAGCTAGGAATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022243.1\|WP_114867352.1\|1023154_1023640_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022243.1\|WP_114867346.1\|1009448_1010660_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377670
NZ_CP022243.1\|WP_162814161.1\|1023795_1024008_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|179020
NZ_CP022243.1\|WP_114867354.1\|1024248_1024491_+\|DUF2384-domain-containing-protein	unknown	unknown	gnl\|CDD\|378249
NZ_CP022243.1\|WP_114867956.1\|1005316_1006183_-\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198394
NZ_CP022243.1\|WP_039483175.1\|1002982_1003297_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP022243.1\|WP_114867343.1\|1003937_1005320_+\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|223989
NZ_CP022243.1\|WP_114867347.1\|1010662_1012750_+\|hypothetical-protein	cas5f	cd09736_cas5f_CAS-I-F	gnl\|CDD\|187867
NZ_CP022243.1\|WP_114867356.1\|1032704_1033313_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022243.1\|WP_114867355.1\|1024887_1025928_+\|SMEK-domain-containing-protein	unknown	unknown	unknown
NZ_CP022243.1\|WP_114867957.1\|1013795_1014401_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	cas6f	cd09739_cas6f_CAS-I-F:CAS-IV	gnl\|CDD\|187870
NZ_CP022243.1\|WP_114867348.1\|1015123_1016200_+\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	unknown	unknown	gnl\|CDD\|335469
NZ_CP022243.1\|WP_114867344.1\|1006825_1008418_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379114
NZ_CP022243.1\|WP_114867955.1\|1001888_1002986_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|377533
NZ_CP022243.1\|WP_114867342.1\|1003398_1003944_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022243.1\|WP_114867345.1\|1008882_1009305_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022243.1\|WP_159408350.1\|1024601_1024739_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022243.1\|WP_114867351.1\|1022044_1022872_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|377369
NZ_CP022243.1\|WP_114867350.1\|1018797_1019391_-\|DUF4123-domain-containing-protein	unknown	unknown	gnl\|CDD\|379225
NZ_CP022243.1\|WP_114867349.1\|1016223_1018785_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030

Protein	Function_ID	Function_description	E-value
NZ_CP022243.1\|WP_114867346.1\|1009448_1010660_+\|hypothetical-protein	gnl\|CDD\|377670	pfam06527, TniQ, TniQ. This family consists of several bacterial TniQ proteins. TniQ along with TniA and B is involved in the transposition of the mercury-resistance transposon Tn5053 which carries the mer operon. It has been suggested that the tni genes are involved in the dissemination of integrons.	5.54378e-11
NZ_CP022243.1\|WP_162814161.1\|1023795_1024008_+\|hypothetical-protein	gnl\|CDD\|179020	PRK00430, fis, DNA-binding transcriptional regulator Fis.	1.40927e-08
NZ_CP022243.1\|WP_114867354.1\|1024248_1024491_+\|DUF2384-domain-containing-protein	gnl\|CDD\|378249	pfam09722, DUF2384, Protein of unknown function (DUF2384). Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. The function is unknown.	9.26529e-11
NZ_CP022243.1\|WP_114867956.1\|1005316_1006183_-\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198394	cd10447, GIY-YIG_unchar_2, GIY-YIG domain of uncharacterized hypothetical protein found in bacteria and archaea. The family includes a group of uncharacterized hypothetical proteins, mainly found in bacteria and a few found in archaea, with a GIY-YIG domain that shows statistically significant similarity to the N-terminal catalytic domains of GIY-YIG family of intron-encoded homing endonuclease I-TevI and catalytic GIY-YIG domain of nucleotide excision repair endonuclease UvrC.	8.64546e-38
NZ_CP022243.1\|WP_039483175.1\|1002982_1003297_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	7.5899e-13
NZ_CP022243.1\|WP_114867343.1\|1003937_1005320_+\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	1.48991e-29
NZ_CP022243.1\|WP_114867347.1\|1010662_1012750_+\|hypothetical-protein	gnl\|CDD\|187867	cd09736, Csy2_I-F, CRISPR/Cas system-associated RAMP superfamily protein Csy2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; predicted Cas5 ortholog.	3.38096e-18
NZ_CP022243.1\|WP_114867957.1\|1013795_1014401_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	gnl\|CDD\|187870	cd09739, Cas6_I-F, CRISPR/Cas system-associated RAMP superfamily protein Cas6f. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6f is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-F subtype; Possesses RRM fold; also known as Csy4 family.	1.94068e-53
NZ_CP022243.1\|WP_114867348.1\|1015123_1016200_+\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	gnl\|CDD\|335469	pfam03781, FGE-sulfatase, Sulfatase-modifying factor enzyme 1. This domain is found in eukaryotic proteins required for post-translational sulfatase modification (SUMF1). These proteins are associated with the rare disorder multiple sulfatase deficiency (MSD). The protein product of the SUMF1 gene is FGE, formylglycine (FGly),-generating enzyme, which is a sulfatase. Sulfatases are enzymes essential for degradation and remodelling of sulfate esters, and formylglycine (FGly), the key catalytic in the active site, is unique to sulfatases. FGE is localized to the endoplasmic reticulum (ER) and interacts with and modifies the unfolded form of newly synthesized sulfatases. FGE is a single-domain monomer with a surprising paucity of secondary structure that adopts a unique fold which is stabilized by two Ca2+ ions. The effect of all mutations found in MSD patients is explained by the FGE structure, providing a molecular basis for MSD. A redox-active disulfide bond is present in the active site of FGE. An oxidized cysteine residue, possibly cysteine sulfenic acid, has been detected that may allow formulation of a structure-based mechanism for FGly formation from cysteine residues in all sulfatases. In Mycobacteria and Treponema denticola this enzyme functions as an iron(II)-dependent oxidoreductase.	1.34941e-23
NZ_CP022243.1\|WP_114867344.1\|1006825_1008418_+\|ATP-binding-protein	gnl\|CDD\|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	5.08015e-08
NZ_CP022243.1\|WP_114867955.1\|1001888_1002986_+\|AAA-family-ATPase	gnl\|CDD\|377533	pfam05621, TniB, Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.	1.69054e-12
NZ_CP022243.1\|WP_114867351.1\|1022044_1022872_+\|restriction-endonuclease	gnl\|CDD\|377369	pfam04471, Mrr_cat, Restriction endonuclease. Prokaryotic family found in type II restriction enzymes containing the hallmark (D/E)-(D/E)XK active site. Presence of catalytic residues implicates this region in the enzymatic cleavage of DNA.	6.35937e-35
NZ_CP022243.1\|WP_114867350.1\|1018797_1019391_-\|DUF4123-domain-containing-protein	gnl\|CDD\|379225	pfam13503, DUF4123, Domain of unknown function (DUF4123). This presumed domain is functionally uncharacterized. It is about 120 amino acids in length and contains several conserved motifs that may be functionally important. This domain is sometimes associated with the FHA domain.	1.64785e-14
NZ_CP022243.1\|WP_114867349.1\|1016223_1018785_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	5.78853e-06

>NZ_CP022243.1|WP_114867957.1|1013795_1014401_+|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4
MTKRYYFCIRYTPVQADYELLAGRCISQMHLFMVNNRQSINKIGVSFPDWSDVTVGQTIAFVAEDKEMMIGLSFQPYFSMMVNEGLFEISNVFEVPDNAIEVRFTRNQTIGKSFLGSKKRRIKRSMARAELLDVGTSLPVTNEERIVDSFHRIPISSGSSGEDYILFVQKEFVSERGAVNFNSYGLATNQERKGTVPELRF
>NZ_CP022243.1|WP_114867347.1|1010662_1012750_+|hypothetical-protein
MTKLSDLLAIEDEAVKQITLKKVFMPYTEDVCVEGFEKEALTILLNLSSSHQSDRCSDWLDVARAKRHLKAAENLEASLDEIKWFHTHNLKFPDCRVKDQRIVARPLTTTEVFISSGVLEQRLGWAHNSAVYRHTLWLLNPFNWQSQSVCILSLIQQESPVWVELLKEFGLGAKSLARLKHTIEEQLLDNHFPDSVSPYSKQLRFPWGDDYVSVTPVVSHAIQSELEVRSRSRESKLRFMSSSLPNSASIGNLCGSLGGNMKALNYPLEVKPSKGGTLTESRKKSGHYFDDYQVTNAKICQVLNHLIGSEPSKTQKQRESARKVRSKILRKQIALWMLPLIELRDIVDADLNQQRLKHDDTLAQAFLVLPESDLGSLASEFNRRLHLTLQNNKYTAKFAYHPMLMQLVKAQIVWILQQLSKPSGHEDKVTGEQYIYLSSMKVQDAVAMSSPYLCGALSLTAIWGFMHRYQREFNKLVNSISLFEFSSFSFYVRSENIQSTAKLTEPNSVAKARTVSNAKRPTIRSERLADLEIDLVIRVHSESRISDFKAALKTALPVAFAGGALYQPQLSTQIEWLRTFTSRSELFHVIKGLPAYGRWLYPSENQPSDFDDLEHLITKDADNLPVSIGYHLLERPTKRCNSITDRHAYAENAIGLAKKVNPIEVRFSGRDHFFNHAFWSIECSSETILIKNYRD
>NZ_CP022243.1|WP_114867346.1|1009448_1010660_+|hypothetical-protein
METDIQLYPDESLESFLLRLSQEQGYERFFHFAEDIWFDTMEQHEAIAGAFPLELNRVNIYHAQTTSQMRVRVLIHLENQLKLINFGVLRLALSHSKAQFSPQYKAVHRFGVDYPYAFLRKRFTPICPLCIDEAPYIRQQWQFISHQVCEHHGCKLVHHCPECKSRLEYQSTDSINQCECGFELRNSPVEDAPEAEVLVARWLSGNDSKPLGLLTGEMTLSERYGFLLWYVNRYGDIDDLSFESFVEYCCAWPTELWQDLDTLKEKAELVRVKDWKKMFFNEAFGALLKDCRQLPSRQLSHNTVLTQVLAYFTQLMATVPSSAKGNIGDVLLSPFEASTLLSCTTDEVYRLYEFGEIKAAIRPRMHTKIASHESAFTLRSVIETKLTRMSSESDGLSVYLPEW
>NZ_CP022243.1|WP_114867345.1|1008882_1009305_+|hypothetical-protein
MSKKEEHVLHPYFSSSKYYEELWLKAEIVEETPVKVRFFVDPPVGWNADEVTLLENHFKEFGLAEKFALFVAHAVVTEIDTVDISLNRRDLRVEVIQEDFELKANNRPSINSPIAAMYRAMSESRWFCSEPRKHEENGYI
>NZ_CP022243.1|WP_114867344.1|1006825_1008418_+|ATP-binding-protein
MKFKMIPRNAFAPQKGVSTCYLEIDNWNDYSFITTFSLSLHDEKGDFHKIGNVRIGFVGQTVKTATYEKLDDVFEGGLPSDFFSLGMHKEYYEELYKLNDRLREKLLHALRDVVFSQKYLSIAEEQDVFGTALLRDTSMAAVKGKYSRLLAGLKELTPYDFAFVPLGDMFGGKQLEFNVIDDSMPSTNIHAIIGKNGTGKTTFLNNMVEAIINPTPDGSKVIDLDSYLEPKPQIGSDYFSSITSVSFSAFDTFTPPKEQPNPAKGTCYFYVGLKNPDKEGTLKTLDELREDLCESMLDCFYDPKQQKLARFKYVIELLEFDQNIKSLNLTKYHEEYVELIKEYPGFDEYKFRTICRERFLEILPPMSSGHAIVLLSTLNLIATVDDKSLVLIDEPESHLHPPLLAAYIRALSWLLNQVNGVSIIATHSPVVLQEIPKNCVWKVIRSETETTVSRPVRETFGENVGILTREAFGLDVEKSGFITVLDNAVKSGGTFEHIYHNTFGGCIGAEGVTLLRILVDIRDRENAKND
>NZ_CP022243.1|WP_114867956.1|1005316_1006183_-|GIY-YIG-nuclease-family-protein
MTRGTQLKIYLANGSVTGIRHAEIVNWTGQAIAVPRVHIKELSVWEETQRPGVYFLFGYDADSGNNLVYVGEAEHIQKRLSQHLAGKEFWNEAICFTNKDENLTKAHVKYLEARLIEIILESKRYDLDNDKQPPTSSLPRGERDAMETFIDNIRTVIGSLGHKLLEPRVSQPASPQTNEQENTVLQLKVKKVDAKAMLTDEGIVVLKGSQALTIAQPSLSKGYTKLRSSLEDKGVLTPSGDRLVAAEDILFTSASQAAAVLLGYPCSGPDYWRDSSGKTLKEIEAESV
>NZ_CP022243.1|WP_114867343.1|1003937_1005320_+|DEAD/DEAH-box-helicase-family-protein
MLRTWQAECVELAINKFSSNRRPHFFCQATPGAGKTVMAAEVAKRLFQEGMIDLVLCFSPSLSVAEGMKKTFSWKLECSFNGGLGSLGGSYTYQSIRFLDENFWNTVSKYRVLVVFDEIHHCSFDDEGRSNSWGQEIVSKIQGFARYTLALSGTPWRSDRLPIVMAEYSDPDGKVVCDYHYGLQQAVVDKVCRRPKIVLIDNEHLSVNAGRDNQHFASILDCLKQSDVSYHSVIHNEDAMNYILNSGCQKLAQIRQESPNAGGLVVAASIKHAKHIQKRLIEHFHQSACIVTYHHDNPLNEIESFRHSNVQWIVSVGMISEGTDIPRLQVCCHMSSVKTELYFRQVLGRILRVNDSPNQEAWLYTFAEESLIGFAERIEQDIPDSCLYIKQENNVPSAIDEKHLPPSTVSESIQSDRPQPSLLNWGEASDVINSNNVGLTLAMDELRLGQFKQRVIAAFT
>NZ_CP022243.1|WP_114867342.1|1003398_1003944_+|hypothetical-protein
MKKVNRINPDMFNLLIEKGMDDFSVIEARDALLNGTSTFTSSDEARKYVYKQLLSLEEKGWLSVIGTRRGKRYHQTNEFKALIIEPRAARNKKAKVDSITVQTPELSLNALEQEKKQHEGELAITLGEIEEYQSLLTRFPNNKHDMEPLFNAARERSAKLLGKINALTNWMQVAQSKASQC
>NZ_CP022243.1|WP_039483175.1|1002982_1003297_-|helix-turn-helix-transcriptional-regulator
MQKDNPIPARLKAARKKAKITQKDLGVKIGMEPSSASGRMNHYEKGRHVPDIGTLERMAEELDVPLNYFFCRNELSAELACAIEKMSDDEKKALLENLNGESHL
>NZ_CP022243.1|WP_114867955.1|1001888_1002986_+|AAA-family-ATPase
MMMILKILRGINLNLTSSQFEQLRSFETCFIEYPAITEIYSIFDQLRFNHSLGGEPESFLLTGEAGSGKTALINNYLSRFPSSSTWSKQPVLSTRVPSRINEQNTLTQFLVDLGGKLGGRSPRRRNEIALGEAVVKQLQRKSVELIIVNEIQELVEFSTAEERQAIANTFKYISEEAKVSFVLVGMPYADVLATEPQWNSRLSWRRKIQYFKLLKNTSHSSGSAHYAFDLEQKKHFAKFVAGLSARMGFDEPPVLTKNEVLYPLFVMCKGECRALKHFLKDALLMSFNENVDTIDKAILSRTFSFKFPYLDNPFDAPVEELRLHQIDSGSAYNLNAIAAEDKILAPRFTDAIPLSMLLSKSGLKA
>NZ_CP022243.1|WP_114867348.1|1015123_1016200_+|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme
MKNRWLGMACVLPLLVACNSESSAIKVSSETVSQKQIDTIVSNINELYPEATPDQKQKAAEVVVRAIENMVFVEGGSFDMGDFKMDCDFPTKTENRLDWSQDAQCFNFATNLSGAQHLHKVTLDSYSISKYETSFLDMEWMRQINGLPVALTNFISVIPLKTKPMERTDEKYKKAIEYNLKNNEAAYTKSWQEAKDYCQWLGKVSTLEFDIPTEAQWEFAARSRGQHYYYATNDGYRSLTEGQYFDPDMGKYIDILPSEVNSSTSSEEYIGQWPANPLGIYGMSNGIQEWVNDWYAKEYYLNSPEHNPQGPENGIQKVVRDGGGVKTFDRFGKDPVLDAYSPTHSFRCTIHDSKPISK
>NZ_CP022243.1|WP_114867349.1|1016223_1018785_-|LysM-peptidoglycan-binding-domain-containing-protein
MSNKTYVIKPGDTLIGIGIEQSVNFNILLELNPKYQPNPDLIQVGDTLILPSQEEEEPIPVEFPVEPIAKMCPKEKGTIVAAPLCEPKEIEDIIFATGESANRFYCLTKESVEKLDKEIEETTKLFQCYSDLVHQAPTGKETWAELEKHTQKREALCADLIYAGILPDPSRKNPASVKAEQSRKEKVEREKALENQRMANAKVTELKKRIRYIEEYSNWFGSEDSAIELKERLTATVVPNLKKELATWEKMAKVPPTKESSSGKPVDAKKMAVKERALDGIVTNTGVRELYSINRGVYTYVREAFFQEETTVRNSWRNTSNTNNANRALRTGNIKEFGKAIADDIKSDLEQKKLGPDIKANLAKWQAPGGKIAEWKSTDTLLRDDEGNTMFAVSSEAQLGRWGMQAAVDAELNPFEKDEHGNAKGNVDLGVGASAGFSAFEAAITAEVFLPSDAGYTPCLNYTDANGQPALHSFGSFRFNAKMKVGCFVGVVAQAKAGISNRRPETGDDVGILFDPHVSMGNAGGGQIGIKASVFGGGQLSGEFAGGVQWKAPEIDQTTNFNSLAEIQTEGNVSVGGGYNADFELYLRGGQFFLKLSAKLVWGAGGGGGFAVAINAQEIWNLAKVIWQGLQYVDYRMLKNINNQAYEYLVDAAYFAFAAADIIKSPDDALKMTVTAGKASIDFIKAERKKYLALEKEAAVLSDRILNTSTRSGVPFDQLPPEAIGRMLDTLTRTFLLNWEEKQEDAICTLLSQSTYSWHKFEEILARMNEKGEKERGEDTLFDNIQRLNAILDGSQQREFNRWVASLAEKNLSKEVANAPFAPYKGKAFARKLAHVNQQYASIYGGSTPNQYV
>NZ_CP022243.1|WP_114867350.1|1018797_1019391_-|DUF4123-domain-containing-protein
MSNTQLNPNWRIQGNAQPNLITNQQAYAIIEPLLWPEWKKKLEAHLESFEVIPLMAGTRLSHLNEGPVLVSIGSSEEALQACVAKMSQTPCGCLVWSSPTHSSSEVAASLRQRLFVSRNQGEALFRFYEPRTLVPLMAALSDEERRHMFPLLSSLHWHSKQWLSINLSHASEATTSIQPWTLSQEQLSTMQNIAQQW
>NZ_CP022243.1|WP_114867351.1|1022044_1022872_+|restriction-endonuclease
MARKSDGIIWHLMDAPWWLSVILSIGVYVALSYVLPELAASSNNFVFNAIAPNLSMFAPYFALLFFIPAPIAFFKQFQRRQMYRTTTSHIRSKQVTTPFHQLSWLEFESYVGEYFKHQGYAVKQSFSQKPDGGIDIWLTKDGELSLVQCKHWKAKKVGIQVLREMYGVMIEHHASKMIIVTSGDFTSEAIAYAQDKRLWLVNGSELVHIIEDGRSFENKPPKPTSDMKLVPKVCPNCQSVLVKRVAKRGVNKGKAFYGCTSFPTCRYTIDYSKPN
>NZ_CP022243.1|WP_114867352.1|1023154_1023640_-|hypothetical-protein
MGKLNDAQLQRRIEHILERHPNASSLVVRQRLMSNLKPSHIYPHLVPFYEQYRIDDSADIQRELKKMMSMHLGLSIIAQTLSIGCFNYRQVEKALLELTADFDHLAQAQRCKELRFGHGAPTDEHHQSQIVMTLQRLGHRLPDIWQVLRQATESNKIAKPR
>NZ_CP022243.1|WP_162814161.1|1023795_1024008_+|hypothetical-protein
MIEHLNALLSHTRDSRTATPDVSALLPFVRDVVLEEVVIHCRGNQAKASRILGLNRGTLRTHMCRIQRQK
>NZ_CP022243.1|WP_114867354.1|1024248_1024491_+|DUF2384-domain-containing-protein
MDIDILLSITSDASNECSTALVEMLDEADTYFGDRESTITWLSKPNVAFKLKSPISICDDMEGIQLVMEQINRLKFGYLA
>NZ_CP022243.1|WP_159408350.1|1024601_1024739_+|hypothetical-protein
MDIAYQSTTEYSSAVVAKSTTTATDPIVQKVVAQLRLNQKCPKTV
>NZ_CP022243.1|WP_114867355.1|1024887_1025928_+|SMEK-domain-containing-protein
MITRGHLIGEIVDGLTSISQQVSTRCQLGLTDLNRYLEDFFKDYLNEALSLSLVNLNDERSNEPGLDLGDEISSVAFQVTSTKTAQKVNKTLKTTSKRKKQFAEINVLVIGKKQASYQLDQSLALNFGFTEENIWDVDDLCRKTISLPLDRLQALYELVRRNLARVRVELEIPDEDGNFSTSIDSYIEKIPTPKMSDFKKYHAYQKSRVDEFEHTTEEVEEHFREFSRELSQLPRITREFYAFLLERREKDDNRIPSRSFYSENLWFNYNKLKRVCRFPDLDDEVVLLGEHGFADIEEPMEHNESPFVRIFAPIKVDGFIHELVEYIESKDIGFKKPIVFLDFSAF
>NZ_CP022243.1|WP_114867356.1|1032704_1033313_+|hypothetical-protein
MLVLGHHLATELGFSDSCDTLGKWMSHHLAEVMERAEHAENSEEKEKYQQQAVELILKLWGHRRNMTNNAYPLARFKKIIESLSILSPEANVWERNKLGKYESLAADTFSMIVDLYRALHFVEFSTLKSYRDNQVPPSALTVEEQELYDFLLSWAEEEMNFRSANDLPTEKSEVQHMSKFLSDYIDDLCEKLNMLKSELSEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022243_1	1.3\|1014679\|31\|NZ_CP022243\|CRISPRCasFinder,CRT	1014679-1014709	31	MN812211	Flavobacterium phage vB_FspS_laban6-1, complete genome	21794-21824	8	0.742
NZ_CP022243_1	1.3\|1014679\|31\|NZ_CP022243\|CRISPRCasFinder,CRT	1014679-1014709	31	NZ_AP019552	Athalassotoga saccharophila strain NAS-01 plasmid pATS1, complete sequence	14984-15014	9	0.71
NZ_CP022243_1	1.3\|1014679\|31\|NZ_CP022243\|CRISPRCasFinder,CRT	1014679-1014709	31	MN582093	Podoviridae sp. ctviO18, complete genome	9904-9934	10	0.677

1. spacer 1.3|1014679|31|NZ_CP022243|CRISPRCasFinder,CRT matches to MN812211 (Flavobacterium phage vB_FspS_laban6-1, complete genome) position: , mismatch: 8, identity: 0.742

tcgtgaaatagaacattttgaacaaaagtct	CRISPR spacer
tattgaaatagaaaatattgaacaaaaagaa	Protospacer
*  ********** ** **********.

2. spacer 1.3|1014679|31|NZ_CP022243|CRISPRCasFinder,CRT matches to NZ_AP019552 (Athalassotoga saccharophila strain NAS-01 plasmid pATS1, complete sequence) position: , mismatch: 9, identity: 0.71

tcgtgaaatagaacattttgaacaaaagtct	CRISPR spacer
ggcacaaatagaaaattttgaaaaaaagtta	Protospacer
     ******** ******** ******.

3. spacer 1.3|1014679|31|NZ_CP022243|CRISPRCasFinder,CRT matches to MN582093 (Podoviridae sp. ctviO18, complete genome) position: , mismatch: 10, identity: 0.677

tcgtgaaatagaacattttgaacaaaagtct	CRISPR spacer
aggtgaaatagaaaatcttgaacaactaata	Protospacer
  *********** **.********  . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

712736 : 719438

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005483011.1\|712736_713876_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7
WP_114867308.1\|713893_715144_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.1e-98	47.9
WP_005482986.1\|715271_715721_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_062851259.1\|715728_716853_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.8e-48	36.0
WP_005483039.1\|716865_717519_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_005496254.1\|717688_718798_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_005440184.1\|718967_719438_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_2

1286916 : 1320049

Vibrio_phage(94.87%)

tail,head,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_114867409.1\|1286916_1289172_-	hypothetical protein	M4M9L1	Vibrio_phage	4.6e-27	46.4
WP_114867410.1\|1289220_1289811_-	YmfQ family protein	M4M9M8	Vibrio_phage	2.8e-93	80.6
WP_114867411.1\|1289795_1290863_-\|plate	baseplate J/gp47 family protein	M4MHE1	Vibrio_phage	2.3e-162	80.3
WP_114867412.1\|1290852_1291305_-	hypothetical protein	M4MB61	Vibrio_phage	1.7e-61	80.5
WP_114867413.1\|1291307_1291913_-\|plate	phage baseplate assembly protein V	A0A2I7S9F6	Vibrio_phage	3.0e-90	81.6
WP_114867414.1\|1292980_1294300_-	multidrug DMT transporter permease	A0A2I7S9E8	Vibrio_phage	6.3e-186	74.4
WP_114867415.1\|1294311_1296057_-\|tail	phage tail tape measure protein	M4MHE6	Vibrio_phage	2.4e-249	76.4
WP_114867416.1\|1296182_1296527_-	hypothetical protein	M4MB64	Vibrio_phage	5.7e-46	83.3
WP_114867417.1\|1296526_1296880_-\|tail	phage tail protein	A0A2I7S9D5	Vibrio_phage	2.1e-43	71.8
WP_114867418.1\|1296895_1298374_-\|tail	phage tail protein	M4M9L9	Vibrio_phage	7.0e-250	86.8
WP_114867958.1\|1298376_1298589_-	DUF2635 domain-containing protein	A0A2I7S9K4	Vibrio_phage	2.9e-08	44.9
WP_114867419.1\|1298616_1299207_-	hypothetical protein	M1PJ94	Vibrio_phage	3.3e-86	73.0
WP_114867420.1\|1299203_1299740_-	phage virion morphogenesis protein	M4MB67	Vibrio_phage	1.5e-77	78.5
WP_114867421.1\|1299739_1300174_-	DUF1320 domain-containing protein	M1PVU7	Vibrio_phage	5.1e-60	78.5
WP_114867422.1\|1300188_1300773_-	hypothetical protein	M4M9M3	Vibrio_phage	3.1e-20	57.1
WP_114867423.1\|1300789_1301347_-	hypothetical protein	M1Q569	Vibrio_phage	4.1e-46	54.9
WP_114867424.1\|1301349_1301610_-	hypothetical protein	NA	NA	NA	NA
WP_114867425.1\|1301681_1302584_-\|head	phage head protein	A0A2I7S9D0	Vibrio_phage	2.5e-133	75.8
WP_114867426.1\|1302583_1303555_-	peptidase	M1Q578	Vibrio_phage	4.7e-122	68.1
WP_114867427.1\|1303859_1304639_-	hypothetical protein	A0A2I7S9F9	Vibrio_phage	2.4e-124	79.6
WP_114867428.1\|1304631_1306194_-	DUF935 domain-containing protein	M4M9P3	Vibrio_phage	5.5e-237	78.0
WP_114867429.1\|1306190_1307756_-	hypothetical protein	M4MHG0	Vibrio_phage	1.4e-232	78.1
WP_114867430.1\|1307876_1308068_-	hypothetical protein	M4MB75	Vibrio_phage	1.7e-12	57.6
WP_114867431.1\|1308067_1308646_-	DUF3486 family protein	M4MCR3	Vibrio_phage	8.6e-71	73.8
WP_114867432.1\|1308655_1308949_-	ArsR family transcriptional regulator	A0A2I7S9D8	Vibrio_phage	5.7e-39	82.3
WP_114867959.1\|1308957_1309257_-	DUF2730 family protein	M4M9P7	Vibrio_phage	6.9e-32	72.2
WP_114867433.1\|1309262_1309478_-	TraR/DksA family transcriptional regulator	M4MHG5	Vibrio_phage	2.0e-20	67.1
WP_114867434.1\|1309474_1310074_-	hypothetical protein	M4MB79	Vibrio_phage	1.1e-44	56.2
WP_114867435.1\|1310058_1310331_-	hypothetical protein	A0A2I7S9C2	Vibrio_phage	6.1e-19	52.9
WP_114867436.1\|1310330_1310897_-	N-acetylmuramidase	A0A2I7S9B9	Vibrio_phage	1.1e-70	70.4
WP_114867437.1\|1310982_1311384_-	transcriptional regulator	M4MHG9	Vibrio_phage	6.6e-38	58.0
WP_114867438.1\|1311465_1312005_-	hypothetical protein	NA	NA	NA	NA
WP_114867439.1\|1312031_1312544_-	regulatory protein GemA	A0A2I7S9B8	Vibrio_phage	9.7e-58	64.9
WP_114867440.1\|1312548_1312755_-	hypothetical protein	NA	NA	NA	NA
WP_062853649.1\|1312763_1313000_-	hypothetical protein	M4M9N5	Vibrio_phage	1.8e-19	57.7
WP_114867441.1\|1313192_1313732_-	hypothetical protein	F6MIJ5	Haemophilus_phage	3.3e-24	39.5
WP_114867442.1\|1313728_1314001_-	DUF3850 domain-containing protein	C1KFE1	Lactobacillus_virus	7.0e-15	53.3
WP_114867443.1\|1313993_1314317_-	hypothetical protein	NA	NA	NA	NA
WP_114867445.1\|1314965_1315580_-	DUF3164 family protein	M4MHH7	Vibrio_phage	7.2e-84	78.0
WP_114867446.1\|1315588_1315825_-	hypothetical protein	NA	NA	NA	NA
WP_114867447.1\|1315835_1316159_-	hypothetical protein	A0A2I7S9B1	Vibrio_phage	1.1e-19	50.9
WP_114867448.1\|1316151_1316541_-	hypothetical protein	NA	NA	NA	NA
WP_114867449.1\|1316564_1316804_-	hypothetical protein	NA	NA	NA	NA
WP_114867450.1\|1316812_1317766_-	AAA family ATPase	M4M9P4	Vibrio_phage	1.6e-146	84.1
WP_114867451.1\|1317790_1319782_-	DDE endonuclease	A0A2I7S9A8	Vibrio_phage	5.2e-301	75.8
WP_114867452.1\|1319791_1320049_-	transcriptional regulator	A0A2I7S995	Vibrio_phage	2.6e-19	61.1

DBSCAN-SWA_3

1701443 : 1711371

Vibrio_phage(90.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053314082.1\|1701443_1703174_+	response regulator	A0A1V0SGX0	Hokovirus	1.7e-42	31.0
WP_114867539.1\|1703341_1703710_-	hypothetical protein	A0A1W6UGD7	Vibrio_phage	2.6e-36	64.7
WP_114867540.1\|1703906_1704179_+	hypothetical protein	NA	NA	NA	NA
WP_025441867.1\|1704178_1704403_+	hypothetical protein	G8IRU4	Vibrio_phage	9.2e-13	56.1
WP_114867541.1\|1704395_1705652_+	replication protein	G8IRU5	Vibrio_phage	1.1e-147	61.7
WP_025441869.1\|1705657_1705984_+	hypothetical protein	G8IRU6	Vibrio_phage	6.2e-18	47.4
WP_029803953.1\|1705980_1706226_+	hypothetical protein	R9TMT7	Vibrio_phage	7.0e-06	40.4
WP_029792117.1\|1706254_1706470_+	hypothetical protein	G8IRU8	Vibrio_phage	3.2e-07	55.1
WP_114867542.1\|1706603_1708109_+	chemotaxis protein	NA	NA	NA	NA
WP_025788705.1\|1708108_1708441_+	DUF2523 domain-containing protein	Q64EV1	Vibrio_phage	1.4e-17	36.4
WP_114867543.1\|1708444_1709869_+	toxin	Q64EV0	Vibrio_phage	9.1e-122	51.0
WP_162814178.1\|1709880_1710159_+	hypothetical protein	NA	NA	NA	NA
WP_114867544.1\|1710500_1710965_-	hypothetical protein	NA	NA	NA	NA
WP_025441877.1\|1710996_1711371_-	phage protein	A0A1W6UG37	Vibrio_phage	2.3e-61	92.7

DBSCAN-SWA_4

1721756 : 1733235

Vibrio_phage(90.91%)

coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029815171.1\|1721756_1723574_-	replication endonuclease	A0A2P1CKY6	Pseudoalteromonas_phage	1.0e-64	34.9
WP_114867554.1\|1723586_1723883_-	hypothetical protein	NA	NA	NA	NA
WP_114867555.1\|1723884_1724070_-	hypothetical protein	NA	NA	NA	NA
WP_005388732.1\|1724212_1724479_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025638643.1\|1724487_1724856_-	antirepressor	Q9MCC3	Vibrio_phage	4.2e-55	90.7
WP_042765520.1\|1724979_1725252_+	hypothetical protein	NA	NA	NA	NA
WP_025526117.1\|1725254_1725470_+	hypothetical protein	A0A1W6UGD1	Vibrio_phage	4.5e-33	97.2
WP_015975179.1\|1725393_1726602_+	DNA replication initiation protein	Q7DKP2	Vibrio_phage	3.2e-245	100.0
WP_015975173.1\|1726605_1726959_+	DUF1293 family protein	O88148	Vibrio_phage	2.9e-61	100.0
WP_015975174.1\|1726970_1727216_+	hypothetical protein	A0A1W6UH23	Vibrio_phage	1.2e-37	100.0
WP_015975175.1\|1727226_1727460_+\|coat	major coat protein	O88142	Vibrio_phage	1.0e-30	100.0
WP_114867556.1\|1727590_1729120_+	methyl-accepting chemotaxis protein	O88107	Vibrio_phage	1.6e-153	93.5
WP_017822026.1\|1729121_1729436_+	DUF2523 domain-containing protein	A0A1W6UG81	Vibrio_phage	6.1e-47	100.0
WP_114867557.1\|1729432_1730575_+	assembly protein	A0A1W6UG53	Vibrio_phage	1.0e-208	98.7
WP_114867558.1\|1730988_1732017_+	hypothetical protein	NA	NA	NA	NA
WP_159408373.1\|1732052_1732649_+	hypothetical protein	NA	NA	NA	NA
WP_114867966.1\|1732869_1733235_-	phage protein	Q9MCC4	Vibrio_phage	1.5e-60	92.6

DBSCAN-SWA_5

2223871 : 2233263

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031417709.1\|2223871_2224108_+	hypothetical protein	F6MII4	Haemophilus_phage	1.3e-12	48.6
WP_031427045.1\|2224109_2226173_+	hypothetical protein	M4M9R2	Vibrio_phage	2.9e-68	30.5
WP_025818281.1\|2226176_2227100_+	AAA family ATPase	A0A2P9JZG8	Alteromonadaceae_phage	4.2e-35	31.0
WP_025818280.1\|2227101_2227539_+	hypothetical protein	NA	NA	NA	NA
WP_031427044.1\|2227529_2227775_+	hypothetical protein	NA	NA	NA	NA
WP_024700519.1\|2227802_2228003_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_025818934.1\|2227999_2228614_+	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	4.7e-51	47.3
WP_031427042.1\|2228635_2229667_+	hypothetical protein	A0A1V0E8C0	Vibrio_phage	1.3e-53	35.6
WP_024700522.1\|2229663_2229912_+	hypothetical protein	NA	NA	NA	NA
WP_024700523.1\|2230032_2230401_+	hypothetical protein	A0A2I7RZB2	Vibrio_phage	1.3e-40	69.3
WP_024701736.1\|2230403_2230910_+	hypothetical protein	A0A2H5BFX4	Vibrio_phage	2.2e-62	70.7
WP_025818832.1\|2231970_2232207_+	hypothetical protein	NA	NA	NA	NA
WP_025818831.1\|2232203_2232419_+	hypothetical protein	NA	NA	NA	NA
WP_025818830.1\|2232696_2233263_+	hypothetical protein	Q71TC0	Escherichia_phage	2.9e-15	44.5

DBSCAN-SWA_6

2962279 : 2973133

Staphylococcus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455546.1\|2962279_2964862_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9
WP_114867838.1\|2965004_2965472_-	recombination regulator RecX	NA	NA	NA	NA
WP_025789425.1\|2965595_2966636_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_021450025.1\|2966836_2967319_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.9e-27	48.7
WP_114867839.1\|2967848_2969489_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.2e-103	41.6
WP_114867840.1\|2969505_2970717_-	AAA family ATPase	NA	NA	NA	NA
WP_159408078.1\|2970713_2971775_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.4e-05	26.1
WP_114867842.1\|2971955_2973133_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.0e-123	69.5

DBSCAN-SWA_7

2996986 : 3010791

uncultured_Mediterranean_phage(22.22%)

tRNA,integrase

attL 2995476:2995489|attR 2999161:2999174

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2995476:2995489	attL	NA	NA	NA	NA
WP_114867860.1\|2996986_2998327_-\|integrase	site-specific integrase	K7PGY1	Enterobacteria_phage	8.5e-21	23.5
WP_114867861.1\|2998499_3001085_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	4.5e-34	23.9
2999161:2999174	attR	NA	NA	NA	NA
WP_005478537.1\|3001163_3002153_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_069540980.1\|3002233_3003157_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005455562.1\|3003171_3003798_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_017449149.1\|3003797_3004574_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.0e-66	52.4
WP_021450029.1\|3004573_3005617_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|3005663_3006140_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_005478544.1\|3006157_3006862_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	5.9e-05	23.6
WP_005455577.1\|3006863_3007145_-	cell division protein FtsB	NA	NA	NA	NA
WP_005455579.1\|3007770_3009072_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455581.1\|3009150_3010791_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022245

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP022243

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection