CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP031843	Bartonella kosoyi strain Tel Aviv chromosome, complete genome	1 crisprs	cas3	0	0	7	0
NZ_CP042964	Bartonella kosoyi strain Tel Aviv plasmid pTLV-1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031843_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031843_1

798270-798407

Orphan

Consensus_repeat	Method
TAAACGTTATCGACCAGGAGATCGAATTCTTGAACTTGGTGATGATGTTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031843_1

>merge|NZ_CP031843|1|798270-798407|CRISPRCasFinder
TAAACGTTATCGACCAGGAGATCGAATTCTTGAACTTGGTGATGATGTTTACGTAGCCGATTATCCTCTTAATCCCAGCAATTCAGGTAAACGTTATCGACCAGGAGATCGAGTTCTTGAACTTGGTGATGATGTTTA

>NZ_CP031843|1|1|798270-798407|CRISPRCasFinder
TAAACGTTATCGACCAGGAGATCGAATTCTTGAACTTGGTGATGATGTTTA	CGTAGCCGATTATCCTCTTAATCCCAGCAATTCAGG
TAAACGTTATCGACCAGGAGATCGAGTTCTTGAACTTGGTGATGATGTTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031843.2\|WP_120100692.1\|800474_801122_+\|transglycosylase-SLT-domain-containing-protein	unknown	unknown	gnl\|CDD\|366654
NZ_CP031843.2\|WP_120100694.1\|801134_802136_+\|tail-fiber-protein	unknown	unknown	gnl\|CDD\|377845
NZ_CP031843.2\|WP_120100701.1\|809073_809403_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_012232364.1\|792901_793210_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|162974
NZ_CP031843.2\|WP_120100679.1\|790678_791806_+\|N4-gp56-family-major-capsid-protein	unknown	unknown	gnl\|CDD\|372532
NZ_CP031843.2\|WP_012232365.1\|792636_792921_-\|putative-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|226162
NZ_CP031843.2\|WP_120100689.1\|796831_798262_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100681.1\|791828_792209_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100686.1\|795441_795867_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100703.1\|810126_810354_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100696.1\|802144_803158_+\|tail-fiber-protein	unknown	unknown	gnl\|CDD\|377845
NZ_CP031843.2\|WP_120100699.1\|804308_804542_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100706.1\|810470_810698_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100682.1\|792220_792601_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100684.1\|793984_795442_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_012232363.1\|793275_793983_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120100687.1\|795868_796792_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031843.2\|WP_120102310.1\|809467_810130_+\|lysozyme	unknown	unknown	gnl\|CDD\|381599
NZ_CP031843.2\|WP_120100697.1\|803165_804299_+\|tail-fiber-protein	unknown	unknown	gnl\|CDD\|377845
NZ_CP031843.2\|WP_167309084.1\|804563_809063_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173412

Protein	Function_ID	Function_description	E-value
NZ_CP031843.2\|WP_120100694.1\|801134_802136_+\|tail-fiber-protein	gnl\|CDD\|377845	pfam07484, Collar, Phage Tail Collar Domain. This region is occasionally found in conjunction with pfam03335. Most of the family appear to be phage tail proteins; however some appear to be involved in other processes. For instance a member from Rhizobium leguminosarum may be involved in plant-microbe interactions. A related protein MrpB is involved in the pathogenicity of Microcystis aeruginosa. The finding of this family in a structural component of the phage tail fibre baseplate suggests that its function is structural rather than enzymatic. Structural studies show this region consists of a helix and a loop and three beta-strands. This alignment does not catch the third strand as it is separated from the rest of the structure by around 100 residues. This strand is conserved in homologs but the intervening sequence is not. Much of the function of phage T4 appears to reside in this intervening region. In the tertiary structure of the phage baseplate this domain forms part of the 'collar'. The domain may bind SO4, however the residues accredited with this vary between the PDB file and the Swiss-Prot entry. The long unconserved region maybe due to domain swapping in and out of a loop or reflective of rapid evolution.	1.23112e-15
NZ_CP031843.2\|WP_120100692.1\|800474_801122_+\|transglycosylase-SLT-domain-containing-protein	gnl\|CDD\|366654	pfam01464, SLT, Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.	5.40108e-13
NZ_CP031843.2\|WP_012232364.1\|792901_793210_-\|hypothetical-protein	gnl\|CDD\|162974	TIGR02683, Uncharacterized_protein_HI_1419, putative addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.	2.67344e-38
NZ_CP031843.2\|WP_120100679.1\|790678_791806_+\|N4-gp56-family-major-capsid-protein	gnl\|CDD\|372532	pfam13252, DUF4043, Protein of unknown function (DUF4043). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are typically between 369 and 424 amino acids in length. There is a single completely conserved residue G that may be functionally important.	3.1125e-75
NZ_CP031843.2\|WP_012232365.1\|792636_792921_-\|putative-addiction-module-antidote-protein	gnl\|CDD\|226162	COG3636, COG3636, Predicted transcriptional regulator [Transcription].	5.40381e-26
NZ_CP031843.2\|WP_120102310.1\|809467_810130_+\|lysozyme	gnl\|CDD\|381599	cd00737, lyz_endolysin_autolysin, endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.	2.64468e-70
NZ_CP031843.2\|WP_120100697.1\|803165_804299_+\|tail-fiber-protein	gnl\|CDD\|377845	pfam07484, Collar, Phage Tail Collar Domain. This region is occasionally found in conjunction with pfam03335. Most of the family appear to be phage tail proteins; however some appear to be involved in other processes. For instance a member from Rhizobium leguminosarum may be involved in plant-microbe interactions. A related protein MrpB is involved in the pathogenicity of Microcystis aeruginosa. The finding of this family in a structural component of the phage tail fibre baseplate suggests that its function is structural rather than enzymatic. Structural studies show this region consists of a helix and a loop and three beta-strands. This alignment does not catch the third strand as it is separated from the rest of the structure by around 100 residues. This strand is conserved in homologs but the intervening sequence is not. Much of the function of phage T4 appears to reside in this intervening region. In the tertiary structure of the phage baseplate this domain forms part of the 'collar'. The domain may bind SO4, however the residues accredited with this vary between the PDB file and the Swiss-Prot entry. The long unconserved region maybe due to domain swapping in and out of a loop or reflective of rapid evolution.	2.42976e-19
NZ_CP031843.2\|WP_167309084.1\|804563_809063_+\|hypothetical-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	1.67185e-34
NZ_CP031843.2\|WP_120100696.1\|802144_803158_+\|tail-fiber-protein	gnl\|CDD\|377845	pfam07484, Collar, Phage Tail Collar Domain. This region is occasionally found in conjunction with pfam03335. Most of the family appear to be phage tail proteins; however some appear to be involved in other processes. For instance a member from Rhizobium leguminosarum may be involved in plant-microbe interactions. A related protein MrpB is involved in the pathogenicity of Microcystis aeruginosa. The finding of this family in a structural component of the phage tail fibre baseplate suggests that its function is structural rather than enzymatic. Structural studies show this region consists of a helix and a loop and three beta-strands. This alignment does not catch the third strand as it is separated from the rest of the structure by around 100 residues. This strand is conserved in homologs but the intervening sequence is not. Much of the function of phage T4 appears to reside in this intervening region. In the tertiary structure of the phage baseplate this domain forms part of the 'collar'. The domain may bind SO4, however the residues accredited with this vary between the PDB file and the Swiss-Prot entry. The long unconserved region maybe due to domain swapping in and out of a loop or reflective of rapid evolution.	1.72804e-17

>NZ_CP031843.2|WP_120100689.1|796831_798262_+|hypothetical-protein
MAFPLLFPLLFTGSMAARAAPHIFRYIAPKAVTGANRLGQLITKSPVGKFVTKYPKTAAFTVGGSAIEGLMMPETAHTPSNPYLQLPQKQFPPYTAPGAEMPLGVDQHPPLLNALEEAPEDLKPKVDVPQAQPLAPASQTPPREPTDAEKFLQSNTYKFFQSDAYQKLQDLFAGMAASSSDGSGWDALASGVKRLNEGDKQRGQVNQTVEYLKSKGYSEEEARVMARNPQMLSALLTGGKAPEGFQSYTNPETGELEYRPVKGSMQELEYKQKLQAQKEWEGRRIKNMFTTKQQLRAGLNDLKAAFELIHEGKSNAFVRWLTQGVGGGEGYRLKKLLEGIRGSVLKTVFENLKSMSSSGTVGAGAISDFESKALSSMFGSLDVGRNKKELENTFEIIKTAFDFFNRHNDLQLYNALTGQPIDTPQEISEKYFVDSPMSQGGSASLPIISSREELDRYPPGTIVNYNGHPVYKGAKR
>NZ_CP031843.2|WP_120100687.1|795868_796792_+|hypothetical-protein
MGSKTPATTEQKQVQTSAPPSWMADVFKRGGRDAYNLYNIGAGGNVYGGPRVAPLSDQTRYGIGGLGSIPQHYQNRSLMNTVYNPTSAANNLGSMASGAMVGQNPAFNAALQNSLDRVRDTINSSFAGAGRYGSGAHTGVLANELGALSTSATANQYNQDVQNMMQANAMIDQANQNQLGASNNFLQGYGNAYSNAIQGGGVLDAHNQRVVDANRERWMEQDNSGWNRLNMLMNAGHGFARNYGTTTNNMSGSKMQGNSPWKNAGVIGSLALQAAPMAFGYMAGGPMGAALAAGAPYAFLKYMNEKQ
>NZ_CP031843.2|WP_120100686.1|795441_795867_+|hypothetical-protein
MAKVYLTTSWDMERIAPYLEDIIASFRAYVERFKHEITLQDLIEAICSGKKQLWLVLDDDARFLAAVTTQIQQTVLGKKRALICECSGKGVLDQVDNLTFVEDWARENGAFEIEILGRLGWKRALNKQGYGITMLYYRKEL
>NZ_CP031843.2|WP_120100684.1|793984_795442_+|hypothetical-protein
MVYFPIADYRPDVSVVNGSFTDTLVNVLPADGGYIPMPSAMVVSAPLGEKPLGCIAFRSGNGVKIIVGGAKKLYSYDSQTQGWKDISQSGVTYQANEDNQWSFALFGQRVIAVNKNDKPQVFHTHSSERFEELGGNPPKAGLVKVWGPFVCLMQLTDHPNRIHWSGLEDATHWTVKQKDCDFQDFPDGEYVQGATESSNPLIFMRSAIYAGTFVPGSKIVFAFQKIQDKRGARSAASIACRGSDAFFAGDGGFYQMSADGQLLPIGFEKVDRTVFKTFDKFALDNMQGVIDPVDNRIYWSLKRGNNEQTTFVYDWGLQKWSTIQGKPFTLFPVFTTGYTLEQLDEISINLESLPASLDSPRWQSGAPMLGAFDENNCLVMFTGAPMEATVVSQEMGAPDGSFNFITKMFAEVDTTQGLLSIGERRLRNHQTPITWHKERECSYATGAYHGRSRNRYHRFKLRIPKNEPWTAITGFDVDLRPLGRG
>NZ_CP031843.2|WP_012232363.1|793275_793983_+|hypothetical-protein
MTRHYIRVRTGGPIPASQNVYHHRKTLSHMVSVIQDEIDDITDEYVAQIQESIFAAIRFCERETFYFNESRDVVFETRAGQGAYDATDTRHIETAVKIRSVYLCSDPHHKIELEHRSPFSLESSLSSEQRGTPVCYSYFDRKLHLYPTPDRAYQIQLILSPQRLSEIERVDEEHLWFVHAFDLIKARAKYELYKNILKEPDCATAAYNDFTEQLHELRAETSKRHNVTRIIPTDF
>NZ_CP031843.2|WP_012232364.1|792901_793210_-|hypothetical-protein
MIFIHKTIEFDNWLKKLKDKKAKAIILQRVVRLKQGLLGDVKFFNSIGEVRIHYGAGYRIYFTQKGSDFILLLCGGDKSTQQRDIEQALKLKEEYSDENNPI
>NZ_CP031843.2|WP_012232365.1|792636_792921_-|putative-addiction-module-antidote-protein
MKTTPFKPEEYLEDIEVQQAFLNEAFKTGDAAHIADAIGIVARSQNMRALAKETNRERSGLYRSLSKTGDPKLSTLVAVLSALNLQLFVQSSTS
>NZ_CP031843.2|WP_120100682.1|792220_792601_+|hypothetical-protein
MADYLPEPLQGRNLHTQQVSFLRLNFSYQDKENVMKIGTLPRGALITSIKAFIKTAFSDTKVKIGSTAGGTEFGELEIKQAGIKAATISNQKEFVPFDKEVTLYAKADKTVQAGQASIVVEFVTNH
>NZ_CP031843.2|WP_120100681.1|791828_792209_+|hypothetical-protein
MADQLPPPLQGRNLHTQQVSFLRLNISHKEKHLTEKIGILPRGALITSIKTFVKTAFSEAKLKIGSSYGGNEFGEKDIKAQTTQDFTPTDQKVFAPEDKEMTLYATRDKTTDAGECVVVVQFVANH
>NZ_CP031843.2|WP_120100679.1|790678_791806_+|N4-gp56-family-major-capsid-protein
MATTHIGTHDPQSVKLWSQKLSNEVLKATKIAPLIGKSSNSIIQLYNETHKSAGDSVTFSLLVNLFGDGVTQGETLEGNEEALQFMNDRLVINELLHAARVANDDSIDQQRILPNLRKKAKEGLVRWYANRLSIMFFLQVCGYTARTISVDGREVYIKPVHYGFNEIMAPSSERIIRPDAKTKDEDLTDKAKHSFSLKLIDEAVKQAKLANPQISPVHVNGDDVYVLYLHPTQVMQLRTNTAAGEWLDIQKSVYATSRAKNPIFDGSLGMYNGVVLREAIHVTHGVKSTDHTAVKSVRRAVFLGAQSAIIGFGKNHSATNYTLKEEYFDYEREFGVAAKTLIGMKKTRFQMPNSGQTAQDFGTIVIPTYSGEAAA
>NZ_CP031843.2|WP_120100692.1|800474_801122_+|transglycosylase-SLT-domain-containing-protein
MPRYNPSVDQAIRQAAARYGLPESYLYRVAQVESGGNPNARNPRSSAGGLYQFIDSTAKQYGLQDRFDPMQAADAMGRLTLDNRNHLSRVLGRAPTDAELYLAHQQGAGGAARLLQNPHANAAQIVGSNAVGLNGGNSGMRASDFVNRVLQMYGGQPYRASPIARGGFGNRANLLEVLRALLASQEETLEEESDEDDNLLMTPFMRAFYGPFYRN
>NZ_CP031843.2|WP_120100694.1|801134_802136_+|tail-fiber-protein
MSTIYDWSLRAADNTRCDASIDWSEGQHPSSVNKSARVMMQRVKEYLSDTGGALEGIVTNDHVQQTSTIRLQSQSQFLEYKNGIVLRFMATGRNVGASTMFLNALDGKPVYKATELGVGPLLGGELQEGCVYTVVSCEDYWHLVNPTPMPREEESSLYPTGFIGTFGMRDVPKDWLICDGKAYLRRDYRDLFETIGTVWGEGDSVTTFNVPDFRGMFLRGVDGGSNRDPNRRFGSIQTDLIQSHQHEGQALSMPHFTSNENFWDGNTTEVLGYRLGLFGGGALANFMGIERDNLGSHVATPYSFDETQEVILESTGEGETRPVNVSVLFAIKT
>NZ_CP031843.2|WP_120100696.1|802144_803158_+|tail-fiber-protein
MSTIYDWSLRASENAYCDGLINWSEGQRPSSVNNSARFMMQRVREYLSDTSGVIESTFTVDAEQQTTLIRLQSQSRFLKYKNGISLCFKAKSKNVGATTIALNDLSAKPVYKATELGISPLSGGEFQKGCIYSLVYRADAWHVLNPTPVSLPPEPILPVYPAGTIGIFGMQVLPEGWLLCDGKAYLRSDYPALYEAIWIRWGGSDSVTHFNVPDLRGVFLRGVDDDREIDRFRYLGTLQKDAIRKHEHGGHTVTIFNDENEEESWYGDMTIIWGYALNDQQRLKLAERLGVRAEDIRVRHSLAFPHTHLHMRDVALASSGVSETRPINMSVVFAIKT
>NZ_CP031843.2|WP_120100697.1|803165_804299_+|tail-fiber-protein
MSTIYDWSLSASENGGADNLINWSEGQHPNTVNNSARFMMQRIREHLFDTGGMLEGIVTVDDKQKTSAIRLQSPSHFLEYKNGISLCFKAKGKNVGATTIALNNLAGKPVYKATDTGLLALTGGEIQDGSLYTVIYDEDITGWQILNPTREKVSSLKRLPSGFIGPFAMERLPEGWLVCDGRAYLRSSYRALFEAIGTTWGQGDGATTFNVPDFRGMFLRGMDYERNLDPWRSFASQQGCSLKAHEHFIGPESSGDHSSRKRRDVSSSQAPLRRRKRAIDEECLGLDGDALASCNKEFDQIAGSPQVEAPFWFTDKDKPPRLPWFIRSPFANFLYYSTPIKEGVHDRAHHEHHLMAESVGGVETRPVNVSIVYGIKT
>NZ_CP031843.2|WP_120100699.1|804308_804542_+|hypothetical-protein
MSLKPFAISELSDPSQVRVVLYSGGGLVHAPLHGVFDLLKTALKSELDGSLKDLEQRLESLKEEFEDLKECSLDEAL
>NZ_CP031843.2|WP_167309084.1|804563_809063_+|hypothetical-protein
MKIPDHSHEYLIPVATQEEIREGISQDSVVVPKLLGTASLYSYETFAPLEQVVNARQESEKAMARANGAQQVAEEAKRVSEQALSEVTKTGEAVTAATTTASLAKETADTAKGLAEEAKNASDAAKHMAEETKAAVDRASGEINSTKGSLATALQRFEEVKQVSENAVNISTEAKRLADESKTIATRAEQTAREASQTATETTQVSATAVATCHEVKTVAMQASLKAAGAKQTADDAKDMAEKAKGLSERATSSITELTKTTSQVQAAVETALTDLRDAKQIAEASKTLSGESKQIADDALRASKDAKSQSETAVRMSEEAKNACDEVKASVASVEKVAETVKTGVEQASQTASEAKGLAEEVKSAVDKATAKVEQAVREASDAQSKADSLERLANEANQTARSSKSVSEEAKGLAETAKSTADRATLTATQAQQEASEASRIANEAKVTAEQALQADRQAVREGGEASKSLAEAVQKKSEEAERVAQDSKRVCEEAKQLATEAKNASTNALTEARDAKEKASTALTSVNDVKNLCEEVKGLAEKASTASTEAQKTSDQALREATAAKTTADMASSTANNAKGSAEKAKTLSEEAKKLVQDNKNAFDESNKTLEAVKGLAETALSTANEAKQKGEEISQQSSEALMKSGEAKNLAEEAKNSADSAQTKSEQAHQSATEATRIASEAKAAAEAAARSGERSGQVDAEALKGIATAAKSKAEAAEKVAEETKGALDGVKQVANSAKSIAEEAKKVADGAQKKASQVETVAGEAEKIAKEAKQTAGYANHEAAQARSEVEKAKSTAHEGWSNANKAQEVASDAKTIASLARTYADEAKKIAENSGNTAHQGWSTANNAKEVADNAKAIASLARTYADEAKKKAEVADSQSYQAKGEVDKAKEIAGNAKYIAEQAQKAAETAGKKADSLETEAREAQKIANEAKEKAGYAEHDARQARSEAESAKNIAYNASSTAYNAKEVADNARTTASLAEMAGEEAKKIAEKADNRAYEAKGEVGKAQELAESAKSIAQSAERAAEEAKKTANTAWSKADEANDAVKAIKDTAGYAKHEAGQARSIAENAEKIASSAVSRVIDINQVVENFKAPVSLARTYADEAKKKAEAADSKAYQAKSEADKAKETADRAKRTAEEAKTTADTMKKELSGIKSSLETATTAHTVATQAKNLAEKINTFLKQSHLTVLSISTPFLVATGKTQLTVKKGTYLTLPRTHDILVVSYTVDARISMPSLSAGKDYYLYLVPEGDSHKIVVSENSTYPNGYSVNNSRKIGGFHTLCADVGTISGHPLSGYRAGDILPNSVWCLNHRPYSSPEGMVYDPSTDLWVDIYLQSGTGENTRSAYNVPITTGRIYTDHVADMLRVKKTLLSDVEFASAMSGSNDKTSITGKKAPSPKTSGGHVDTANRRMISHIGCEEGCGYVWQFLSGTFPMQITNRGQARLEMRWLSGGGGWSHGVDSGCFARSTISSARGNEQLCARGCSRPRHF
>NZ_CP031843.2|WP_120100701.1|809073_809403_+|hypothetical-protein
MIDYPEHLNTKQDYLNMLSFDKVETVRRLETLLSTRFYWVFVKELSEGEEGIEDDTHKVCLTTETPVDLDGTSIAKRCQYELQESEYAPLFQLGFRVDEVEQLIKEHSQ
>NZ_CP031843.2|WP_120102310.1|809467_810130_+|lysozyme
MRKISKEGLELIKQWEGLRLEAYRDTACIWTIGYGHTSNAGNPLVKKGMRITKERAEAILCEDLKQFEKAVEEAVTVSLTDCQFAALVSFCYNVGTTAFCKSSLLKKLNQGDYEAVPVELQKWNKVGGKLLAGLANRRAAEAGLWAKGSYVSSNYQRVETKEARGLFKVEALAPIIGSCSGFGGFLVGNGPIQWALAGIMVLAACTGLVIVAKRFREQRL
>NZ_CP031843.2|WP_120100703.1|810126_810354_+|hypothetical-protein
MIFGFKRNLSLLLAALAVFLMALAKAFHLGKKSEQQKQTERALKTATTRFEVENEVNQKTDAGVRSALSRWMRGK
>NZ_CP031843.2|WP_120100706.1|810470_810698_+|hypothetical-protein
MVGKMSRKRHEEQDLSQIERQLLHEMIETYQGLKMMSRIMKWITFIVFMFVIDFARFMDALDNVLSYFKKWIAKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

656711 : 725594

Acidithiobacillus_phage(24.14%)

tail,capsid,tRNA,portal,terminase,plate,integrase

attL 681635:681651|attR 694609:694625

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_120100494.1\|656711_659627_+\|tRNA	isoleucine--tRNA ligase	M1NN51	Moumouvirus	1.6e-64	25.5
WP_120100496.1\|659804_660296_+	hypothetical protein	NA	NA	NA	NA
WP_120100498.1\|660968_661415_-	nucleoside deaminase	NA	NA	NA	NA
WP_120100500.1\|661681_663082_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_120100502.1\|663062_663629_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_012230724.1\|664430_664877_+	hypothetical protein	NA	NA	NA	NA
WP_120100503.1\|666349_667681_+	TldD/PmbA family protein	NA	NA	NA	NA
WP_120100505.1\|667667_668471_+	3'(2'),5'-bisphosphate nucleotidase CysQ	NA	NA	NA	NA
WP_120100507.1\|668516_668762_+	DUF4170 domain-containing protein	NA	NA	NA	NA
WP_120100509.1\|669983_671306_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_120100511.1\|671295_672336_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_120100513.1\|672355_672592_-	DUF2093 domain-containing protein	NA	NA	NA	NA
WP_120100514.1\|672704_674558_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.1e-108	39.5
WP_120100516.1\|674831_675920_+	2'-deoxycytidine 5'-triphosphate deaminase	NA	NA	NA	NA
WP_120100518.1\|676967_678119_+	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_120100519.1\|680384_680600_-	hypothetical protein	NA	NA	NA	NA
WP_120100521.1\|680532_680760_-	hypothetical protein	NA	NA	NA	NA
WP_120100522.1\|680756_681419_-	glycoside hydrolase family protein	A0A141GEY9	Brucella_phage	7.6e-47	64.3
681635:681651	attL	NA	NA	NA	NA
WP_120100524.1\|684534_684858_-	hypothetical protein	NA	NA	NA	NA
WP_120100525.1\|685036_686464_+	amino acid permease	NA	NA	NA	NA
WP_120100527.1\|686505_687186_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.8e-14	28.9
WP_120100528.1\|687182_687806_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_120100530.1\|687837_688392_+	biotin transporter BioY	NA	NA	NA	NA
WP_120100532.1\|689233_689542_+	hypothetical protein	NA	NA	NA	NA
WP_120100533.1\|690641_691799_+\|integrase	site-specific integrase	A0A1X9HVL9	Ruegeria_phage	4.4e-74	39.7
WP_120100535.1\|692721_692997_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_120100537.1\|693009_693291_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_120100538.1\|693321_695364_-	ATP-binding protein	NA	NA	NA	NA
694609:694625	attR	NA	NA	NA	NA
WP_012230750.1\|695567_695780_-	hypothetical protein	NA	NA	NA	NA
WP_120100541.1\|695908_696136_-	hypothetical protein	NA	NA	NA	NA
WP_120102296.1\|696132_696795_-	glycoside hydrolase family protein	A0A141GEY9	Brucella_phage	9.0e-48	60.9
WP_006589072.1\|696954_697257_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	3.4e-18	49.0
WP_012231054.1\|697243_697564_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	2.6e-16	46.2
WP_120100543.1\|697607_697886_-	hypothetical protein	NA	NA	NA	NA
WP_120100545.1\|697882_698620_-	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	5.5e-46	40.5
WP_120100547.1\|698931_700239_-	late control protein	K4HZC6	Acidithiobacillus_phage	7.4e-70	39.8
WP_120100548.1\|700235_700460_-\|tail	phage tail protein	A0A2H4J946	uncultured_Caudovirales_phage	1.1e-05	53.1
WP_120100550.1\|700456_700837_-\|tail	phage tail protein	A0A1W6JT48	Escherichia_phage	3.4e-23	43.1
WP_120100552.1\|700842_702978_-\|tail	phage tail protein	A0A2I5ARC1	Synechococcus_phage	6.1e-13	35.1
WP_120100553.1\|702974_703088_-\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_120100555.1\|703084_703372_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_120100557.1\|703373_703880_-\|tail	phage major tail tube protein	K4I1G5	Acidithiobacillus_phage	3.4e-31	42.2
WP_120100558.1\|703879_705091_-\|tail	phage tail protein	A0A088FVH5	Escherichia_phage	1.6e-127	52.4
WP_120100560.1\|705472_706231_+	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	9.6e-46	39.5
WP_120100562.1\|706227_706506_+	hypothetical protein	NA	NA	NA	NA
WP_120100564.1\|706551_706893_-	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_120100565.1\|706903_707182_-	plasmid maintenance system killer	NA	NA	NA	NA
WP_120102298.1\|707376_708198_-	DNA adenine methylase	A0A219VHB5	Ochrobactrum_phage	3.2e-87	57.9
WP_120100567.1\|708691_710017_-	hypothetical protein	NA	NA	NA	NA
WP_120100568.1\|710031_713175_-	DUF4815 domain-containing protein	K4ICQ5	Acidithiobacillus_phage	8.6e-157	35.0
WP_120100570.1\|713176_714289_-\|tail	phage tail protein	K4I1F8	Acidithiobacillus_phage	5.1e-19	36.4
WP_120100572.1\|714288_715116_-\|plate	baseplate assembly protein	A0A219VH98	Ochrobactrum_phage	3.9e-40	34.9
WP_120100574.1\|715112_715454_-\|plate	baseplate assembly protein W	Q75QM0	Wolbachia_phage	1.1e-30	56.9
WP_120100576.1\|715450_716140_-\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	1.4e-14	32.7
WP_120102300.1\|716120_716663_-	hypothetical protein	NA	NA	NA	NA
WP_120100577.1\|716718_717030_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	2.0e-10	40.9
WP_120100579.1\|717046_717343_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	2.4e-13	48.2
WP_120100581.1\|717389_717668_-	hypothetical protein	NA	NA	NA	NA
WP_120100582.1\|717664_718405_-	phage regulatory protein/antirepressor Ant	B5AX29	Iodobacteriophage	1.2e-24	37.5
WP_120100584.1\|718735_719092_-	hypothetical protein	NA	NA	NA	NA
WP_120100585.1\|719093_720170_-\|capsid	major capsid protein	A0A0A8ILA9	Aurantimonas_phage	1.0e-56	35.5
WP_120102301.1\|720546_720891_-	hypothetical protein	NA	NA	NA	NA
WP_120100587.1\|720809_721877_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	1.2e-65	47.6
WP_120100588.1\|721866_723411_-\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	4.6e-95	41.5
WP_120100590.1\|723410_723659_-	hypothetical protein	NA	NA	NA	NA
WP_120100592.1\|723662_725594_-\|terminase	phage terminase large subunit family protein	K4I3Y9	Acidithiobacillus_phage	2.8e-166	52.3

DBSCAN-SWA_2

889906 : 898337

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_120100789.1\|889906_892822_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
WP_005773335.1\|893154_893661_+	single-stranded DNA-binding protein	A0A0K1LLZ9	Caulobacter_phage	8.4e-46	59.4
WP_120100791.1\|893892_896670_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.4e-104	34.5
WP_120100792.1\|896694_897192_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	7.5e-23	35.2
WP_167309104.1\|897204_897807_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.0e-46	54.8
WP_120100795.1\|897824_898337_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	9.1e-48	61.8

DBSCAN-SWA_3

964369 : 988981

Lactobacillus_phage(18.75%)

integrase

attL 957997:958011|attR 966173:966187

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
957997:958011	attL	NA	NA	NA	NA
WP_150222275.1\|964369_965413_-\|integrase	tyrosine-type recombinase/integrase	A0A291AUF0	Sinorhizobium_phage	4.4e-33	31.0
WP_120100633.1\|965421_965640_-	hypothetical protein	NA	NA	NA	NA
WP_120100635.1\|965761_966385_-	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	1.2e-46	44.6
966173:966187	attR	NA	NA	NA	NA
WP_120100636.1\|966386_967208_-	phage recombination protein Bet	A0A0M3LR26	Mannheimia_phage	2.2e-40	41.9
WP_120100638.1\|967818_968286_-	hypothetical protein	A0A0A7NP48	Lactobacillus_phage	1.4e-10	58.2
WP_120100640.1\|968279_968681_-	hypothetical protein	A0A0A7NNQ1	Lactobacillus_phage	2.3e-06	57.8
WP_120100641.1\|968693_969455_-	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	3.3e-46	42.9
WP_120102304.1\|969535_969895_-	hypothetical protein	NA	NA	NA	NA
WP_012232384.1\|970158_970488_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_120100643.1\|970608_970890_+	hypothetical protein	NA	NA	NA	NA
WP_120100645.1\|970900_971317_+	hypothetical protein	NA	NA	NA	NA
WP_012232381.1\|971469_972180_-	hypothetical protein	NA	NA	NA	NA
WP_120100648.1\|972255_972720_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	9.1e-47	61.0
WP_120100649.1\|972722_973088_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_120100651.1\|973077_974193_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_120100860.1\|975136_975643_+	hypothetical protein	K4PXF0	Edwardsiella_phage	1.8e-11	54.5
WP_120100861.1\|975724_976387_+	hypothetical protein	A0A076G7L7	Bacillus_phage	4.4e-10	53.4
WP_120100862.1\|976471_977155_+	hypothetical protein	K4PXF0	Edwardsiella_phage	6.5e-09	50.0
WP_120100863.1\|977762_978203_+	single-stranded DNA-binding protein	A0A0K1LLZ9	Caulobacter_phage	2.3e-31	54.8
WP_120100866.1\|979491_980271_-	hypothetical protein	K4Q356	Edwardsiella_phage	4.8e-08	47.6
WP_120100867.1\|980376_980907_-	hypothetical protein	A0A076G7L7	Bacillus_phage	2.0e-10	53.4
WP_120100869.1\|980988_981570_-	hypothetical protein	A0A076G7L7	Bacillus_phage	5.0e-10	53.6
WP_120100870.1\|981652_982450_-	hypothetical protein	A0A0A7NQP6	Lactobacillus_phage	2.6e-09	55.8
WP_120100872.1\|984019_988981_-	DEAD/DEAH box helicase	A0A2H4UTW8	Bodo_saltans_virus	5.3e-44	27.7

DBSCAN-SWA_4

1013313 : 1023833

Lactobacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012231588.1\|1013313_1013661_-	YdaU family protein	A0A076GD06	Sinorhizobium_phage	1.1e-15	40.9
WP_120100898.1\|1013653_1014130_-	hypothetical protein	K4ICN3	Acidithiobacillus_phage	6.2e-51	63.8
WP_120100899.1\|1014210_1014645_-	hypothetical protein	NA	NA	NA	NA
WP_120100901.1\|1014661_1014901_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_120100902.1\|1015002_1015605_+	helix-turn-helix transcriptional regulator	A0A1X9HW95	Ruegeria_phage	5.7e-17	43.5
WP_120100904.1\|1015772_1016153_+	hypothetical protein	NA	NA	NA	NA
WP_120100905.1\|1016217_1016574_+	hypothetical protein	NA	NA	NA	NA
WP_120100906.1\|1016646_1017375_+	phage regulatory protein/antirepressor Ant	B5AX29	Iodobacteriophage	3.3e-27	41.5
WP_120100908.1\|1017387_1017705_+	hypothetical protein	A0A0A7NQP6	Lactobacillus_phage	2.5e-11	63.0
WP_120100910.1\|1017716_1018118_+	hypothetical protein	A0A0A7NNQ1	Lactobacillus_phage	1.6e-07	59.6
WP_120100911.1\|1018111_1018612_+	hypothetical protein	K4PXF0	Edwardsiella_phage	3.5e-12	52.9
WP_120102330.1\|1018687_1019509_+	ERF family protein	K4NWX3	Pseudomonas_phage	8.6e-16	33.7
WP_120100621.1\|1019510_1020134_+	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	3.0e-45	43.9
WP_120100913.1\|1020996_1022160_+	phosphoserine transaminase	NA	NA	NA	NA
WP_120100914.1\|1022540_1023833_+	adenylosuccinate synthase	A0A285PX35	Cedratvirus	1.9e-54	32.3

DBSCAN-SWA_5

1642167 : 1662081

Sulfitobacter_phage(27.27%)

tail,capsid,portal,terminase,integrase

attL 1660637:1660652|attR 1672105:1672120

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_120101659.1\|1642167_1643298_-\|tail	tail fiber protein	D5LGZ0	Escherichia_phage	5.1e-19	50.5
WP_120101661.1\|1643305_1644307_-\|tail	tail fiber protein	D5LGZ0	Escherichia_phage	5.4e-20	36.2
WP_120101663.1\|1644319_1644967_-	transglycosylase SLT domain-containing protein	L7TQZ1	Rhizobium_phage	1.3e-30	48.8
WP_120101664.1\|1644966_1647123_-	glycine zipper family protein	NA	NA	NA	NA
WP_120101666.1\|1647128_1648046_-	hypothetical protein	NA	NA	NA	NA
WP_120101668.1\|1648024_1648750_-	hypothetical protein	NA	NA	NA	NA
WP_120101670.1\|1648761_1649646_-	hypothetical protein	NA	NA	NA	NA
WP_120100686.1\|1649647_1650073_-	hypothetical protein	NA	NA	NA	NA
WP_120100684.1\|1650072_1651530_-	hypothetical protein	NA	NA	NA	NA
WP_012232363.1\|1651531_1652239_-	hypothetical protein	NA	NA	NA	NA
WP_012232364.1\|1652304_1652613_+	hypothetical protein	A0A141GEX6	Brucella_phage	2.1e-15	45.3
WP_012232365.1\|1652593_1652878_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	2.6e-12	49.4
WP_120100682.1\|1652913_1653294_-	hypothetical protein	NA	NA	NA	NA
WP_120100681.1\|1653305_1653686_-	hypothetical protein	NA	NA	NA	NA
WP_120100679.1\|1653708_1654836_-\|capsid	N4-gp56 family major capsid protein	A0A248SKT9	Klebsiella_phage	3.0e-43	32.6
WP_120102306.1\|1654929_1655820_-	hypothetical protein	NA	NA	NA	NA
WP_120100677.1\|1655845_1657864_-\|portal	phage portal protein	C5IHN8	Burkholderia_virus	3.1e-35	24.6
WP_120100676.1\|1657848_1659177_-\|terminase	PBSX family phage terminase large subunit	A0A088F6U9	Sulfitobacter_phage	1.7e-146	57.8
WP_120100674.1\|1659157_1659493_-	hypothetical protein	A0A088FAU1	Sulfitobacter_phage	2.1e-05	41.2
WP_120100673.1\|1659693_1659963_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SB46	Streptococcus_phage	7.6e-14	46.3
WP_120100671.1\|1659946_1660174_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_120101671.1\|1660268_1660703_-	hypothetical protein	NA	NA	NA	NA
1660637:1660652	attL	NA	NA	NA	NA
WP_120101673.1\|1660914_1662081_+\|integrase	site-specific integrase	A0A088F800	Sulfitobacter_phage	6.2e-76	41.4
WP_120101673.1\|1660914_1662081_+\|integrase	site-specific integrase	A0A088F800	Sulfitobacter_phage	6.2e-76	41.4
1672105:1672120	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1695023 : 1732539

Edwardsiella_phage(13.04%)

tail,integrase

attL 1677067:1677083|attR 1737697:1737713

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1677067:1677083	attL	NA	NA	NA	NA
WP_120101688.1\|1695023_1696190_-\|integrase	site-specific integrase	A0A1X9HVL9	Ruegeria_phage	7.3e-77	40.1
WP_120101690.1\|1696427_1697069_+	hypothetical protein	K4PXF0	Edwardsiella_phage	1.0e-08	52.8
WP_120101692.1\|1697153_1698317_+	hypothetical protein	A0A0A7NQP6	Lactobacillus_phage	6.9e-11	56.4
WP_120102381.1\|1698414_1699194_+	hypothetical protein	K4Q356	Edwardsiella_phage	8.2e-08	49.2
WP_120101694.1\|1701166_1701454_-	HigA family addiction module antidote protein	A0A0M3LPV0	Mannheimia_phage	5.3e-13	42.7
WP_120101695.1\|1701471_1701750_-	Killer protein	A0A0M3LQB1	Mannheimia_phage	1.2e-17	46.7
WP_120101697.1\|1702164_1702461_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_012231062.1\|1702470_1702857_-	hypothetical protein	NA	NA	NA	NA
WP_120101699.1\|1702849_1703101_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_120101700.1\|1703275_1703554_-	hypothetical protein	NA	NA	NA	NA
WP_120101702.1\|1703550_1704282_-	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	6.9e-49	42.7
WP_120101703.1\|1705385_1706552_+\|integrase	site-specific integrase	A0A088F800	Sulfitobacter_phage	2.3e-70	40.9
WP_007347209.1\|1706760_1706961_+	DNA-binding protein	NA	NA	NA	NA
WP_120101705.1\|1707268_1708843_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_167309088.1\|1709225_1709393_-	hypothetical protein	NA	NA	NA	NA
WP_120101707.1\|1709450_1714358_+	DEAD/DEAH box helicase	A0A2H4UTW8	Bodo_saltans_virus	1.5e-43	26.8
WP_120102382.1\|1715980_1716778_+	hypothetical protein	A0A076G7L7	Bacillus_phage	1.2e-09	50.9
WP_120101709.1\|1716860_1717544_+	hypothetical protein	A0A076G7L7	Bacillus_phage	5.9e-10	51.7
WP_120101711.1\|1717623_1718154_+	hypothetical protein	A0A076G7L7	Bacillus_phage	2.7e-10	53.4
WP_120101713.1\|1718260_1719040_+	hypothetical protein	K4Q356	Edwardsiella_phage	4.8e-08	49.2
WP_120100557.1\|1721446_1721953_+\|tail	phage major tail tube protein	K4I1G5	Acidithiobacillus_phage	3.4e-31	42.2
WP_120100555.1\|1721954_1722242_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_120100553.1\|1722238_1722352_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_120100552.1\|1722348_1724484_+\|tail	phage tail protein	A0A2I5ARC1	Synechococcus_phage	6.1e-13	35.1
WP_120100550.1\|1724489_1724870_+\|tail	phage tail protein	A0A1W6JT48	Escherichia_phage	3.4e-23	43.1
WP_120100548.1\|1724866_1725091_+\|tail	phage tail protein	A0A2H4J946	uncultured_Caudovirales_phage	1.1e-05	53.1
WP_120100547.1\|1725087_1726395_+	late control protein	K4HZC6	Acidithiobacillus_phage	7.4e-70	39.8
WP_120101716.1\|1726708_1727449_+	phage regulatory protein/antirepressor Ant	B5AX29	Iodobacteriophage	1.7e-26	39.5
WP_120101718.1\|1727445_1727724_+	hypothetical protein	NA	NA	NA	NA
WP_120101720.1\|1727778_1728090_-	addiction module antidote protein	NA	NA	NA	NA
WP_120101721.1\|1728101_1728425_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.7e-15	48.1
WP_120102384.1\|1728530_1729193_+	glycoside hydrolase family protein	A0A141GEY9	Brucella_phage	2.6e-47	61.5
WP_120100541.1\|1729189_1729417_+	hypothetical protein	NA	NA	NA	NA
WP_012230750.1\|1729545_1729758_+	hypothetical protein	NA	NA	NA	NA
WP_120101723.1\|1729888_1731064_-\|integrase	site-specific integrase	A0A1X9HVL9	Ruegeria_phage	1.1e-75	41.7
WP_120101725.1\|1731612_1732539_-	porin family protein	O11861	Bartonella_henselae_phage	1.6e-55	44.6
1737697:1737713	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1910741 : 2023873

Ochrobactrum_phage(55.56%)

tail,transposase,protease,integrase

attL 2009527:2009546|attR 2024056:2024075

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_120101941.1\|1910741_1911467_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_120101943.1\|1912488_1913577_+	DUF3792 domain-containing protein	NA	NA	NA	NA
WP_120102397.1\|1913788_1914982_+	MFS transporter	NA	NA	NA	NA
WP_120101945.1\|1915172_1915844_+	hypothetical protein	NA	NA	NA	NA
WP_120101947.1\|1915857_1917111_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_120101949.1\|1917453_1917843_+	glyoxalase	NA	NA	NA	NA
WP_150222303.1\|1918391_1918568_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_150222305.1\|1921205_1921586_+	hypothetical protein	NA	NA	NA	NA
WP_120101960.1\|1921929_1922361_+	hypothetical protein	NA	NA	NA	NA
WP_120101962.1\|1922708_1923878_+	MFS transporter	NA	NA	NA	NA
WP_120101964.1\|1925396_1926758_+	MFS transporter	NA	NA	NA	NA
WP_120101970.1\|1936356_1936749_+	transcriptional repressor	NA	NA	NA	NA
WP_120101972.1\|1936907_1938002_+	HlyD family secretion protein	NA	NA	NA	NA
WP_120101974.1\|1940388_1940973_-	N-acetyltransferase	NA	NA	NA	NA
WP_120101976.1\|1941050_1942184_-	type III PLP-dependent enzyme	A0A2K9L0W9	Tupanvirus	1.4e-37	30.2
WP_120102399.1\|1943789_1944707_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_120101982.1\|1944819_1945485_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_150222307.1\|1945440_1945776_-	hypothetical protein	NA	NA	NA	NA
WP_120101986.1\|1945879_1946710_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_120101989.1\|1947336_1948452_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.7e-27	28.7
WP_120101993.1\|1948910_1949111_-	hypothetical protein	NA	NA	NA	NA
WP_120102401.1\|1950133_1952929_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	2.5e-272	53.3
WP_120101995.1\|1952934_1953303_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_120101997.1\|1953309_1954422_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_120101999.1\|1955082_1955748_+\|protease	ATP-dependent protease	NA	NA	NA	NA
WP_120102001.1\|1955761_1955962_+	Trm112 family protein	NA	NA	NA	NA
WP_120102402.1\|1956930_1957311_+	helix-turn-helix transcriptional regulator	K4K6E9	Caulobacter_phage	1.8e-13	50.6
WP_120102007.1\|1957807_1958839_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_120102009.1\|1959388_1960051_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_120102011.1\|1960511_1961330_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_120102013.1\|1961357_1962392_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.4e-26	32.9
WP_120102015.1\|1962384_1963044_+	ABC transporter permease	NA	NA	NA	NA
WP_120102017.1\|1964782_1965262_-	MaoC family dehydratase	NA	NA	NA	NA
WP_120102019.1\|1965429_1966758_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_120102021.1\|1968196_1968553_-	hypothetical protein	NA	NA	NA	NA
WP_120102023.1\|1969344_1969641_-	hypothetical protein	NA	NA	NA	NA
WP_167309091.1\|1970448_1970613_-	hypothetical protein	NA	NA	NA	NA
WP_120102025.1\|1971329_1972073_+	creatininase family protein	NA	NA	NA	NA
WP_120102027.1\|1972095_1973127_+	GTP-binding protein	NA	NA	NA	NA
WP_120102029.1\|1973138_1974110_+	WD40 repeat domain-containing protein	NA	NA	NA	NA
WP_120102031.1\|1975448_1978757_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_120102033.1\|1978924_1982956_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_150222309.1\|1983123_1986474_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_167309092.1\|1986805_1986967_-	hypothetical protein	NA	NA	NA	NA
WP_120102404.1\|1991975_1994792_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_120102039.1\|1995601_1998853_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_150222311.1\|1999519_2005321_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_120102044.1\|2005520_2006471_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_120102046.1\|2006570_2007527_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	6.4e-63	43.0
WP_120102048.1\|2007519_2008470_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_120102049.1\|2008466_2009225_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.1e-16	27.6
2009527:2009546	attL	NA	NA	NA	NA
WP_150222289.1\|2010213_2011224_-	late control protein	A0A219VHA9	Ochrobactrum_phage	6.3e-85	51.2
WP_120101381.1\|2011214_2011469_-\|tail	phage tail protein	A0A1S5NR68	Burkholderia_phage	4.7e-05	37.3
WP_120102364.1\|2011465_2011912_-\|tail	phage tail protein	A0A219VHA8	Ochrobactrum_phage	3.2e-25	41.5
WP_150222287.1\|2011923_2012103_-	hypothetical protein	NA	NA	NA	NA
WP_120102053.1\|2014552_2014966_-	hypothetical protein	NA	NA	NA	NA
WP_120102055.1\|2014975_2015494_-\|tail	phage tail protein	A0A219VHB2	Ochrobactrum_phage	1.3e-62	64.7
WP_150222361.1\|2015490_2016780_-\|tail	phage tail protein	A0A219VHA7	Ochrobactrum_phage	5.1e-148	62.2
WP_120102407.1\|2016952_2018314_-	hypothetical protein	NA	NA	NA	NA
WP_120102057.1\|2018904_2020887_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A219VHD4	Ochrobactrum_phage	1.6e-161	60.3
WP_120102059.1\|2020883_2021342_-	hypothetical protein	A0A219VHC5	Ochrobactrum_phage	1.6e-43	64.3
WP_120102061.1\|2021338_2022298_-	ParB/RepB/Spo0J family partition protein	A0A219VHB6	Ochrobactrum_phage	3.4e-72	47.6
WP_120102063.1\|2022297_2022696_-	hypothetical protein	A0A219VHC3	Ochrobactrum_phage	1.1e-29	58.1
WP_007346581.1\|2022679_2022817_-	hypothetical protein	NA	NA	NA	NA
WP_120102409.1\|2022893_2023199_-	transcriptional regulator	A0A219VHB8	Ochrobactrum_phage	1.5e-18	67.1
WP_120102064.1\|2023345_2023873_+	helix-turn-helix transcriptional regulator	A0A219VHC1	Ochrobactrum_phage	3.7e-20	39.0
2024056:2024075	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage