CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP040236	Enterococcus faecium strain VB3025 chromosome, complete genome	1 crisprs	cas14j,cas3,DEDDh,cas2,DinG,csa3,RT	0	0	10
NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	1 crisprs	DEDDh	0	2	2
NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	1 crisprs	c2c10_CAS-V-U3,cas14j	2	8	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040236_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040236_1

2506744-2506853

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040236_1

>merge|NZ_CP040236|1|2506744-2506853|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP040236|1|1|2506744-2506853|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040236.1\|WP_002294585.1\|2508638_2509307_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP040236.1\|WP_002295743.1\|2502818_2503727_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP040236.1\|WP_002294578.1\|2513279_2513432_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP040236.1\|WP_002287787.1\|2499961_2500663_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP040236.1\|WP_002296327.1\|2504951_2505641_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP040236.1\|WP_076713757.1\|2503820_2504870_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP040236.1\|WP_002294583.1\|2510282_2511302_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP040236.1\|WP_002291634.1\|2506167_2506671_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP040236.1\|WP_002294587.1\|2507080_2507770_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP040236.1\|WP_002294580.1\|2512439_2512985_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP040236.1\|WP_002287791.1\|2497546_2498686_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP040236.1\|WP_002287792.1\|2496492_2497458_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP040236.1\|WP_002294577.1\|2513593_2514238_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP040236.1\|WP_002294588.1\|2505746_2506115_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP040236.1\|WP_002291638.1\|2507873_2508296_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP040236.1\|WP_002287788.1\|2498994_2499708_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP040236.1\|WP_002294579.1\|2513085_2513256_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP040236.1\|WP_002294548.1\|2514293_2514797_-\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_CP040236.1\|WP_002290558.1\|2500896_2502429_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP040236.1\|WP_002294584.1\|2509319_2510192_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801

Protein	Function_ID	Function_description	E-value
NZ_CP040236.1\|WP_002294585.1\|2508638_2509307_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP040236.1\|WP_002295743.1\|2502818_2503727_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP040236.1\|WP_002294578.1\|2513279_2513432_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP040236.1\|WP_002287787.1\|2499961_2500663_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP040236.1\|WP_002296327.1\|2504951_2505641_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP040236.1\|WP_076713757.1\|2503820_2504870_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.24119e-56
NZ_CP040236.1\|WP_002294583.1\|2510282_2511302_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP040236.1\|WP_002291634.1\|2506167_2506671_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP040236.1\|WP_002294587.1\|2507080_2507770_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP040236.1\|WP_002294580.1\|2512439_2512985_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP040236.1\|WP_002287791.1\|2497546_2498686_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP040236.1\|WP_002287792.1\|2496492_2497458_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP040236.1\|WP_002294577.1\|2513593_2514238_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP040236.1\|WP_002294588.1\|2505746_2506115_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP040236.1\|WP_002291638.1\|2507873_2508296_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP040236.1\|WP_002287788.1\|2498994_2499708_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP040236.1\|WP_002294579.1\|2513085_2513256_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP040236.1\|WP_002294548.1\|2514293_2514797_-\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	1.05399e-35
NZ_CP040236.1\|WP_002290558.1\|2500896_2502429_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP040236.1\|WP_002294584.1\|2509319_2510192_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103

>NZ_CP040236.1|WP_002291634.1|2506167_2506671_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP040236.1|WP_002294588.1|2505746_2506115_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP040236.1|WP_002296327.1|2504951_2505641_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP040236.1|WP_076713757.1|2503820_2504870_-|MFS-transporter
MKSNEKTPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLRDVVDRPKLIIRMVALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFTRGAS
>NZ_CP040236.1|WP_002295743.1|2502818_2503727_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP040236.1|WP_002290558.1|2500896_2502429_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP040236.1|WP_002287787.1|2499961_2500663_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP040236.1|WP_002287788.1|2498994_2499708_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP040236.1|WP_002287791.1|2497546_2498686_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP040236.1|WP_002287792.1|2496492_2497458_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP040236.1|WP_002294587.1|2507080_2507770_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP040236.1|WP_002291638.1|2507873_2508296_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP040236.1|WP_002294585.1|2508638_2509307_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP040236.1|WP_002294584.1|2509319_2510192_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP040236.1|WP_002294583.1|2510282_2511302_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP040236.1|WP_002294580.1|2512439_2512985_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP040236.1|WP_002294579.1|2513085_2513256_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP040236.1|WP_002294578.1|2513279_2513432_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP040236.1|WP_002294577.1|2513593_2514238_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP040236.1|WP_002294548.1|2514293_2514797_-|QueT-transporter-family-protein
MQKTKSRQRLSVIVVNGIIMALYLALTILVAPVSSGPIQFRISESLNHLVVFNRKLLWGVLGGVIVYNAFFGFGIMDVVFGGGQTLLSLGLTALLQNKVKNVKMRLVLNTIFFTISMGLIAYMLVPTGGQAFWTTYGTLALSEFIVMAVSAPLMYYLDRALDFEKRV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3628 : 56376

Streptococcus_phage(16.67%)

integrase,transposase

attL 39347:39361|attR 52174:52188

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303668.1\|3628_3832_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_002348989.1\|3862_4009_+	hypothetical protein	NA	NA	NA	NA
WP_002348988.1\|4015_4171_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002303667.1\|4446_5787_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.1e-66	36.0
WP_002330794.1\|7759_7978_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_106914383.1\|7998_8634_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-17	35.1
WP_002303663.1\|8826_9066_-	hypothetical protein	NA	NA	NA	NA
WP_002303662.1\|9089_10613_-	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002302412.1\|10630_10753_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_002303661.1\|10782_11766_-	GTP-binding protein	NA	NA	NA	NA
WP_002297320.1\|11789_11939_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002297319.1\|11959_12337_-	hypothetical protein	NA	NA	NA	NA
WP_002297318.1\|12368_12548_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_002297316.1\|12562_12832_-	30S ribosomal protein S14	NA	NA	NA	NA
WP_002303659.1\|13353_15096_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.5e-30	29.1
WP_002303657.1\|15079_16834_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-24	24.8
WP_002302405.1\|16943_17513_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_002305512.1\|17530_18955_-	energy-coupling factor ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	5.9e-20	26.4
WP_002297304.1\|18956_19625_-	cobalt transporter	NA	NA	NA	NA
WP_071875988.1\|19755_20340_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002302393.1\|20670_20904_-	iron-dependent repressor	NA	NA	NA	NA
WP_002297295.1\|20918_21869_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297294.1\|21865_22708_-	metal ABC transporter permease	NA	NA	NA	NA
WP_002305510.1\|22840_23566_-	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.6e-19	33.2
WP_002302387.1\|24358_25954_-	solute:sodium symporter family transporter	NA	NA	NA	NA
WP_002302386.1\|25976_26867_-	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_002302385.1\|26883_27909_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_002302384.1\|27932_28940_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002330790.1\|29052_30213_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_002305508.1\|30288_31743_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_002297404.1\|32151_33402_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305507.1\|33589_34414_-	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_002305506.1\|34452_36369_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	6.2e-25	24.4
WP_002305505.1\|36379_37414_-	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_002305504.1\|37570_38587_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002346694.1\|38688_38886_-	hypothetical protein	NA	NA	NA	NA
WP_002305503.1\|39187_40177_-\|transposase	IS91 family transposase	NA	NA	NA	NA
39347:39361	attL	NA	NA	NA	NA
WP_002303714.1\|40917_41898_-	ornithine cyclodeaminase family protein	NA	NA	NA	NA
WP_002302368.1\|41910_42789_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_138013240.1\|44949_45324_+\|transposase	transposase	Q9JMN8	Wolbachia_phage	1.6e-09	34.6
WP_002303710.1\|45331_46240_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_071875986.1\|46868_47120_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_002302358.1\|47661_47820_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002303709.1\|47891_49118_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_094899290.1\|49707_51156_-	ATP-dependent DNA helicase RecG	A0A1B3AYT3	Gordonia_phage	2.4e-61	34.9
WP_094899324.1\|51301_52798_-	RNA-directed DNA polymerase	Q2P9X6	Enterobacteria_phage	1.1e-69	34.3
52174:52188	attR	NA	NA	NA	NA
WP_086325426.1\|52969_53215_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_086325425.1\|53319_54093_+	hypothetical protein	NA	NA	NA	NA
WP_002299593.1\|54322_54571_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_094899292.1\|54669_55020_-	hypothetical protein	NA	NA	NA	NA
WP_002287525.1\|55227_56376_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4

DBSCAN-SWA_2

392334 : 441575

Liberibacter_phage(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138013243.1\|392334_393243_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002348732.1\|393464_396506_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	4.0e-18	23.2
WP_002348733.1\|396695_397280_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_010782519.1\|397276_398416_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002336645.1\|400845_401466_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_002336646.1\|401477_401936_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002331203.1\|401954_402233_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002336647.1\|402257_403625_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002331205.1\|403639_404785_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.2e-52	33.4
WP_002331206.1\|404811_405303_+	hypothetical protein	NA	NA	NA	NA
WP_002345001.1\|405745_406945_+	MFS transporter	NA	NA	NA	NA
WP_002331208.1\|407438_408197_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002331209.1\|408364_409300_+	1-phosphofructokinase	NA	NA	NA	NA
WP_002336649.1\|409296_410742_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002336650.1\|410769_411225_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_002336651.1\|411243_412218_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002336652.1\|413034_413649_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_044382644.1\|413928_414837_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_044382646.1\|414939_415323_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002298023.1\|416294_416945_+	hypothetical protein	NA	NA	NA	NA
WP_138013244.1\|417394_418333_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002291912.1\|418345_419398_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002331196.1\|419663_420299_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002296391.1\|420489_421281_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002295755.1\|422722_423220_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002340421.1\|423258_423942_-	hypothetical protein	NA	NA	NA	NA
WP_002296262.1\|424288_424555_+	DUF960 domain-containing protein	NA	NA	NA	NA
WP_002296261.1\|424581_424881_+	hypothetical protein	NA	NA	NA	NA
WP_002296259.1\|425054_425606_+	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_002296258.1\|425751_426045_+	hypothetical protein	NA	NA	NA	NA
WP_002304106.1\|426037_426334_+	peptidase	NA	NA	NA	NA
WP_002296256.1\|426407_427406_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_138013245.1\|427492_428452_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002294735.1\|428550_429267_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_025478783.1\|430808_432857_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_002294732.1\|434066_435308_+	serine/threonine transporter SstT	NA	NA	NA	NA
WP_002294730.1\|435454_436090_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002294728.1\|436280_437021_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002296909.1\|437165_438803_-	membrane protein	NA	NA	NA	NA
WP_080497382.1\|438768_438954_+	hypothetical protein	NA	NA	NA	NA
WP_002346735.1\|438935_439895_-\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_000997695.1\|440396_441575_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

986752 : 1066293

Enterococcus_phage(26.32%)

holin,portal,tRNA,head,protease,integrase,capsid,terminase,tail,transposase

attL 1042335:1042350|attR 1045686:1045701

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296621.1\|986752_989551_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	2.1e-74	26.4
WP_002286618.1\|989599_991126_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|991140_991788_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|991971_992301_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|992477_993206_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|993221_994235_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|994234_995512_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_130032929.1\|995574_998277_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|998428_998746_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|998775_999096_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|999203_1000664_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|1000731_1000953_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|1000983_1001166_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|1001165_1001579_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|1001701_1002883_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286587.1\|1003413_1004553_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|1004851_1005487_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|1005599_1006235_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|1006268_1006730_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296613.1\|1006859_1007291_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|1007308_1007629_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|1007927_1008704_+	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|1008718_1008922_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|1008937_1009276_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_060804954.1\|1009262_1009442_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|1009484_1009955_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|1010041_1010740_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|1010917_1011259_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|1011251_1011923_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286553.1\|1011928_1012615_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286552.1\|1012617_1013367_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286696.1\|1013378_1013648_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|1013809_1014112_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|1014108_1014270_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|1014266_1014572_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|1014571_1014928_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|1014887_1015133_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|1015129_1015549_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|1015545_1016103_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|1016099_1016396_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|1016472_1016886_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002300143.1\|1017343_1017619_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|1018072_1018279_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|1018474_1018642_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|1018667_1019012_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|1019016_1019298_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|1019400_1019715_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|1019692_1021387_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|1021406_1022585_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|1022547_1023234_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|1023233_1024394_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|1024403_1025279_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|1025275_1025587_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|1025576_1025930_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|1025919_1026321_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|1026313_1026718_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|1026729_1027338_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|1027357_1027720_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|1027722_1027905_+	hypothetical protein	NA	NA	NA	NA
WP_002286502.1\|1027921_1031353_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002286500.1\|1031403_1032141_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002296595.1\|1032150_1034442_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	1.6e-88	30.0
WP_002286495.1\|1034465_1036592_+	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002286491.1\|1036754_1037201_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|1037202_1037340_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|1037377_1037671_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|1037667_1037892_+\|holin	holin	NA	NA	NA	NA
WP_002286484.1\|1037888_1038914_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|1039853_1041015_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|1041937_1042345_+	hypothetical protein	NA	NA	NA	NA
1042335:1042350	attL	NA	NA	NA	NA
WP_002296902.1\|1042358_1042760_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|1042761_1043133_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|1043168_1043471_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|1043719_1043920_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002286469.1\|1044224_1045457_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|1045710_1046280_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
1045686:1045701	attR	NA	NA	NA	NA
WP_002286465.1\|1046457_1046898_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|1047055_1047820_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|1047851_1048775_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|1048850_1049990_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|1049982_1050783_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|1050782_1051610_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|1051587_1052322_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|1052421_1053288_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|1053301_1053874_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002296544.1\|1053895_1054924_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.2e-69	43.2
WP_002294531.1\|1055021_1055873_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.0
WP_002296543.1\|1055907_1057941_+	hypothetical protein	NA	NA	NA	NA
WP_060805065.1\|1057984_1059265_+	EpaQ family protein	NA	NA	NA	NA
WP_002289081.1\|1059474_1060281_+	ABC transporter permease	NA	NA	NA	NA
WP_002296541.1\|1060292_1061513_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-11	26.4
WP_002296539.1\|1061502_1063089_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002296538.1\|1063127_1065266_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002297271.1\|1065333_1066293_-\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1355763 : 1364814

Lysinibacillus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297185.1\|1355763_1357059_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002297115.1\|1357228_1357606_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1357861_1358590_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1358589_1358844_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1358845_1359517_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1359517_1361740_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1361724_1363164_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002321731.1\|1363195_1364239_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1364235_1364814_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_5

1640189 : 1692958

Streptococcus_phage(16.67%)

protease,integrase,transposase

attL 1684676:1684691|attR 1694397:1694412

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287525.1\|1640189_1641338_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|1641354_1641759_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_123835867.1\|1642160_1642349_+	hypothetical protein	NA	NA	NA	NA
WP_002295138.1\|1642875_1643349_+	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_002295139.1\|1643357_1643585_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002295142.1\|1644220_1644592_+	hypothetical protein	NA	NA	NA	NA
WP_002291278.1\|1644847_1645090_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002296679.1\|1645121_1646024_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002291274.1\|1646036_1646225_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002296677.1\|1646238_1646802_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002300977.1\|1646839_1647733_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.2e-59	46.0
WP_002296674.1\|1647810_1648749_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002296672.1\|1648782_1649133_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002296671.1\|1649165_1650068_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002296670.1\|1650060_1650918_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
WP_002296669.1\|1651251_1652061_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002296667.1\|1652100_1652598_+	cysteine hydrolase	NA	NA	NA	NA
WP_002321681.1\|1653242_1653566_+	hypothetical protein	NA	NA	NA	NA
WP_002296665.1\|1653729_1653984_+	hypothetical protein	NA	NA	NA	NA
WP_002296663.1\|1654053_1654299_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296662.1\|1654374_1654740_+	hypothetical protein	NA	NA	NA	NA
WP_002303842.1\|1654800_1655364_-	hypothetical protein	NA	NA	NA	NA
WP_002296654.1\|1658309_1659395_-	mannonate dehydratase	NA	NA	NA	NA
WP_002296653.1\|1659411_1659855_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002321678.1\|1659888_1660242_-	hypothetical protein	NA	NA	NA	NA
WP_002296650.1\|1660353_1660755_-	hypothetical protein	NA	NA	NA	NA
WP_002296648.1\|1660791_1661301_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002303107.1\|1661322_1662180_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002296646.1\|1662197_1663031_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002303106.1\|1663044_1663842_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002321677.1\|1663874_1664159_-	alcohol dehydrogenase	NA	NA	NA	NA
WP_002296641.1\|1664155_1665157_-	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
WP_002296640.1\|1665158_1666061_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.3e-53	35.3
WP_002296639.1\|1666224_1667073_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002296638.1\|1667718_1667925_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296637.1\|1668126_1669128_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002311095.1\|1669132_1671046_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_002296633.1\|1671876_1672317_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_138013276.1\|1672342_1673365_-	hypothetical protein	NA	NA	NA	NA
WP_002346735.1\|1673422_1674382_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_002296631.1\|1674570_1674927_-	hypothetical protein	NA	NA	NA	NA
WP_002296629.1\|1675224_1676199_-	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_002296628.1\|1676394_1677234_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|1677418_1678306_+	rotamase	NA	NA	NA	NA
WP_002311093.1\|1678899_1679595_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|1679578_1679977_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002297404.1\|1680385_1681636_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296760.1\|1681777_1682773_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002289423.1\|1682790_1683345_-	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289422.1\|1683332_1683824_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289421.1\|1683816_1685685_-	HTH domain-containing protein	NA	NA	NA	NA
1684676:1684691	attL	NA	NA	NA	NA
WP_002289420.1\|1685703_1686504_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289418.1\|1686727_1686943_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002303864.1\|1687081_1687567_+	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|1688022_1688436_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002322258.1\|1688572_1688833_+	hypothetical protein	NA	NA	NA	NA
WP_002303865.1\|1688760_1689000_+	hypothetical protein	NA	NA	NA	NA
WP_002321532.1\|1688950_1689241_+	hypothetical protein	NA	NA	NA	NA
WP_002288357.1\|1691830_1692958_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
1694397:1694412	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1758284 : 1821574

Streptococcus_phage(21.43%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|1758284_1759580_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002296400.1\|1759719_1761054_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_002296401.1\|1761184_1761946_-	YdcF family protein	NA	NA	NA	NA
WP_002296402.1\|1761961_1762444_-	SprT family protein	NA	NA	NA	NA
WP_002296403.1\|1762463_1764644_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_002296404.1\|1764787_1765519_-	serine/threonine protein phosphatase	A7KV25	Bacillus_phage	1.7e-15	30.8
WP_002296405.1\|1765587_1766529_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_002296407.1\|1766708_1767077_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_002295194.1\|1767687_1769079_-	L-cystine transporter	NA	NA	NA	NA
WP_002291995.1\|1769291_1769678_-	DUF1149 family protein	NA	NA	NA	NA
WP_002295196.1\|1769733_1770357_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_002295197.1\|1770420_1771089_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_002322028.1\|1771100_1771541_-	hypothetical protein	NA	NA	NA	NA
WP_002295199.1\|1771599_1772271_-	transcriptional regulator	NA	NA	NA	NA
WP_002287525.1\|1772456_1773605_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|1773621_1774026_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002295200.1\|1774346_1774745_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_002296408.1\|1774741_1775515_-	DUF1538 domain-containing protein	NA	NA	NA	NA
WP_002296409.1\|1775511_1776195_-	DUF1538 domain-containing protein	NA	NA	NA	NA
WP_002289130.1\|1776361_1777249_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002289133.1\|1778250_1779537_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_060805073.1\|1779809_1780388_+	response regulator	NA	NA	NA	NA
WP_002289135.1\|1780387_1781317_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002289137.1\|1783111_1783948_-	prephenate dehydratase	NA	NA	NA	NA
WP_002289138.1\|1783944_1784454_-	shikimate kinase	NA	NA	NA	NA
WP_002289139.1\|1784446_1785742_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_002289140.1\|1785754_1786846_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_002289142.1\|1786862_1788029_-	chorismate synthase	A0A291AU41	Pandoravirus	1.6e-39	35.3
WP_002289143.1\|1788030_1789095_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_002289144.1\|1789127_1790150_-	3-deoxy-7-phosphoheptulonate synthase	NA	NA	NA	NA
WP_002320911.1\|1790481_1790691_+	hypothetical protein	NA	NA	NA	NA
WP_002289516.1\|1790808_1791783_-	beta-galactosidase	NA	NA	NA	NA
WP_002289518.1\|1791763_1793647_-	glycoside hydrolase family 2	L0N6M2	Herpes_simplex_virus	1.1e-98	34.4
WP_002296412.1\|1793664_1795890_-	alpha-galactosidase	NA	NA	NA	NA
WP_002296414.1\|1796004_1797039_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002296415.1\|1797105_1798119_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	7.9e-11	23.3
WP_002288466.1\|1798196_1798385_-	hypothetical protein	A0A218MNE0	uncultured_virus	2.6e-08	50.9
WP_002297185.1\|1798908_1800204_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002297218.1\|1800478_1801774_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002295229.1\|1801868_1801997_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_002288467.1\|1801999_1803373_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	D0R096	Streptococcus_phage	7.1e-140	55.9
WP_002288473.1\|1804547_1805978_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_002317639.1\|1805974_1807447_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_002288477.1\|1807446_1807752_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_002323115.1\|1807857_1809894_-	NAD-dependent DNA ligase LigA	A0A289ZTZ3	Serratia_phage	4.8e-100	37.1
WP_002319708.1\|1809910_1812145_-	DNA helicase PcrA	A7KV33	Bacillus_phage	9.5e-126	40.1
WP_002317636.1\|1812299_1813859_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_002323114.1\|1813969_1815901_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_002288484.1\|1815918_1816833_-	1-phosphofructokinase	NA	NA	NA	NA
WP_002323503.1\|1816829_1817582_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002294422.1\|1817740_1817950_-	hypothetical protein	NA	NA	NA	NA
WP_002288487.1\|1817960_1819289_-	hypothetical protein	NA	NA	NA	NA
WP_002288491.1\|1819653_1820241_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_002294425.1\|1820323_1821574_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	5.5e-147	62.5

DBSCAN-SWA_7

1944515 : 2003803

Streptococcus_phage(40.0%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002347404.1\|1944515_1945001_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002326253.1\|1945023_1945782_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	6.5e-26	36.9
WP_002322842.1\|1945797_1946976_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.1e-102	48.9
WP_002326254.1\|1947205_1949326_+	LTA synthase family protein	W6LM83	Streptococcus_phage	6.3e-220	58.3
WP_127817623.1\|1950847_1951078_-	hypothetical protein	NA	NA	NA	NA
WP_002326255.1\|1952575_1953301_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1953290_1953800_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1953869_1955318_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288595.1\|1956013_1956364_-	SdpI family protein	NA	NA	NA	NA
WP_002293945.1\|1956507_1957281_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002293947.1\|1957855_1958038_+	hypothetical protein	NA	NA	NA	NA
WP_085838153.1\|1958122_1959076_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002323892.1\|1959319_1959634_-	hypothetical protein	NA	NA	NA	NA
WP_002321266.1\|1959919_1960159_+	hypothetical protein	NA	NA	NA	NA
WP_060806716.1\|1960520_1960781_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1960966_1961464_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1961593_1962304_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1962316_1963981_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|1964185_1964848_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|1964857_1965673_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1965934_1966378_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|1966511_1966850_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002302962.1\|1966837_1967215_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002322902.1\|1967438_1968632_+	MFS transporter	NA	NA	NA	NA
WP_010729581.1\|1968797_1969178_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002303955.1\|1969810_1970266_+	hypothetical protein	NA	NA	NA	NA
WP_002293154.1\|1970233_1970431_-	hypothetical protein	NA	NA	NA	NA
WP_130032945.1\|1970427_1971600_-	class C sortase	NA	NA	NA	NA
WP_002288981.1\|1971804_1972620_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002303960.1\|1973230_1974244_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002303962.1\|1974274_1974733_-	cell wall anchor	NA	NA	NA	NA
WP_002303963.1\|1974729_1977057_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288972.1\|1977698_1977812_+\|protease	CAAX amino protease	NA	NA	NA	NA
WP_002288970.1\|1977899_1978193_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002311684.1\|1978229_1978415_+	hypothetical protein	NA	NA	NA	NA
WP_002286913.1\|1978450_1978798_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293717.1\|1978933_1979695_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002293716.1\|1979684_1980206_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002290277.1\|1981290_1981542_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|1981553_1981829_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|1982081_1982636_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|1982714_1983236_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|1983239_1983818_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|1983929_1985348_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|1985368_1985707_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|1985666_1986170_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|1986300_1987005_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002303966.1\|1987001_1988738_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_099745856.1\|1991315_1991498_-	RNA helicase	NA	NA	NA	NA
WP_002289807.1\|1993133_1994024_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002300070.1\|1994220_1994703_-	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|1994914_1995280_+	hypothetical protein	NA	NA	NA	NA
WP_002326708.1\|1995370_1995688_-	SdpI family protein	NA	NA	NA	NA
WP_076720001.1\|1996429_1997389_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.7e-10	26.8
WP_002301623.1\|1997511_1998486_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	7.1e-25	31.8
WP_002297404.1\|1998896_2000147_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295273.1\|2000432_2000690_+	hypothetical protein	NA	NA	NA	NA
WP_008266934.1\|2000921_2001335_-	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_000997695.1\|2001591_2002770_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002295743.1\|2002894_2003803_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

2229351 : 2235024

uncultured_Caudovirales_phage(50.0%)

portal,head,capsid,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296483.1\|2229351_2229687_-\|head	phage head closure protein	V5UQC7	Enterococcus_phage	4.7e-13	35.6
WP_002296484.1\|2229673_2229958_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002296485.1\|2230013_2231537_-\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
WP_002296486.1\|2231529_2232705_-\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002317249.1\|2232708_2232894_-	hypothetical protein	NA	NA	NA	NA
WP_103021673.1\|2232859_2234554_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8
WP_002296488.1\|2234550_2235024_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA

DBSCAN-SWA_9

2266829 : 2322977

Bacillus_phage(15.38%)

tRNA,integrase,transposase

attL 2267805:2267821|attR 2297444:2297460

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000222572.1\|2266829_2267783_+\|transposase	IS30 family transposase	NA	NA	NA	NA
2267805:2267821	attL	NA	NA	NA	NA
WP_002289406.1\|2267816_2269046_-	GTPase HflX	NA	NA	NA	NA
WP_002289405.1\|2269047_2269965_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_002289404.1\|2269968_2270706_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.3e-12	40.0
WP_002289403.1\|2270796_2271324_-	hypothetical protein	NA	NA	NA	NA
WP_002289402.1\|2271503_2272097_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.9e-55	55.6
WP_002289401.1\|2272200_2272686_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_002296291.1\|2272838_2273036_-	hypothetical protein	NA	NA	NA	NA
WP_002289400.1\|2273130_2274891_-	multidrug efflux ABC transporter subunit EfrB	W8CYL7	Bacillus_phage	2.5e-52	28.6
WP_002296290.1\|2274887_2276618_-	multidrug efflux ABC transporter subunit EfrA	W8CYL7	Bacillus_phage	2.1e-43	27.6
WP_002287947.1\|2277010_2277223_+	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_002287948.1\|2277224_2278904_+	ribonuclease J	NA	NA	NA	NA
WP_073119932.1\|2278914_2279199_+	hypothetical protein	NA	NA	NA	NA
WP_002294067.1\|2279157_2279358_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.7e-21	71.2
WP_000868132.1\|2279790_2280876_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	4.5e-12	28.3
WP_001557544.1\|2280872_2282765_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000361059.1\|2282771_2283149_+\|transposase	transposase	NA	NA	NA	NA
WP_002360186.1\|2283609_2284764_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_094467217.1\|2285095_2287063_+	ABC-F type ribosomal protection protein OptrA	A0A2K9L3Z8	Tupanvirus	1.8e-51	28.5
WP_024378353.1\|2287992_2288355_+	hypothetical protein	NA	NA	NA	NA
WP_001092058.1\|2289600_2290263_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_105466976.1\|2291093_2291747_-	HAD family phosphatase	NA	NA	NA	NA
WP_002294071.1\|2291736_2293050_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287953.1\|2293359_2296005_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002287954.1\|2296397_2297045_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287955.1\|2297617_2298829_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
2297444:2297460	attR	NA	NA	NA	NA
WP_002287957.1\|2300150_2301872_-	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_002287958.1\|2302070_2302631_-	haloacid dehalogenase	A0A0H3UZF4	Geobacillus_virus	2.3e-28	45.1
WP_002287959.1\|2302656_2303496_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002287960.1\|2303529_2304363_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_002287961.1\|2304594_2305563_+	asparaginase	NA	NA	NA	NA
WP_002287962.1\|2305717_2306455_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_002287963.1\|2306470_2307304_-	phosphotransferase	NA	NA	NA	NA
WP_002294080.1\|2307505_2308834_-	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	7.3e-73	38.1
WP_002287965.1\|2309923_2310553_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002304454.1\|2310572_2310755_+	hypothetical protein	NA	NA	NA	NA
WP_002287966.1\|2310666_2311041_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_086956687.1\|2311249_2312411_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002322034.1\|2316052_2316250_+	hypothetical protein	NA	NA	NA	NA
WP_002287172.1\|2318583_2318946_-	hypothetical protein	NA	NA	NA	NA
WP_002287231.1\|2319019_2319400_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_002296072.1\|2319481_2320657_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002287167.1\|2320733_2321318_-	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	2.0e-27	43.4
WP_002297404.1\|2321726_2322977_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_10

2470275 : 2503727

uncultured_virus(15.38%)

protease,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296840.1\|2470275_2471463_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002288864.1\|2471875_2473501_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002288862.1\|2473551_2473836_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288860.1\|2474060_2474723_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002288858.1\|2474798_2476091_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002288856.1\|2476260_2476890_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_002288854.1\|2476992_2477802_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
WP_002288853.1\|2477856_2478726_-	hypothetical protein	NA	NA	NA	NA
WP_002288852.1\|2478726_2480043_-	hypothetical protein	NA	NA	NA	NA
WP_002288851.1\|2480039_2481875_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.0e-37	37.7
WP_002288850.1\|2481879_2482584_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_002288847.1\|2482773_2483634_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	24.4
WP_002322652.1\|2483620_2484190_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_000222572.1\|2484819_2485773_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002321654.1\|2485769_2485916_-\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002287810.1\|2486019_2486331_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002304799.1\|2486332_2486530_-	enterocin	NA	NA	NA	NA
WP_002287807.1\|2486923_2488651_-	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002287805.1\|2488643_2489837_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287801.1\|2490023_2490668_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002304795.1\|2490615_2490807_-	hypothetical protein	NA	NA	NA	NA
WP_002290587.1\|2490761_2490896_-	hypothetical protein	NA	NA	NA	NA
WP_002287799.1\|2490897_2493030_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_002287797.1\|2493026_2493500_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287795.1\|2493900_2494125_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287793.1\|2494283_2496443_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287792.1\|2496492_2497458_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287791.1\|2497546_2498686_-	AI-2E family transporter	NA	NA	NA	NA
WP_002287788.1\|2498994_2499708_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287787.1\|2499961_2500663_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002290558.1\|2500896_2502429_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002295743.1\|2502818_2503727_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP040237

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040237_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040237_1

430-557

Orphan

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP040237_1

>merge|NZ_CP040237|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP040237|1|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040237.1\|WP_002302867.1\|8573_8834_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040237.1\|WP_002311524.1\|3674_3908_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040237.1\|WP_060805016.1\|8830_10921_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|375475
NZ_CP040237.1\|WP_060805017.1\|7799_8561_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040237.1\|WP_002311521.1\|2832_3174_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP040237.1\|WP_002316053.1\|7031_7784_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP040237.1\|WP_002313095.1\|4313_4985_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP040237.1\|WP_002311523.1\|3192_3483_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040237.1\|WP_002322486.1\|1881_2214_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040237.1\|WP_060805018.1\|5037_7017_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637

Protein	Function_ID	Function_description	E-value
NZ_CP040237.1\|WP_002316053.1\|7031_7784_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.23538e-60
NZ_CP040237.1\|WP_002313095.1\|4313_4985_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	4.30589e-43
NZ_CP040237.1\|WP_002311521.1\|2832_3174_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	8.60138e-49
NZ_CP040237.1\|WP_060805016.1\|8830_10921_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|375475	pfam17998, AgI_II_C2, Cell surface antigen I/II C2 terminal domain. This is the second domain (C2) located in the C-terminal region found in antigen I/II type adhesin protein AspA from S. pyogenes. Together with C3, these two domains form an elongated structure, each domain adopts the DEv-IgG fold. Similar to the classical IgG folds, it is comprised of two major antiparallel beta-sheets, designated ABED and CFG. For the C2-domain, there are two additional strands on the CFG sheet. Furthermore, sheets ABED and CFG are interconnected by several cross-connecting loops and one alpha-helix (DH1). The side chains of D982 and N996 in the C2-domain are involved in hydrogen bonding with the side chains of R1264 and N1295 in the C3 domain. Main chain hydrogen bonding can also be observed between S992 in C2 and N1189/G1191 in C3, furthermore stabilizing the interaction between the domains. The C2 domain contains one bound metal ion, modeled as Ca2+, and both the C2- and C3-domains are stabilized by conserved isopeptide bonds, which connect the beta-sheets of the central DEv-IgG motifs.Other members of this family include Major cell-surface adhesin PAc from Streptococcus mutans and SspB from Streptococcus gordonii.	1.29104e-15
NZ_CP040237.1\|WP_060805018.1\|5037_7017_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.35074e-30

>NZ_CP040237.1|WP_002322486.1|1881_2214_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP040237.1|WP_002311521.1|2832_3174_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALNEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP040237.1|WP_002311523.1|3192_3483_+|hypothetical-protein
MKFFEVKSPYYYALIAAKNEEECAELYEQVVTDIENREEFIRCLHELNRNEAIQEDAKKISEETLQPIGMEEATKDIFTIIDEQKSCVLSIDSTLV
>NZ_CP040237.1|WP_002311524.1|3674_3908_+|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWREHNGIKDLKPARPVIRRKKLKK
>NZ_CP040237.1|WP_002313095.1|4313_4985_+|class-A-sortase
MKKWLFGFLGVALIVFCSVFGYVSYQKHEGEVFKQNIEKKMPIDQINEHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQAFAQIQIPALGLTLPIFKGANQYTLSLGAATYFYEDAEMRKGNYVLAGHNMEIPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP040237.1|WP_060805018.1|5037_7017_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDVDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQALPREDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLESAEFAAKNAEGKYYGGLVDTDKNGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP040237.1|WP_002316053.1|7031_7784_+|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLEPNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKKQKLSWTWLLGSTVFLSVMIIGSLFVYKKKK
>NZ_CP040237.1|WP_060805017.1|7799_8561_+|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGQKLEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKDRVKKLFSDQLKLVSNGKTKTIDQQTGVFEFSIEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNGEFLKDVWIYPKSEASQPKEEVKKIVSTGVKKNFFENCWDFVTHLFSRD
>NZ_CP040237.1|WP_002302867.1|8573_8834_+|hypothetical-protein
MKLIKLLLFNFSCLTAVFLYCGLLFSKLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG
>NZ_CP040237.1|WP_060805016.1|8830_10921_+|isopeptide-forming-domain-containing-fimbrial-protein
MNFKHSWTRRLKYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKNIRYPSFQKEYGETNLVLEGVTTNTKVNIDYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIVYHSTQMNVQLVATYEDGSPVQFSGDTFISFNSLNPAGGKTTDLKGEYAHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKLTQADNDFNNLHDKLGDPKFGQGTVSFKISEANPTFVIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKVNRLGVDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSGEVTYDKTKHQVKYAAKADTLKNRMKYNGETYELVINVKVNELANQNSVAKNQGTSIINKVEKDTNIITVYFPKIPVKEVQQNGKDVNGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDAASDHYKQFSIQDPIEARLTYKEGSAQVIDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPLQSEKNIDNQAVVAVDNVSNKTNVVTIGVDPNLPQVIVPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.2\|516\|19\|NZ_CP040237\|CRISPRCasFinder	516-534	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP040237_1	1.1\|453\|40\|NZ_CP040237\|CRISPRCasFinder	453-492	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|516|19|NZ_CP040237|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|453|40|NZ_CP040237|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25321 : 133390

105

Bacillus_phage(18.52%)

transposase,holin,integrase

attL 60084:60099|attR 138050:138068

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060811263.1\|25321_26281_+\|transposase	IS30-like element IS6770 family transposase	W5R8L2	Staphylococcus_phage	3.0e-36	36.1
WP_002311551.1\|26774_27062_+	hypothetical protein	NA	NA	NA	NA
WP_002311552.1\|27079_27502_+	hypothetical protein	NA	NA	NA	NA
WP_033583488.1\|27521_29114_+	hypothetical protein	NA	NA	NA	NA
WP_002316755.1\|29369_29564_+	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|29699_30950_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002311557.1\|31359_33732_+	hypothetical protein	B5SP25	Lactococcus_phage	1.1e-10	28.9
WP_002353044.1\|33792_35253_+	hypothetical protein	NA	NA	NA	NA
WP_002353045.1\|35263_35707_+	topoisomerase	NA	NA	NA	NA
WP_002295629.1\|37714_38311_+	transcriptional regulator	NA	NA	NA	NA
WP_002340481.1\|38323_39223_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002295625.1\|39731_39989_+	hypothetical protein	NA	NA	NA	NA
WP_002311565.1\|40147_40282_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295623.1\|40424_40685_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002295619.1\|41133_41340_+	hypothetical protein	NA	NA	NA	NA
WP_002293542.1\|41339_41591_+	hypothetical protein	NA	NA	NA	NA
WP_002311567.1\|41606_42044_+	hypothetical protein	NA	NA	NA	NA
WP_024635938.1\|42263_42464_+	hypothetical protein	NA	NA	NA	NA
WP_060804903.1\|42479_42668_+	hypothetical protein	NA	NA	NA	NA
WP_002314432.1\|42725_42992_+	hypothetical protein	NA	NA	NA	NA
WP_002340480.1\|43001_43235_+	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_002335346.1\|43577_43760_+	hypothetical protein	NA	NA	NA	NA
WP_002340479.1\|43749_43971_+	hypothetical protein	NA	NA	NA	NA
WP_002290556.1\|45966_46734_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002290555.1\|47221_47647_+	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_002290554.1\|47663_48179_+	galactose-6-phosphate isomerase subunit LacB	A0A222YX14	Synechococcus_phage	3.3e-05	36.0
WP_002340477.1\|48189_49122_+	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_002290551.1\|49124_50105_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002290550.1\|50132_50450_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002340476.1\|50449_52156_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002290548.1\|52297_53704_+	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	3.6e-46	29.0
WP_002305107.1\|53726_53999_+	DUF3884 family protein	NA	NA	NA	NA
WP_002303235.1\|54019_54919_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_002326839.1\|58556_59466_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002300833.1\|59868_61815_+	PTS transporter subunit EIIA	NA	NA	NA	NA
60084:60099	attL	NA	NA	NA	NA
WP_002300835.1\|61817_62273_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
60084:60099	attL	NA	NA	NA	NA
WP_002300836.1\|62286_63615_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002300838.1\|63648_63933_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002300840.1\|63934_64450_+	YjbQ family protein	NA	NA	NA	NA
WP_002300841.1\|64465_65128_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002300842.1\|65134_65707_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002300843.1\|65893_67414_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.1e-48	31.6
WP_002305884.1\|67656_67842_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_002300846.1\|67825_68008_-	hypothetical protein	NA	NA	NA	NA
WP_002301839.1\|68961_69561_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.3e-29	36.1
WP_002322465.1\|69624_70224_+	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|70253_70940_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002305879.1\|71268_72141_-	ROK family protein	NA	NA	NA	NA
71868:71883	attR	NA	NA	NA	NA
WP_002352509.1\|72404_74351_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
71868:71883	attR	NA	NA	NA	NA
WP_002302078.1\|74535_75975_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002302077.1\|75976_76939_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_060807298.1\|76941_77124_-	hypothetical protein	NA	NA	NA	NA
WP_086953894.1\|78632_80059_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|80301_80757_+\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_002325009.1\|80777_81011_+	hypothetical protein	NA	NA	NA	NA
WP_002289255.1\|81342_81573_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|81802_82621_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|82781_83471_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|83484_84987_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002300328.1\|84999_85476_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_086956687.1\|85972_87135_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002322543.1\|87400_87592_-	fructokinase	NA	NA	NA	NA
WP_002305874.1\|87637_87886_-	hypothetical protein	NA	NA	NA	NA
WP_002287870.1\|88252_88771_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002313170.1\|89113_89317_+	hypothetical protein	NA	NA	NA	NA
WP_002301591.1\|90846_91932_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_000222572.1\|92039_92993_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002301126.1\|93123_94374_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_138013295.1\|94392_95319_-	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
WP_002301128.1\|95397_96393_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002301130.1\|96408_97578_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002301131.1\|97593_98328_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_086956687.1\|99098_100261_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002301811.1\|100829_102122_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.1e-32	41.0
WP_002313174.1\|102395_102656_-	hypothetical protein	NA	NA	NA	NA
WP_000195429.1\|102828_104001_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002300493.1\|104161_105331_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002300494.1\|105655_106975_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|106971_107625_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002349129.1\|107686_107827_-	hypothetical protein	NA	NA	NA	NA
WP_002348630.1\|108753_109470_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.5e-45	50.0
WP_002302256.1\|109519_109729_-	hypothetical protein	NA	NA	NA	NA
WP_002302261.1\|111385_112417_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6
WP_002313180.1\|112423_113254_-	ABC transporter permease	NA	NA	NA	NA
WP_002302265.1\|113250_114057_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002302267.1\|114062_114887_-	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
WP_002302268.1\|114876_115977_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002302270.1\|116154_116940_+	histidinol phosphate phosphatase	NA	NA	NA	NA
WP_002330694.1\|116972_117356_+	hypothetical protein	NA	NA	NA	NA
WP_077828694.1\|117431_117563_+	hypothetical protein	NA	NA	NA	NA
WP_002322470.1\|117531_117768_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_077828693.1\|117779_117947_+	hypothetical protein	NA	NA	NA	NA
WP_002302275.1\|117845_118817_-	radical SAM protein	NA	NA	NA	NA
WP_002340465.1\|119468_121091_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	2.7e-122	47.5
WP_002301195.1\|121376_122753_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|122752_123409_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|123418_124696_-	ABC transporter permease	NA	NA	NA	NA
WP_087121905.1\|124945_126107_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002330699.1\|126137_126587_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_010706480.1\|126742_127093_-	hypothetical protein	NA	NA	NA	NA
WP_102829664.1\|127512_128674_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	9.2e-80	54.2
WP_138013300.1\|129267_129564_-	hypothetical protein	NA	NA	NA	NA
WP_002330700.1\|130812_131364_-	hypothetical protein	NA	NA	NA	NA
WP_002301108.1\|131419_131974_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_085807902.1\|132436_133390_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.0e-11	29.0
138050:138068	attR	NA	NA	NA	NA

DBSCAN-SWA_2

137383 : 202670

Streptococcus_phage(46.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010729766.1\|137383_137995_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.9e-99	84.7
WP_002351514.1\|138055_138652_+	recombinase family protein	M9Q1K0	Clostridium_phage	2.9e-13	31.4
WP_002296127.1\|139313_140861_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002287659.1\|140962_141316_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002285758.1\|141305_141500_-	hypothetical protein	NA	NA	NA	NA
WP_076720031.1\|142455_144801_-	S8 family serine peptidase	NA	NA	NA	NA
WP_080497384.1\|144815_145958_-	ATP-binding protein	R4TQL5	Phaeocystis_globosa_virus	1.2e-15	24.5
WP_138013296.1\|146003_146822_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_000195429.1\|146813_147986_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_001028141.1\|148115_149555_-	bifunctional aminoglycoside N-acetyltransferase AAC(6')-Ie/aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A0N9SKF6	Staphylococcus_phage	8.5e-285	100.0
WP_000393259.1\|149555_149948_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	6.9e-72	100.0
WP_000195429.1\|150004_151177_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002380753.1\|151283_152774_-	replication protein RepR	NA	NA	NA	NA
WP_002380754.1\|153167_153407_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010714231.1\|153650_153764_-	hypothetical protein	E4ZFP9	Streptococcus_phage	3.4e-08	88.2
WP_001038792.1\|153768_154506_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_001814874.1\|154630_154714_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_002401483.1\|155389_156253_-	toxin zeta	NA	NA	NA	NA
WP_000301765.1\|156254_156527_-	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_002295735.1\|156543_156759_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	1.4e-31	98.6
WP_118215883.1\|156829_157726_-	ParA family protein	A0A1X9I765	Streptococcus_phage	3.3e-154	99.3
WP_000085862.1\|158122_158254_-	hypothetical protein	E4ZFP9	Streptococcus_phage	7.9e-17	100.0
WP_001038792.1\|158258_158996_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_001809736.1\|159120_159216_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_000635249.1\|159264_159504_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	6.8e-22	81.5
WP_130006275.1\|159631_161776_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.0e-269	98.8
WP_076720021.1\|162096_162312_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_076720020.1\|162289_162874_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.0e-42	52.2
WP_125278162.1\|163444_164500_-	TIGR00341 family protein	NA	NA	NA	NA
WP_125278163.1\|164691_165297_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.5e-17	33.3
WP_076720015.1\|165325_167206_-	ATP-binding protein	NA	NA	NA	NA
WP_138013297.1\|167198_167948_-	hypothetical protein	NA	NA	NA	NA
WP_002296840.1\|168124_169312_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_138013298.1\|169404_169665_-	hypothetical protein	NA	NA	NA	NA
WP_002291076.1\|170385_171507_-	class C sortase	NA	NA	NA	NA
WP_076720012.1\|171503_172700_-	class C sortase	NA	NA	NA	NA
WP_076720010.1\|172785_174273_-	SpaH/EbpB family LPXTG-anchored major pilin	NA	NA	NA	NA
WP_076720009.1\|174337_175069_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002319817.1\|179505_180186_-\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_002292681.1\|181973_182522_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|182522_183380_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_076713767.1\|183665_183953_-	hypothetical protein	NA	NA	NA	NA
WP_002292678.1\|183942_184272_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_106914394.1\|184444_185125_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-126	97.8
WP_138013299.1\|187556_188429_-	ROK family protein	NA	NA	NA	NA
WP_016629104.1\|188445_189918_-	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_002313079.1\|189931_190780_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002322555.1\|190776_191643_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002322554.1\|191685_193044_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010729506.1\|193138_194110_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-05	22.4
WP_002313084.1\|195144_195750_+	recombinase family protein	A0A219YA40	Aeromonas_phage	3.6e-19	32.6
WP_002340501.1\|195795_195975_-	hypothetical protein	NA	NA	NA	NA
WP_002348862.1\|196868_197078_-	hypothetical protein	NA	NA	NA	NA
WP_002295743.1\|197582_198491_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_010729753.1\|198549_200352_-	exonuclease DNA polymerase III epsilon subunit	A0A0A7RWA3	Clostridium_phage	7.6e-33	30.4
WP_002342384.1\|200414_201257_-	hypothetical protein	NA	NA	NA	NA
WP_002331328.1\|201272_201494_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085910366.1\|201983_202670_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP040238

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040238_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040238_1

20470-20700

TypeV-U3

Consensus_repeat	Method
ATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC	CRISPRCasFinder
ATGCTGTTTTATATGGTTCTAAA	CRT
ACAATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC	PILER-CR

3 spacers

c2c10_CAS-V-U3

The CRISPR arrays of NZ_CP040238_1

>merge|NZ_CP040238|1|20470-20700|CRISPRCasFinder,CRT,PILER-CR
ATTTGAGAACTATACTATTTTATATGATCCCAGATTTTTTTAACTTGACAATCATTTTAAACAATTTGAGAACTATGCTGTTTTATATGGTTCTAAAGCAGGAACGCCATCAATTAATTTAAAGTACTCATTTGAGAAACATGCTGTTTTATATGGTTCTAAAACTCTTATTATAACATAAATGAAACAAACACAATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC

>NZ_CP040238|1|1|20470-20700|CRISPRCasFinder
ATTTGAGAACTATACTATTTTATATGATCCCAGATT	TTTTTAACTTGACAATCATTTTAAACA
ATTTGAGAACTATGCTGTTTTATATGGTTCTAAAGC	AGGAACGCCATCAATTAATTTAAAGTACTC
ATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC	TCTTATTATAACATAAATGAAACAAACACA
ATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC

>NZ_CP040238|1|1|20481-20698|CRT
ATACTATTTTATATGATCCCAGA	TTTTTTTAACTTGACAATCATTTTAAACAATTTGAGAACT
ATGCTGTTTTATATGGTTCTAAA	GCAGGAACGCCATCAATTAATTTAAAGTACTCATTTGAGAAAC
ATGCTGTTTTATATGGTTCTAAA	ACTCTTATTATAACATAAATGAAACAAACACAATTTGAGAAAC
ATGCTGTTTTATATGGTTCTAAA

>NZ_CP040238|1|1|20530-20700|PILER-CR
ACAATTTGAGAACTATGCTGTTTTATATGGTTCTAAAGC	AGGAACGCCATCAATTAATTTAAAGTA
CTCATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC	TCTTATTATAACATAAATGAAACAAAC
ACAATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040238.1\|WP_002320829.1\|18449_18632_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_001557544.1\|10985_12878_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271187
NZ_CP040238.1\|WP_010733708.1\|18968_20294_-\|Y-family-DNA-polymerase	unknown	unknown	gnl\|CDD\|176454
NZ_CP040238.1\|WP_125308478.1\|23662_24556_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_002352923.1\|20810_22037_-\|hypothetical-protein	c2c10_CAS-V-U3	-	unknown
NZ_CP040238.1\|WP_125308493.1\|29142_30186_-\|glycosyhydrolase	unknown	unknown	gnl\|CDD\|379241
NZ_CP040238.1\|WP_002321352.1\|22008_23643_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369600
NZ_CP040238.1\|WP_060763495.1\|25163_26282_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_125308486.1\|28480_28738_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_002320828.1\|18628_18976_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_002320756.1\|15543_16104_-\|SLATT-domain-containing-protein	unknown	unknown	gnl\|CDD\|380134
NZ_CP040238.1\|WP_000868132.1\|12874_13960_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271186
NZ_CP040238.1\|WP_106914365.1\|17098_18277_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP040238.1\|WP_002347527.1\|16123_16945_-\|nucleotidyltransferase	unknown	unknown	gnl\|CDD\|375587
NZ_CP040238.1\|WP_125308489.1\|28740_28971_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_002321530.1\|24810_25131_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_125308483.1\|27181_27370_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_000361059.1\|10601_10979_-\|transposase	unknown	unknown	unknown
NZ_CP040238.1\|WP_125308480.1\|26310_27105_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040238.1\|WP_016922209.1\|14078_14720_-\|DNA-repair-protein-RadC	unknown	unknown	gnl\|CDD\|163702

Protein	Function_ID	Function_description	E-value
NZ_CP040238.1\|WP_002320756.1\|15543_16104_-\|SLATT-domain-containing-protein	gnl\|CDD\|380134	pfam18186, SLATT_4, SMODS and SLOG-associating 2TM effector domain family 4. The SLATT domain contains two transmembrane helices. SLATT domains are generally predicted to function as pore-forming effectors in a class of conflict systems which are reliant on the production of second messenger nucleotide or nucleotide derivatives. SLATT domains are predicted to initiate cell suicide responses upon their activation. This SLATT family is often coupled to the SMODS nucleotide synthetase and is sometimes further embedded in other conflict systems like CRISPR/Cas or R-M systems.	1.4006e-74
NZ_CP040238.1\|WP_000868132.1\|12874_13960_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271186	cd01186, INT_tnpA_C_Tn554, Putative Transposase A from transposon Tn554, C-terminal catalytic domain. This family includes putative Transposase A from transposon Tn554. It belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	4.0175e-100
NZ_CP040238.1\|WP_002347527.1\|16123_16945_-\|nucleotidyltransferase	gnl\|CDD\|375587	pfam18144, SMODS, Second Messenger Oligonucleotide or Dinucleotide Synthetase domain. Nucleotide synthetase enzyme of the DNA polymerase beta superfamily. Experimental studies have demonstrated cGAMP synthetase activity in the Vibrio cholerae DncV protein, a member of the SMODS family. The diversity inherent to the SMODS family suggests members of the family could generate a range of nucleotides, cyclic and/or linear. The nucleotide second messengers generated by the SMODS domains are predicted to activate effectors in a class of conflict systems reliant on the production and sensing of the nucleotide second messengers.	1.87637e-40
NZ_CP040238.1\|WP_010733708.1\|18968_20294_-\|Y-family-DNA-polymerase	gnl\|CDD\|176454	cd01700, PolY_Pol_V_umuC, umuC subunit of DNA Polymerase V. umuC subunit of Pol V. Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.	4.4106e-122
NZ_CP040238.1\|WP_125308493.1\|29142_30186_-\|glycosyhydrolase	gnl\|CDD\|379241	pfam13529, Peptidase_C39_2, Peptidase_C39 like family.	2.15356e-10
NZ_CP040238.1\|WP_002321352.1\|22008_23643_-\|hypothetical-protein	gnl\|CDD\|369600	pfam07926, TPR_MLP1_2, TPR/MLP1/MLP2-like protein. The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.	0.000104492
NZ_CP040238.1\|WP_106914365.1\|17098_18277_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.80245e-107
NZ_CP040238.1\|WP_001557544.1\|10985_12878_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271187	cd01187, INT_tnpB_C_Tn554, Putative Transposase B from transposon Tn554, C-terminal catalytic domain. This family includes putative Transposase B from transposon Tn554. It belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain containing six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	6.6262e-52
NZ_CP040238.1\|WP_016922209.1\|14078_14720_-\|DNA-repair-protein-RadC	gnl\|CDD\|163702	cd08071, MPN_DUF2466, Mov34/MPN/PAD-1 family. Mov34 DUF2466 (also known as DNA repair protein RadC) domain of unknown function contains the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity. However, to date, the name RadC has been misleading and no function has been determined.	5.78099e-24

>NZ_CP040238.1|WP_010733708.1|18968_20294_-|Y-family-DNA-polymerase
MFDYSREPVNDYFLIDMKSFYASVECIERNLDPMTTPLIVMSRSDNTGSGLTLASSPTAKKKYHITNVSRATDLPYPLPKELHIVPPRMNLYIKKNMEVNQIFRKYVADEDLLIYSIDESILKVTKSLNLFTSSGTRSERRRELAKIIKDEIQKETGLIATVGIGDNPLLAKLALDNEAKSSKEFIAEWSYETVPEKIWKINEMTDFWGIGSRMKKRLNHMGIMSIEDLANWNPYTIKSQLGVIGLQLYFHTNGIDRTDIAIPPEPTKEKSYGNSQVLPKDYTRREEVELVVKEMAEQVAIRIRQHNCKTGCVRLAIGTSILEEKSGFSHQMKIPITDNTKELQNYCLFLFNKFYEGQEVRHIGVTYSRLVYTDSLQLDLFSDPRKKIAEENLDRIIDKIRQKYGFTAIIHASSMLEGARSITRSTLIGGHAGGLGGLHND
>NZ_CP040238.1|WP_002320828.1|18628_18976_-|hypothetical-protein
MIEYNDRGRLKWSGFYLSDHTERINADNVQRANHNLAKEQMTTEEIAKILRTAVIKNRPVCIQKEERNAEGYYPDDVVGKIIGYDELGVFVEEEKVHYDEIRNVSFAELLKWSQI
>NZ_CP040238.1|WP_002320829.1|18449_18632_-|hypothetical-protein
MNIIKKYEFGYITYEQLIEELWGYGQQLINEVGIDCFCFYIESGAGYHKNRYYIFPYPPK
>NZ_CP040238.1|WP_106914365.1|17098_18277_+|IS256-family-transposase
MNDFTTEILKTLANKGDLNELFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFNTGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHFFRKGITMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKVRTLNDKYVAIFMDATYIPLKRQTVSKEAIYIAIGIREDGTKEVLSYAIAPTESTYVWNELLQDIYSRGVHDVLLFITDGLKGMKDTIHQIYPKAKYQHCCVHVSRNIAHKVRVKDRKEICDDFKAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIENQDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERFLVSIFDTYNQKFLNRSHKGFQQVTDTLVSMFTE
>NZ_CP040238.1|WP_002347527.1|16123_16945_-|nucleotidyltransferase
MGLLVPRANTYTIPLTKRQLIAKRYQRITRAINREFWNSESDTAHSLYVGSYGRGTAISTSDIDIIVELPMAEFDRFKNYLSNGPSKLLQVIKNAFQEILPNSDIRADGQVVKINFHDGIKFEIVPAFNEKDYWGESKGFIYPDSNMGGNWKATNPKKEQEAMKLKNTKSNNLLYATCKHFRHVRDTEFTSYHLSGIVIDSFVYEAMGNWKFVENNSGGQNISSVSYETALLEYYNSHKVMGGLNLYSPGSNQFVNSDSSIICLEKVLKKIAL
>NZ_CP040238.1|WP_002320756.1|15543_16104_-|SLATT-domain-containing-protein
MGDEKKRLEVQLREAYGRVTYTYTTHLKQADNIISDNKILRCLQIGLSALTTGGVLSTIITDNSELTFVAGLCSTISLGLNLYFKNFDLAEEAKNHQIVADKLWLIREEYVSLLTDLNRLSVEDIVKKRDQLMNETHEAYKNAPKTNSKSYESAQKALKSEEEQFFTEEELDKMLPEHLRKKSSKY
>NZ_CP040238.1|WP_016922209.1|14078_14720_-|DNA-repair-protein-RadC
MRDRILEVNQEMVNKLTNISGNYEKYDGTLLDNYIFHDTQNIRIGRSKPRAFILIKEKYLNEWNSTYEMVMTDNFEKVLDFRNALLGSDMGNSSLESIEVENKTENEGEGLIKNVLKIEQKYISEDRSFYRVTSSVGLANFATNLIGNNASESLLVMCLNTKNEVIAYSEVFKGGINQSVAIPREIFQLALLNNSAKIAVSHNHPSGYELTIV
>NZ_CP040238.1|WP_000868132.1|12874_13960_-|tyrosine-type-recombinase/integrase
MKVQRIEVENKPYPLYLLLDKEYQLIEPVMKFIKYLDNTGKSPNTIKAYCYHLKLLYEFMEQRGVILNDINFELLADFVGWLRYPSASNVIDLQSKKAIREETTVNTILNVVMSFLDYLSRLGEFKSIDVFKQAKGRNFKGFLHHVNKGRYQKNVLKLRVKKKQIRTLRSKEVKQIIDACHTKRDKLILMLMYEGGLRIGEVLSLRLEDIVTWDNQIHLTPRDVNVNEAYIKLRKERTIHVSKELMSLYTDYLIYEYSEELEHDYVFISLKEGYFGKPLKYQSVLDLVRRIVKRTGIEFTSHMLRHTHATQLIREGWDVAFVQKRLGHAHVQTTLNTYVHLSDQDMKNEFNKYLERKEHKK
>NZ_CP040238.1|WP_001557544.1|10985_12878_-|tyrosine-type-recombinase/integrase
MNASSKRKIISQSEISKKIAVMNEEMQGFWANNSWDIRKCPHPSAIELSKNPALRNRWVRFERVKNLWLRTELKYFYFYHLNNGIWNAKTVWIRKGTVINKMLDFLDLKYPSITSITEVPIEKAMTEYRTYLTKRGVRITTTNYKITANQEKTPVKANSYYVTNLKQFMEFYENFYFDGEEWDKDVWDRRNLPLPDDKVNPTQYEYTINFKGFRNTYFKQLVKRYCKLRLNVDSFSYVSDIAQRLKEFFNFLDMKFKQVQRVHQLTRVEIEAYLSELNMMGIKPSTITGRISILEGLFSTLLRLEWDDVPSKILIYSEDYPKIPRAKPRFIDEFVLEQLNSHLDKLPEYIATMTMIVQECGMRISELCTLKKGCLLEDKDGDFFLKYYQWKMKKEHIVPISKEVALLIKVREDKVSEEFPDSEYLFPRKDGSPLKQETFRGELNKLAYEQNIVDKSGEIYRFHAHAFRHTVGTRMINNGMPQHIVQKFLGHESPEMTSRYAHIFDETLKNEFTKFQEKLVTNNGDVLDLDEDNEVDDVELQWFKKNINAQVLPNGYCRLPVVAGGCPHANACLDCTHFCTSKQFLPQHEEQLERTEELLAIAKDKQWQRQVETNSRVKERLEQIIGSLTG
>NZ_CP040238.1|WP_000361059.1|10601_10979_-|transposase
MDKQVRNTTEIVRLAKQKSKKTREKVDKAISKFSIEGKVINFNSIAKEANVSKSWLYKEHDIRQRIESLRERQITANVVSKPKKSSRSEEILIKTLKRRVMELEKENKKLQNQIQKLYGDLYNKE
>NZ_CP040238.1|WP_002352923.1|20810_22037_-|hypothetical-protein
MIFYMFININEVLKLTTITMTKKIEVYVDGSQEERDSFFDFFWKNSREYVKALNLVYKQLMFEELIKDAIKEMDQGYAEREESIQNRIEKLAYTDPIDQKKLDKAKAELSKLRNEKNKEAREILTQAIGLKSQTRTRDVAKKLDFDFGDFVDSANMKASKDFGNDFIGIVTGQRTPRIYKNRSKYGLLPFRGRDIKIHKDDKFYIYLPKGFRFKVNLGSKPRKARDVASVLQHIMDGDYKLNQSNLIFDGRKLFFNLTISFEKRYNELEFKEGNELIVNFADLCSGECLVNNKSVMSFGDSQYIRNFKSKILAMKSKEQSRGVFSKGGHGRKRKLDQDRWEAIKKRESNFVKTYNNQCSAKIVKTAIRNKAQIIRIIEPDKAYGEWAYYQLKEQLVNKGKRYGIEVRS
>NZ_CP040238.1|WP_002321352.1|22008_23643_-|hypothetical-protein
MPEIEGIFSPKIGKKQLDFSSFPSVNRDYNLGDEVQILNIDFKELDFAVAVSNKPKALERVKKIYQENDQNIKNMIKKYRRDNSKVEDVLFNGTAKHDLNVYMALGVALYCNSINQTDILVNIVRNSYQKILKISSETNPYYAMKYLGDNLLNDKKLMHNTEELLSNLAAINFLFKTGSEDYFIDNVLKGAYGTAFYPLYNMKQHKAEQKDNKLEIKKMKELLGIGFVKPNSKVTIASLATTNNNGKIVNGFDDSDIDILSKSYFSLYGDFADLMGIDSYLVNNFEIKGSELNDIVYFVLISLYAIDQNTEYRQIDYLLVFYSLLYQFVLTRLFKNAKEELILNSDYEIAKQIASIRKENKSEVIKLRKELSIASKENGRLESLVKSAKKEEELLKQEIKELKGIRKELEQLRFENKVLKQLQEQEHRQSLNGKTEEPSLSEMIAYLKHKNILLVGGHVNFQNKLTELLPNIKMFDVSENNGKILKNLNTCDAIFLYTDYLNHGLYYRVMSEISNKDKIFYLDNHVNMSLTIKRIYDLLYVYKH
>NZ_CP040238.1|WP_125308478.1|23662_24556_-|hypothetical-protein
MRTHYIYLEDKIIDEIPAKSREQARKLFIEKYKEINGDSEVPKVVVTVRKRQTKKRSTFHVSPDIYNLIERHRSEDNISISQYIATVIDELISGKYDYAFDFEDEKDYKSVAVFQSDFEKLKNYAGRRNVNFARLLEEFYSEELGVGNEYKRETYAKLSHKLSQALKEVTEVKAELDAKLEEVKKYQTERKNNMKNQVEFDEQKEFEKARKRYNKIMNELSYEHLTVHEELSEGTEKYTIADMVNEVETLLASFFENGHVNDEWRKEEPKRVNAYIARLKRFIDKYKENSDKFSKDK
>NZ_CP040238.1|WP_002321530.1|24810_25131_-|hypothetical-protein
MKKKIVEGNVGVIILKDSTDYAKSMALKDEKVARMDKDLVEFLMDDTERLKGDQFLSLMKDKGLNTYGLFDYKKLAIEWVKEGEIFFIEEWEGTENLVLHQYLLKA
>NZ_CP040238.1|WP_060763495.1|25163_26282_-|hypothetical-protein
MGNNSIYTPEMQNKIKRLVGLGWMTRGKLDSFSTIKYLLMDIYRQNKQTGIHFLGYDKPEDAPFFVPSSAYRASTSGSMYNLDLFEEGAKMIEYDFNEAYSRIMRNYPLPSNTYLKAKYNTDQAILRAINRPKVRPYENLKTYMFFLVNFEGTAKEGTYANPKSQSMFADYGENPKTANEPIWLSEIELTLILDYYDIKEMEVLDSHTFLTKKGLLKEYFERIEPLKTDPDTLKLYKNLRTKVFGAIGQKSLREGETNTFDKYSMYNRAYSSMVAGVFRDRMVRYEQKYVHSAYGLLKIRTDGLYFRSEVPEFEELYKLGVVKKKVHTISKEEVEKALEFKNKGFENKGSFGNSKDEVKGVVIDDDFEFDFD
>NZ_CP040238.1|WP_125308480.1|26310_27105_-|hypothetical-protein
MVAKKNTLKEASEKYQDMKRRGLIPKNKKGVWREFVKEVSSDRSNGNFVGRYTAKGYSRRLRITVEYGTNESATELKQRYLDTRREASKKYDDFKRRGLIPKKKKGIWREFFKEEDSDRNKGDFIGRYTAKGYTKNLGIKVEYGTGESSWELRNRYLNILLEKYKAELLELFDVNDFIEMAEKYGHEEGFMINDIMVIDNFTDLLALAKKARDLRETQMYLFRNKNGRNRRTESSEIEDYYDAFTHDLGAFVDEISGVMNKYRV
>NZ_CP040238.1|WP_125308483.1|27181_27370_-|hypothetical-protein
MKIDDFKQNLSDKELNEFIENFDKYKEIRKNLLQQRKKDRANKSDLHPSIKKALDNISKDQN
>NZ_CP040238.1|WP_125308486.1|28480_28738_-|hypothetical-protein
MINEDFRSEQKMIDISLIEKLLFSDKYTAKELATRWQISESAIKAYRQNKGSVGWRDWKGISIGKAEDIMKREGFQADNDSKKVE
>NZ_CP040238.1|WP_125308489.1|28740_28971_-|hypothetical-protein
MNQRRRKRLEEISERLSELKDELEVIQEEEEEYKENIPENLQGSERYEKAEESVDQLEEAVDGLSDILGLIEDITS
>NZ_CP040238.1|WP_125308493.1|29142_30186_-|glycosyhydrolase
MKKFLVGILFTMGLVLLSPSVSAESSISMYRMYNPNSGEHLYTRSVGERDNLKRYGWHYEGVAWQAPTSGTPVYRLYNRYNGEHFYTVDAGERDKISHTGWTYEGVAFYSYNGANRVPVTRLYNKYVNWHHYTLDQNEKNVISKQGWKIEGTGWYAMPNSVPNPIPAPSTEKVLNVPVVWQGNTMLCEGASLLEGLHYKGVATNQSLTSFVNYMPKANDNNPYHGYSGEWRHNVNGTYQGIMPDPVVKWAKNVGGNAVNITGSGTNGIKNEIRNGNPVVTWITYNYATPEFKQMPWGRAVWNGHVVLVDGFRNGAYHVVDPVFGAKWINASTYERAFNVTGMAVAVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040237.1	4836-4865	1	0.967
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040237.1	4839-4865	1	0.963

1. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to position: 4836-4865, mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

2. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to position: 4839-4865, mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11160-11186	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85795-85821	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	10699-10725	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	8958-8984	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP038997	Enterococcus faecium strain SRR24 plasmid pSRR24	9536-9562	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	5876-5902	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16685-16711	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	94150-94176	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78616-78642	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP019994	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2	88542-88568	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2082-2108	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	29516-29542	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20506-20532	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8042-8068	0	1.0
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2666-2692	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11556-11585	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	11095-11124	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	11245-11274	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	8061-8090	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	6272-6301	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	55977-56006	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	98745-98774	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16748-16777	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	52172-52201	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	60989-61018	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2478-2507	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20569-20598	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	43272-43301	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8438-8467	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2729-2758	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	136818-136847	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85396-85425	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	6151-6180	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	4724-4753	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	4819-4848	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	123904-123933	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	4724-4753	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	4819-4848	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78217-78246	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	71708-71737	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	183278-183307	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	39531-39560	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	90519-90548	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	4819-4848	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135300	Enterococcus faecium isolate E7429 plasmid 4	10813-10842	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135491	Enterococcus faecium isolate E8414 plasmid 4	27112-27141	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135366	Enterococcus faecium isolate E8195 plasmid 3	20400-20429	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135403	Enterococcus faecium isolate E8377 plasmid 3	8810-8839	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135396	Enterococcus faecium isolate E8290 plasmid 3	53921-53950	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135387	Enterococcus faecium isolate E7933 plasmid 4	27007-27036	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP044276	Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence	9511-9540	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP042836	Enterococcus sp. DA9 plasmid unnamed1	542-571	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP042837	Enterococcus sp. DA9 plasmid unnamed2	26328-26357	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	1126-1155	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP027519	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence	18779-18808	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135342	Enterococcus faecium isolate E7356 plasmid 4	28195-28224	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135295	Enterococcus faecium isolate E7237 plasmid 3	4134-4163	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NC_010880	Enterococcus faecium plasmid pEF1, complete sequence	14112-14141	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135346	Enterococcus faecium isolate E8202 plasmid 3	16929-16958	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR135353	Enterococcus faecium isolate E8014 plasmid 3	32806-32835	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LR134110	Enterococcus faecium isolate E6043 plasmid 6	8306-8335	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16814-16843	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20635-20664	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP018067	Enterococcus faecium strain E1 plasmid pE1_29, complete sequence	7427-7456	0	1.0
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2795-2824	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11158-11197	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85784-85823	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	10697-10736	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	8956-8995	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP038997	Enterococcus faecium strain SRR24 plasmid pSRR24	9534-9573	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	5874-5913	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16683-16722	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	94139-94178	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78605-78644	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP019994	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2	88531-88570	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2080-2119	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	29514-29553	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20504-20543	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8040-8079	0	1.0
NZ_CP040238_1	1.4\|20504\|40\|NZ_CP040238\|CRT	20504-20543	40	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2664-2703	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	136807-136849	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11554-11596	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85385-85427	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	11093-11135	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	11243-11285	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	8059-8101	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	123893-123935	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	6270-6312	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16746-16788	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78206-78248	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2476-2518	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20567-20609	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8436-8478	0	1.0
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2727-2769	0	1.0
NZ_CP040238_1	1.6\|20633\|43\|NZ_CP040238\|CRT	20633-20675	43	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16812-16854	0	1.0
NZ_CP040238_1	1.6\|20633\|43\|NZ_CP040238\|CRT	20633-20675	43	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20633-20675	0	1.0
NZ_CP040238_1	1.6\|20633\|43\|NZ_CP040238\|CRT	20633-20675	43	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2793-2835	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	136821-136847	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85399-85425	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	6154-6180	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	4727-4753	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	4822-4848	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	123907-123933	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	4727-4753	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	4822-4848	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78220-78246	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	71711-71737	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	183281-183307	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	39534-39560	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	90522-90548	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	4822-4848	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11556-11582	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	11095-11121	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	11245-11271	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	8061-8087	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	6272-6298	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	55977-56003	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	98745-98771	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16748-16774	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	52172-52198	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	60989-61015	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2478-2504	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20569-20595	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	43272-43298	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8438-8464	0	1.0
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2729-2755	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	1126-1152	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP027519	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence	18779-18805	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135300	Enterococcus faecium isolate E7429 plasmid 4	10816-10842	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135342	Enterococcus faecium isolate E7356 plasmid 4	28195-28221	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135295	Enterococcus faecium isolate E7237 plasmid 3	4134-4160	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NC_010880	Enterococcus faecium plasmid pEF1, complete sequence	14112-14138	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135491	Enterococcus faecium isolate E8414 plasmid 4	27115-27141	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135366	Enterococcus faecium isolate E8195 plasmid 3	20403-20429	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135403	Enterococcus faecium isolate E8377 plasmid 3	8813-8839	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135396	Enterococcus faecium isolate E8290 plasmid 3	53924-53950	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135346	Enterococcus faecium isolate E8202 plasmid 3	16929-16955	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135353	Enterococcus faecium isolate E8014 plasmid 3	32806-32832	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR135387	Enterococcus faecium isolate E7933 plasmid 4	27010-27036	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LR134110	Enterococcus faecium isolate E6043 plasmid 6	8306-8332	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16814-16840	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP044276	Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence	9514-9540	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP042836	Enterococcus sp. DA9 plasmid unnamed1	545-571	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP042837	Enterococcus sp. DA9 plasmid unnamed2	26331-26357	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20635-20661	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP018067	Enterococcus faecium strain E1 plasmid pE1_29, complete sequence	7427-7453	0	1.0
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2795-2821	0	1.0
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	46726-46755	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	104418-104447	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	90078-90107	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	287701-287730	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	115579-115608	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	12157-12186	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	75629-75658	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	47725-47754	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135477	Enterococcus faecium isolate E8423 plasmid 3	6959-6988	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	86388-86417	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	97412-97441	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	8507-8536	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	92662-92691	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	47623-47652	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	29112-29141	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	35530-35559	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	44725-44754	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	11096-11125	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	43131-43160	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	164278-164307	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP011283	Enterococcus faecium strain E39 plasmid p2, complete sequence	6434-6463	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	6754-6783	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	20782-20811	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	4724-4753	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	15130-15159	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	6709-6738	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	4836-4865	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	8493-8522	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	8376-8405	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	6709-6738	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	4836-4865	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135289	Enterococcus faecium isolate E7199 plasmid 3	12894-12923	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	4368-4397	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	157892-157921	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	4447-4476	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	62592-62621	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	6259-6288	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	4447-4476	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	8492-8521	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	7114-7143	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	59573-59602	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	6705-6734	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	6754-6783	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	4368-4397	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	5434-5463	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	6151-6180	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	4447-4476	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135207	Enterococcus faecium isolate E7171 plasmid 5	4724-4753	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	5492-5521	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	4724-4753	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	8774-8803	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	6709-6738	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	6709-6738	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	4836-4865	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	6709-6738	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	6338-6367	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	6420-6449	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	4368-4397	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	4368-4397	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	206632-206661	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	6151-6180	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	8492-8521	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	8492-8521	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	45021-45050	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	7871-7900	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	7707-7736	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	6727-6756	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	29948-29977	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	29948-29977	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	5492-5521	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	6259-6288	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	5434-5463	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	4835-4864	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	118208-118237	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135309	Enterococcus faecium isolate E7240 plasmid 3	40225-40254	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	4836-4865	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	1645-1674	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	29948-29977	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	6709-6738	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	4725-4754	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	29948-29977	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	65568-65597	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	9108-9137	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	15130-15159	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	29948-29977	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	29948-29977	1	0.967
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	6709-6738	1	0.967
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NZ_CP042836	Enterococcus sp. DA9 plasmid unnamed1	34200-34229	1	0.967
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP011283	Enterococcus faecium strain E39 plasmid p2, complete sequence	6437-6463	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	6757-6783	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	20785-20811	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	4727-4753	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	15133-15159	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	102248-102274	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	4839-4865	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	8496-8522	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	8379-8405	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	4746-4772	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	4839-4865	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	4747-4773	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135289	Enterococcus faecium isolate E7199 plasmid 3	12897-12923	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	4371-4397	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	157895-157921	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	4450-4476	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	4747-4773	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	62595-62621	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	6262-6288	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	4450-4476	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	8495-8521	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135238	Enterococcus faecium isolate E7067 plasmid 4	4728-4754	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	7117-7143	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	59576-59602	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	6708-6734	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	6757-6783	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	4371-4397	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	5437-5463	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	4450-4476	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135207	Enterococcus faecium isolate E7171 plasmid 5	4727-4753	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	5495-5521	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	4727-4753	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	8777-8803	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	10386-10412	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	4839-4865	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	6341-6367	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	6423-6449	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	4371-4397	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	4371-4397	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	206635-206661	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	23847-23873	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	8495-8521	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	8495-8521	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	45024-45050	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	7874-7900	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	7710-7736	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	6730-6756	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	6153-6179	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	29951-29977	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	29951-29977	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	6153-6179	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	6153-6179	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	5495-5521	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	6154-6180	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	6262-6288	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	5437-5463	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	4727-4753	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	4838-4864	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	118211-118237	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135309	Enterococcus faecium isolate E7240 plasmid 3	40228-40254	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	4839-4865	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	1648-1674	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	29951-29977	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	4728-4754	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	29951-29977	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	65571-65597	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	9111-9137	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	15133-15159	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	37705-37731	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	29951-29977	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	29951-29977	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	6712-6738	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	215527-215553	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	46726-46752	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	104418-104444	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	90078-90104	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	287701-287727	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	352516-352542	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	115579-115605	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	12157-12183	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	75629-75655	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	6851-6877	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	47725-47751	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	5683-5709	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135261	Enterococcus faecium isolate E4457 plasmid 4	37696-37722	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	75811-75837	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135477	Enterococcus faecium isolate E8423 plasmid 3	6959-6985	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	48704-48730	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	86388-86414	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	97412-97438	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	42202-42228	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	8507-8533	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	92662-92688	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	47623-47649	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	29112-29138	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	35530-35556	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	44725-44751	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	11096-11122	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	43131-43157	1	0.963
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	164278-164304	1	0.963
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	136964-136990	2	0.926
NZ_CP040238_1	1.1\|20506\|27\|NZ_CP040238\|CRISPRCasFinder	20506-20532	27	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	124050-124076	2	0.926
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	352516-352545	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	215527-215556	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	6851-6880	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	5683-5712	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135261	Enterococcus faecium isolate E4457 plasmid 4	37696-37725	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	75811-75840	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	48704-48733	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	42202-42231	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	6151-6180	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	102245-102274	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	6151-6180	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	4743-4772	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	4744-4773	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	4744-4773	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135238	Enterococcus faecium isolate E7067 plasmid 4	4725-4754	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135205	Enterococcus faecium isolate E7171 plasmid 3	30099-30128	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	6151-6180	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	6151-6180	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	7707-7736	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	10383-10412	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	6151-6180	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	23844-23873	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	10087-10116	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	6150-6179	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	6150-6179	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	6150-6179	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	6151-6180	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	4724-4753	2	0.933
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	37702-37731	2	0.933
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	10090-10116	2	0.926
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_LR135205	Enterococcus faecium isolate E7171 plasmid 3	30102-30128	2	0.926
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	181275-181301	2	0.926
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP016165	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence	50322-50348	2	0.926
NZ_CP040238_1	1.7\|20569\|27\|NZ_CP040238\|PILER-CR	20569-20595	27	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	357-383	2	0.926
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NZ_CP042836	Enterococcus sp. DA9 plasmid unnamed1	34203-34229	2	0.926
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	357-386	3	0.9
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	181272-181301	3	0.9
NZ_CP040238_1	1.2\|20569\|30\|NZ_CP040238\|CRISPRCasFinder	20569-20598	30	NZ_CP016165	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence	50319-50348	3	0.9
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	CP006767	Lactococcus lactis subsp. lactis KLDS 4.0325 plasmid unnamed1, complete sequence	2214-2240	3	0.889
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	CP006767	Lactococcus lactis subsp. lactis KLDS 4.0325 plasmid unnamed1, complete sequence	2214-2243	4	0.867
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	NC_030925	Bacillus phage Shbh1, complete genome	73737-73763	6	0.778
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	6140-6182	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	4713-4755	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	4808-4850	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	4713-4755	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	55975-56017	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	4808-4850	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	98743-98785	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	52170-52212	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	60987-61029	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	71697-71739	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	183267-183309	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	39520-39562	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	90508-90550	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	4808-4850	7	0.837
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	43270-43312	7	0.837
NZ_CP040238_1	1.8\|20635\|27\|NZ_CP040238\|PILER-CR	20635-20661	27	MH552526	Siphoviridae sp. isolate ctfj46, complete genome	55150-55176	7	0.741
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	LC557520	Staphylococcus phage vB_SsapH-Golestan101-M DNA, complete genome	92108-92137	8	0.733
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	NC_030925	Bacillus phage Shbh1, complete genome	73734-73763	8	0.733
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP011283	Enterococcus faecium strain E39 plasmid p2, complete sequence	6423-6465	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	6743-6785	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	4713-4755	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	15119-15161	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	46724-46766	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	104416-104458	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	4825-4867	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	8482-8524	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	8365-8407	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	90076-90118	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	287699-287741	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	115577-115619	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	4825-4867	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135289	Enterococcus faecium isolate E7199 plasmid 3	12883-12925	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	4357-4399	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	12155-12197	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	75627-75669	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	157881-157923	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	4436-4478	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	62581-62623	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	47723-47765	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	6248-6290	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	4436-4478	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	8481-8523	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	7103-7145	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	59562-59604	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	6694-6736	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	6743-6785	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	4357-4399	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	5423-5465	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	6140-6182	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135477	Enterococcus faecium isolate E8423 plasmid 3	6957-6999	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	4436-4478	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135207	Enterococcus faecium isolate E7171 plasmid 5	4713-4755	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	5481-5523	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	4713-4755	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	8763-8805	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	86386-86428	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	97410-97452	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	4825-4867	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	6327-6369	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	6409-6451	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	8505-8547	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	4357-4399	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	92660-92702	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	4357-4399	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	47621-47663	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	206621-206663	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	6140-6182	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	8481-8523	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	8481-8523	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	45010-45052	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	7860-7902	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	7696-7738	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	6716-6758	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	29937-29979	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	29937-29979	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	29110-29152	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	5481-5523	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	35528-35570	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	6248-6290	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	5423-5465	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	4824-4866	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	118197-118239	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	44723-44765	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135309	Enterococcus faecium isolate E7240 plasmid 3	40214-40256	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	4825-4867	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	1634-1676	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	29937-29979	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	4714-4756	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	11094-11136	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	29937-29979	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	65557-65599	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	9097-9139	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	15119-15161	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	43129-43171	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	29937-29979	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	29937-29979	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	164276-164318	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	6698-6740	8	0.814
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	20771-20813	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	352514-352556	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	215525-215567	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	6140-6182	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	102234-102276	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	6140-6182	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	4732-4774	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	4733-4775	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	4733-4775	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	6849-6891	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	5681-5723	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135238	Enterococcus faecium isolate E7067 plasmid 4	4714-4756	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135261	Enterococcus faecium isolate E4457 plasmid 4	37694-37736	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	75809-75851	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	48702-48744	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	6140-6182	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	6140-6182	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	7696-7738	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	10372-10414	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	42200-42242	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	6140-6182	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	23833-23875	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	10076-10118	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	6139-6181	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	6139-6181	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	6139-6181	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	6140-6182	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	4713-4755	9	0.791
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	37691-37733	9	0.791
NZ_CP040238_1	1.3\|20635\|30\|NZ_CP040238\|CRISPRCasFinder	20635-20664	30	MH552526	Siphoviridae sp. isolate ctfj46, complete genome	55147-55176	10	0.667
NZ_CP040238_1	1.5\|20567\|43\|NZ_CP040238\|CRT	20567-20609	43	NZ_LR135205	Enterococcus faecium isolate E7171 plasmid 3	30088-30130	10	0.767

1. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

2. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

3. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

4. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

5. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP038997 (Enterococcus faecium strain SRR24 plasmid pSRR24) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

6. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

7. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

8. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

9. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

10. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP019994 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

11. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

12. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

13. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

14. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

15. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaca	Protospacer
***************************

16. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

17. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

18. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

19. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

20. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

21. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

22. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

23. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

24. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

25. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

26. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

27. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

28. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

29. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

30. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

31. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

32. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

33. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

34. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

35. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

36. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

37. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

38. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

39. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

40. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

41. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

42. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

43. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

44. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcaattaatttaaagtactc	Protospacer
******************************

45. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135300 (Enterococcus faecium isolate E7429 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

46. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135491 (Enterococcus faecium isolate E8414 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

47. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135366 (Enterococcus faecium isolate E8195 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

48. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135403 (Enterococcus faecium isolate E8377 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

49. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135396 (Enterococcus faecium isolate E8290 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

50. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135387 (Enterococcus faecium isolate E7933 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

51. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP044276 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

52. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP042836 (Enterococcus sp. DA9 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

53. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP042837 (Enterococcus sp. DA9 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

54. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP020486 (Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

55. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027519 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

56. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135342 (Enterococcus faecium isolate E7356 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

57. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135295 (Enterococcus faecium isolate E7237 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

58. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NC_010880 (Enterococcus faecium plasmid pEF1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

59. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135346 (Enterococcus faecium isolate E8202 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

60. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135353 (Enterococcus faecium isolate E8014 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

61. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR134110 (Enterococcus faecium isolate E6043 plasmid 6) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

62. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

63. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

64. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018067 (Enterococcus faecium strain E1 plasmid pE1_29, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

65. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaacaca	CRISPR spacer
tcttattataacataaatgaaacaaacaca	Protospacer
******************************

66. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

67. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

68. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

69. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

70. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP038997 (Enterococcus faecium strain SRR24 plasmid pSRR24) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

71. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

72. spacer 1.4|20504|40|NZ_CP040238|CRT matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

73. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

74. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

75. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP019994 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

76. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

77. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

78. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

79. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

80. spacer 1.4|20504|40|NZ_CP040238|CRT matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

tttttttaacttgacaatcattttaaacaatttgagaact	CRISPR spacer
tttttttaacttgacaatcattttaaacaatttgagaact	Protospacer
****************************************

81. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

82. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

83. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

84. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

85. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

86. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

87. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

88. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

89. spacer 1.5|20567|43|NZ_CP040238|CRT matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

90. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

91. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

92. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

93. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

94. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
gcaggaacgccatcaattaatttaaagtactcatttgagaaac	Protospacer
*******************************************

95. spacer 1.6|20633|43|NZ_CP040238|CRT matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

actcttattataacataaatgaaacaaacacaatttgagaaac	CRISPR spacer
actcttattataacataaatgaaacaaacacaatttgagaaac	Protospacer
*******************************************

96. spacer 1.6|20633|43|NZ_CP040238|CRT matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

actcttattataacataaatgaaacaaacacaatttgagaaac	CRISPR spacer
actcttattataacataaatgaaacaaacacaatttgagaaac	Protospacer
*******************************************

97. spacer 1.6|20633|43|NZ_CP040238|CRT matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

actcttattataacataaatgaaacaaacacaatttgagaaac	CRISPR spacer
actcttattataacataaatgaaacaaacacaatttgagaaac	Protospacer
*******************************************

98. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

99. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

100. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

101. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

102. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

103. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

104. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

105. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

106. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

107. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

108. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

109. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

110. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

111. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

112. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

113. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

114. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

115. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

116. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

117. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

118. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

119. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

120. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

121. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

122. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

123. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

124. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

125. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

126. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcaattaatttaaagta	Protospacer
***************************

127. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP020486 (Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

128. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP027519 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

129. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135300 (Enterococcus faecium isolate E7429 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

130. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135342 (Enterococcus faecium isolate E7356 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

131. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135295 (Enterococcus faecium isolate E7237 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

132. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NC_010880 (Enterococcus faecium plasmid pEF1, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

133. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135491 (Enterococcus faecium isolate E8414 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

134. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135366 (Enterococcus faecium isolate E8195 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

135. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135403 (Enterococcus faecium isolate E8377 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

136. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135396 (Enterococcus faecium isolate E8290 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

137. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135346 (Enterococcus faecium isolate E8202 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

138. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135353 (Enterococcus faecium isolate E8014 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

139. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR135387 (Enterococcus faecium isolate E7933 plasmid 4) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

140. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LR134110 (Enterococcus faecium isolate E6043 plasmid 6) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

141. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

142. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP044276 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

143. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP042836 (Enterococcus sp. DA9 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

144. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP042837 (Enterococcus sp. DA9 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

145. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

146. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP018067 (Enterococcus faecium strain E1 plasmid pE1_29, complete sequence) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

147. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaac	Protospacer
***************************

148. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

149. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

150. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

151. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

152. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

153. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

154. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

155. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

156. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135477 (Enterococcus faecium isolate E8423 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

157. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

158. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

159. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

160. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

161. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

162. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

163. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

164. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

165. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

166. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

167. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

168. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP011283 (Enterococcus faecium strain E39 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

169. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

170. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

171. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

172. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

173. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

174. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

175. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

176. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

177. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

178. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

179. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

180. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135289 (Enterococcus faecium isolate E7199 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

181. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

182. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

183. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

184. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

185. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

186. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

187. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

188. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

189. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

190. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

191. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

192. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

193. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

194. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

195. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

196. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

197. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

198. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

199. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135207 (Enterococcus faecium isolate E7171 plasmid 5) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

200. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

201. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

202. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

203. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

204. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

205. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

206. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

207. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

208. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

209. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

210. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

211. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

212. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

213. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

214. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

215. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

216. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

217. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

218. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

219. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

220. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

221. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

222. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

223. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

224. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

225. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

226. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

227. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

228. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

229. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

230. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

231. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135309 (Enterococcus faecium isolate E7240 plasmid 3) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

232. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

233. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

234. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

235. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

236. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

237. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

238. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

239. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

240. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

241. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

242. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

243. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 1, identity: 0.967

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtactc	Protospacer
************.*****************

244. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP042836 (Enterococcus sp. DA9 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

tcttattataacataaatgaaacaaacaca-	CRISPR spacer
tcttattataacataaatgaaac-aacacat	Protospacer
*********************** ******

245. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP011283 (Enterococcus faecium strain E39 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

246. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

247. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

248. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

249. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

250. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

251. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

252. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

253. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

254. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

255. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

256. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

257. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

258. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

259. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

260. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

261. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

262. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135289 (Enterococcus faecium isolate E7199 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

263. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

264. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

265. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

266. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

267. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

268. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

269. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

270. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

271. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

272. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135238 (Enterococcus faecium isolate E7067 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

273. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

274. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

275. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

276. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

277. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

278. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

279. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

280. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

281. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

282. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

283. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135207 (Enterococcus faecium isolate E7171 plasmid 5) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

284. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

285. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

286. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

287. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

288. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

289. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

290. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

291. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

292. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

293. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

294. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

295. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

296. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

297. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

298. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

299. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

300. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

301. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

302. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

303. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

304. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

305. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

306. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

307. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

308. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

309. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

310. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

311. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

312. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

313. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

314. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

315. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

316. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

317. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

318. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

319. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

320. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

321. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

322. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

323. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

324. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

325. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

326. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135309 (Enterococcus faecium isolate E7240 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

327. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

328. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

329. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

330. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

331. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

332. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

333. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

334. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

335. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

336. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

337. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

338. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

339. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

340. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

341. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

342. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

343. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

344. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

345. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

346. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

347. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

348. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

349. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

350. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

351. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

352. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135261 (Enterococcus faecium isolate E4457 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

353. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

354. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135477 (Enterococcus faecium isolate E8423 plasmid 3) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

355. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

356. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

357. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

358. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

359. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

360. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

361. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

362. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

363. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

364. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

365. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

366. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

367. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 1, identity: 0.963

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagta	Protospacer
************.**************

368. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.926

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaac	Protospacer
*************************

369. spacer 1.1|20506|27|NZ_CP040238|CRISPRCasFinder matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 2, identity: 0.926

tttttaacttgacaatcattttaaaca	CRISPR spacer
tttttaacttgacaatcattttaaaac	Protospacer
*************************

370. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

371. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

372. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

373. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

374. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135261 (Enterococcus faecium isolate E4457 plasmid 4) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

375. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

376. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

377. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

378. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

379. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

380. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

381. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

382. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

383. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

384. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135238 (Enterococcus faecium isolate E7067 plasmid 4) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

385. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135205 (Enterococcus faecium isolate E7171 plasmid 3) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacaccattaattaatttaaagtactc	Protospacer
******.****.******************

386. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

387. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

388. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

389. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

390. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

391. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

392. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtgctc	Protospacer
************.*************.***

393. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

394. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

395. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

396. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

397. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

398. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 2, identity: 0.933

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatttaaagtaccc	Protospacer
************.***************.*

399. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 2, identity: 0.926

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatttaaagtg	Protospacer
************.*************.

400. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_LR135205 (Enterococcus faecium isolate E7171 plasmid 3) position: , mismatch: 2, identity: 0.926

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacaccattaattaatttaaagta	Protospacer
******.****.***************

401. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 2, identity: 0.926

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatctaaagta	Protospacer
************.******.*******

402. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP016165 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence) position: , mismatch: 2, identity: 0.926

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatctaaagta	Protospacer
************.******.*******

403. spacer 1.7|20569|27|NZ_CP040238|PILER-CR matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 2, identity: 0.926

aggaacgccatcaattaatttaaagta	CRISPR spacer
aggaacgccatcgattaatctaaagta	Protospacer
************.******.*******

404. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NZ_CP042836 (Enterococcus sp. DA9 plasmid unnamed1) position: , mismatch: 2, identity: 0.926

tcttattataacataaatgaaacaaac	CRISPR spacer
tcttattataacataaatgaaacaaca	Protospacer
*************************

405. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 3, identity: 0.9

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatctaaagtaccc	Protospacer
************.******.********.*

406. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 3, identity: 0.9

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatctaaagtaccc	Protospacer
************.******.********.*

407. spacer 1.2|20569|30|NZ_CP040238|CRISPRCasFinder matches to NZ_CP016165 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence) position: , mismatch: 3, identity: 0.9

aggaacgccatcaattaatttaaagtactc	CRISPR spacer
aggaacgccatcgattaatctaaagtaccc	Protospacer
************.******.********.*

408. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to CP006767 (Lactococcus lactis subsp. lactis KLDS 4.0325 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

tcttattataacataaatgaaacaaac	CRISPR spacer
ttttattataacataaatgacaaaaac	Protospacer
*.****************** * ****

409. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to CP006767 (Lactococcus lactis subsp. lactis KLDS 4.0325 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

tcttattataacataaatgaaacaaacaca	CRISPR spacer
ttttattataacataaatgacaaaaacaaa	Protospacer
*.****************** * ***** *

410. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to NC_030925 (Bacillus phage Shbh1, complete genome) position: , mismatch: 6, identity: 0.778

tcttattataacataaatgaaacaaac	CRISPR spacer
caggattgtaacataaatgaaacaacc	Protospacer
.   ***.***************** *

411. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

412. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcaggtacgataa	Protospacer
 ********************************  *. ** *

413. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

414. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcaggtacgataa	Protospacer
 ********************************  *. ** *

415. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

416. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

417. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

418. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

419. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

420. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

421. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

422. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

423. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

424. spacer 1.5|20567|43|NZ_CP040238|CRT matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

425. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 7, identity: 0.837

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcaattaatttaaagtactcagatacgataa	Protospacer
 ********************************  *. ** *

426. spacer 1.8|20635|27|NZ_CP040238|PILER-CR matches to MH552526 (Siphoviridae sp. isolate ctfj46, complete genome) position: , mismatch: 7, identity: 0.741

tcttattataacataaatgaaacaaac	CRISPR spacer
atatattataacataaattaaacattt	Protospacer
 . *************** *****  .

427. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to LC557520 (Staphylococcus phage vB_SsapH-Golestan101-M DNA, complete genome) position: , mismatch: 8, identity: 0.733

tcttattataacataaatgaaacaaacaca	CRISPR spacer
taaggagatgacataaatgaaacaaacaaa	Protospacer
*   .  **.****************** *

428. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to NC_030925 (Bacillus phage Shbh1, complete genome) position: , mismatch: 8, identity: 0.733

tcttattataacataaatgaaacaaacaca	CRISPR spacer
caggattgtaacataaatgaaacaacccta	Protospacer
.   ***.***************** * .*

429. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP011283 (Enterococcus faecium strain E39 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

430. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

431. spacer 1.5|20567|43|NZ_CP040238|CRT matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

432. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

433. spacer 1.5|20567|43|NZ_CP040238|CRT matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

434. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

435. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

436. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

437. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

438. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

439. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

440. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

441. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

442. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

443. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

444. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

445. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135289 (Enterococcus faecium isolate E7199 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

446. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

447. spacer 1.5|20567|43|NZ_CP040238|CRT matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

448. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

449. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

450. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

451. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

452. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

453. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

454. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

455. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

456. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

457. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

458. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

459. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

460. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

461. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

462. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

463. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

464. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

465. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

466. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135477 (Enterococcus faecium isolate E8423 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

467. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

468. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135207 (Enterococcus faecium isolate E7171 plasmid 5) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

469. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

470. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

471. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

472. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

473. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

474. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

475. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

476. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

477. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

478. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

479. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

480. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

481. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

482. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

483. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

484. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

485. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

486. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

487. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

488. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

489. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

490. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

491. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

492. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

493. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

494. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

495. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

496. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

497. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

498. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

499. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

500. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

501. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

502. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

503. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

504. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

505. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

506. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

507. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

508. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135309 (Enterococcus faecium isolate E7240 plasmid 3) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

509. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

510. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

511. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

512. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

513. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

514. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

515. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

516. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

517. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

518. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

519. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

520. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

521. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

522. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

523. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 8, identity: 0.814

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggtacgataa	Protospacer
 *************.******************  *. ** *

524. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtactcaggcacgataa	Protospacer
 *************.******************  .. ** *

525. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

526. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

527. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

528. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

529. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

530. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

531. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

532. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

533. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

534. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

535. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135238 (Enterococcus faecium isolate E7067 plasmid 4) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

536. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135261 (Enterococcus faecium isolate E4457 plasmid 4) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

537. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

538. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

539. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

540. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

541. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

542. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

543. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

544. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

545. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

546. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtgctcaggtacgataa	Protospacer
 *************.*************.****  *. ** *

547. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

548. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

549. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

550. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

551. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

552. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 9, identity: 0.791

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacgccatcgattaatttaaagtacccaggtacgataa	Protospacer
 *************.***************.**  *. ** *

553. spacer 1.3|20635|30|NZ_CP040238|CRISPRCasFinder matches to MH552526 (Siphoviridae sp. isolate ctfj46, complete genome) position: , mismatch: 10, identity: 0.667

tcttattataacataaatgaaacaaacaca	CRISPR spacer
atatattataacataaattaaacatttttt	Protospacer
 . *************** *****  . .

554. spacer 1.5|20567|43|NZ_CP040238|CRT matches to NZ_LR135205 (Enterococcus faecium isolate E7171 plasmid 3) position: , mismatch: 10, identity: 0.767

gcaggaacgccatcaattaatttaaagtactcatttgagaaac	CRISPR spacer
tcaggaacaccattaattaatttaaagtactcaggtacaataa	Protospacer
 *******.****.*******************  *. .* *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10601 : 52813

Streptococcus_phage(55.56%)

transposase,protease,integrase

attL 1620:1635|attR 19955:19970

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1620:1635	attL	NA	NA	NA	NA
WP_000361059.1\|10601_10979_-\|transposase	transposase	NA	NA	NA	NA
WP_001557544.1\|10985_12878_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_000868132.1\|12874_13960_-\|integrase	tyrosine-type recombinase/integrase	A0A2I7SCV1	Paenibacillus_phage	4.0e-13	33.9
WP_016922209.1\|14078_14720_-	DNA repair protein RadC	NA	NA	NA	NA
WP_002320756.1\|15543_16104_-	SLATT domain-containing protein	NA	NA	NA	NA
WP_002347527.1\|16123_16945_-	nucleotidyltransferase	NA	NA	NA	NA
WP_106914365.1\|17098_18277_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-29	25.3
WP_002320829.1\|18449_18632_-	hypothetical protein	NA	NA	NA	NA
WP_002320828.1\|18628_18976_-	hypothetical protein	NA	NA	NA	NA
WP_010733708.1\|18968_20294_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	3.8e-98	44.2
19955:19970	attR	NA	NA	NA	NA
WP_002352923.1\|20810_22037_-	hypothetical protein	NA	NA	NA	NA
WP_002321352.1\|22008_23643_-	hypothetical protein	NA	NA	NA	NA
WP_125308478.1\|23662_24556_-	hypothetical protein	NA	NA	NA	NA
WP_002321530.1\|24810_25131_-	hypothetical protein	NA	NA	NA	NA
WP_060763495.1\|25163_26282_-	hypothetical protein	F0PIJ1	Enterococcus_phage	5.3e-85	48.8
WP_125308480.1\|26310_27105_-	hypothetical protein	F0PIJ0	Enterococcus_phage	3.2e-23	33.7
WP_125308483.1\|27181_27370_-	hypothetical protein	NA	NA	NA	NA
WP_125308486.1\|28480_28738_-	hypothetical protein	NA	NA	NA	NA
WP_125308489.1\|28740_28971_-	hypothetical protein	NA	NA	NA	NA
WP_125308493.1\|29142_30186_-	glycosyhydrolase	NA	NA	NA	NA
WP_125308496.1\|30364_30619_-	hypothetical protein	NA	NA	NA	NA
WP_002320843.1\|30809_31025_-	hypothetical protein	NA	NA	NA	NA
WP_125308499.1\|31076_31991_-	hypothetical protein	NA	NA	NA	NA
WP_002320845.1\|31990_32890_-	RusA family crossover junction endodeoxyribonuclease	NA	NA	NA	NA
WP_002320846.1\|32889_33477_-	hypothetical protein	NA	NA	NA	NA
WP_002320847.1\|33640_33832_-	hypothetical protein	NA	NA	NA	NA
WP_002347462.1\|33904_34807_-	hypothetical protein	NA	NA	NA	NA
WP_002350127.1\|34823_35300_-	hypothetical protein	NA	NA	NA	NA
WP_125308502.1\|35315_35915_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_125308504.1\|36473_36953_-	hypothetical protein	NA	NA	NA	NA
WP_125308507.1\|36971_37601_-	hypothetical protein	NA	NA	NA	NA
WP_002353144.1\|37597_38974_-	cell division protein FtsK	G1FGP1	Mycobacterium_phage	1.7e-48	42.5
WP_002354485.1\|39327_40014_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001096887.1\|40374_41169_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_000627290.1\|41261_41804_-	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001255866.1\|41800_42709_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|42741_43476_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000228166.1\|43456_44326_-	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000567888.1\|44428_44674_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_000085862.1\|45831_45963_-	hypothetical protein	E4ZFP9	Streptococcus_phage	7.9e-17	100.0
WP_001038792.1\|45967_46705_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_001814874.1\|46829_46913_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_002368882.1\|46933_47203_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	7.6e-22	81.5
WP_000343406.1\|47892_50880_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.3e-206	38.3
WP_002321606.1\|51004_51610_+	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-19	33.2
WP_000824191.1\|51654_51822_-	hypothetical protein	NA	NA	NA	NA
WP_000366408.1\|51855_52155_-	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|52195_52813_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1

DBSCAN-SWA_2

57133 : 86257

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|57133_57820_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000222573.1\|59073_60033_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-32	36.1
WP_000053907.1\|60056_60353_-	replication control protein PrgN	NA	NA	NA	NA
WP_000947691.1\|60487_61981_-	replication protein RepR	NA	NA	NA	NA
WP_000429439.1\|62592_63546_+	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1
WP_001196543.1\|63517_63793_+	hypothetical protein	NA	NA	NA	NA
WP_000199136.1\|63985_64240_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_077828739.1\|64221_64605_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-12	45.5
WP_086956687.1\|64645_65807_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_073120187.1\|65908_66481_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_002360715.1\|66377_66617_-	hypothetical protein	NA	NA	NA	NA
WP_000170424.1\|66953_67526_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_000599739.1\|67541_68147_-	cell filamentation protein	NA	NA	NA	NA
WP_002354485.1\|68344_69031_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002405437.1\|69703_71644_+	tetracycline resistance ribosomal protection protein Tet(S)	A0A2K5B2A5	Erysipelothrix_phage	6.0e-294	78.7
WP_005228365.1\|71731_71899_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	8.1e-14	64.0
WP_029756604.1\|72412_72769_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	3.4e-25	60.9
WP_000343406.1\|73419_76407_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.3e-206	38.3
WP_000516404.1\|76720_77206_-	glycopeptide resistance protein VanZ-A	NA	NA	NA	NA
WP_105467056.1\|77358_78270_-	VanY-A/VanY-F/VanY-M family D-Ala-D-Ala carboxypeptidase	NA	NA	NA	NA
WP_000402347.1\|78697_79306_-	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
WP_001079845.1\|79311_80343_-	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
WP_001059542.1\|80335_81304_-	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_002305818.1\|81518_82673_-	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_001280781.1\|82650_83346_-	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_001226076.1\|83559_84135_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	9.0e-20	34.8
WP_002354485.1\|85570_86257_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040236

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP040237

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP040238

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection