CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP029468	Bacillus cereus strain FORC_086 chromosome, complete genome	4 crisprs	cas3,csa3,WYL,c2c9_V-U4,DinG,DEDDh,c2c10_CAS-V-U3	0	31	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP029468_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029468_1

3626571-3629005

Orphan

Consensus_repeat	Method
ACNGGCGCTACTGGNNCTNNNGG	CRT
AGGTAACACNGGNGCTAC	CRT

61 spacers

The CRISPR arrays of NZ_CP029468_1

>merge|NZ_CP029468|1|3626571-3629005|CRT,CRT
CAAGGACCTACCGGACCTACTGGACCAGCAGGCGCTACTGGTGCTACCGGACCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAACATGGGCGCTACTGGACCTACCGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCCCGAGGTAACACAGGCGCTACTGGACCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGGCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCGAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTAACACAGGTGCCACTGGCGCTACTGGTATAGGAGTTACCGGACCTACTGGACCTTCTGGCGGGCCTCCTGGACCTACTGGACCTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACCGGACCTCAAGGCGTTCAAGGTAACACAGGTGCCACTGGTGCCACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGTGCTCAAGGGCCTGCTGGTGCTACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGTGCTCAAGGGCCTGCTGGTGCTACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACCGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCTACCGGTGCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTGCTACCGGTGCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGCGCTACCGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACTGGCGCTACTGGTGCTACCGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACTGGCGCTACCGGTGCCACTGGACCTCAAGGCATTCAAGGACCAACGGGTGCTACCGGCGCTACTGG

>NZ_CP029468|1|2|3626571-3629005|CRT
CAAGGACCTACCGGACCTACTGG	ACCAGCAGGCGCTACTGGTGCTACCGGACCTCGAGGTAAC
ACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCTCG
	TGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGGCCTCG
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCTCG
	TGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGGCCTCG
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGACCTCA
	TGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGGCCTCG
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCTCG
	TGCCACTGGGCCTCGAGGTAACATGGGCGCTACTGGACCTACCGGTGCCACTGGACCTCAAGGTAAC
	TGGACCTACCGGTGCCACTGGACCTCA
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCCCG
	TGCCACTGGGCCCCGAGGTAACACAGGCGCTACTGGACCTACCGGTGCCACTGGACCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	TGGCGCCACTGGACCTCA
	ACCTCAAGGTAACACGGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
	TGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGGCCTCG
	GCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAAC
	TGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGACCTCG
	ACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
	TGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGACCTCG
	ACCTCGAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTAAC
	CGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGACCTCAGGGTGTTCA
	ACCTCAGGGTGTTCAAGGTAACACAGGTGCT
AC	CGGCGCTACTGGTGCTACTGGACCTCA
	ACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCT
	TGGTGCCACTGGACCTCAGGGTGTTCA
AGGTAACACAGGTGCTAC	CGGCGCTACTGGTGCTACTGGACCTCA
	ACCTCAAGGTAACACAGGTGCCACTGGCGCTACTGGTATAGGAGTT
ACCGGACCTACTGGACCTTCTGG	CGGGCCTCCTGGACCTACTGGACCTCAAGGTAACACAGGCGCT
ACTGGTGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCT
ACTGGTGCCACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCT
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCT
ACTGGTGCCACTGGACCTCAAGG	CGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACCGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCCACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGCTCAAGGGCCTGCTGGTGCT
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGCTCAAGGGCCTGCTGGTGCT
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGCGCTACTGG	ACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACCGGTGCTACTGG	ACCTCAAGGTGTTCAAGGTAACACAGGTGCT
ACTGGTGCTACCGGTGCCACTGG	ACCTCAAGGCGTTCAAGGTAACACAGGTGCT
ACTGGTGCTACCGGTGCCACTGG	ACCTCAAGGCGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACCGGTGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACTGGCGCTACTGGTGCTACCGG	TGCCACTGGACCTCAGGGTGTTCAAGGTAAC
ACTGGCGCTACCGGTGCCACTGG	ACCTCAAGGCATTCAAGGACCA
ACGGGTGCTACCGGCGCTACTGG

>NZ_CP029468|1|1|3626627-3627589|CRT
	ACCAGCAGGCGCTACTGGTGCTACCGGACCTCGAGGTAAC
ACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCTCG
	TGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGGCCTCG
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCTCG
	TGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGGCCTCG
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGACCTCA
	TGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGACCTACCGGTGCCACTGGGCCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGGCCTCG
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCTCG
	TGCCACTGGGCCTCGAGGTAACATGGGCGCTACTGGACCTACCGGTGCCACTGGACCTCAAGGTAAC
	TGGACCTACCGGTGCCACTGGACCTCA
AGGTAACACGGGCGCTAC	TGGACCTACCGGTGCCACTGGGCCCCG
	TGCCACTGGGCCCCGAGGTAACACAGGCGCTACTGGACCTACCGGTGCCACTGGACCTCGAGGTAAC
	TGGACCTACCGGTGCCACTGGACCTCG
AGGTAACACGGGCGCTAC	TGGCGCCACTGGACCTCA
	ACCTCAAGGTAACACGGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
	TGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGGCCTCG
	GCCTCGAGGTAACACGGGTGCTACTGGCGCTACTGGACCTCAAGGTAAC
	TGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGACCTCG
	ACCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGACCTCAAGGTAAC
	TGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGACCTCG
	ACCTCGAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGTAAC
	CGGCGCTACTGGACCTCA
AGGTAACACAGGTGCTAC	TGGTGCCACTGGACCTCAGGGTGTTCA
	ACCTCAGGGTGTTCAAGGTAACACAGGTGCT
AC	CGGCGCTACTGGTGCTACTGGACCTCA
	ACCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCT
	TGGTGCCACTGGACCTCAGGGTGTTCA
AGGTAACACAGGTGCTAC	CGGCGCTACTGGTGCTACTGGACCTCA
	ACCTCAAGGTAACACAGGTGCCACTGGCGCTACTGGTATAGGAGTT
ACCGGACCTACTGGACCTTCTGG	CGGGCCTCCTGGACCTACTGGACCTCAAGGTAACACAGGCGCT
ACTGGTGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCT
ACTGGTGCCACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGCGCT
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCT
ACTGGTGCCACTGGACCTCAAGG	CGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACCGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCCACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGCTCAAGGGCCTGCTGGTGCT
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGCTCAAGGGCCTGCTGGTGCT
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGCGCTACTGG	ACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGGTGCC
ACTGGCGCTACTGGACCTCAAGG	TGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACCGGTGCTACTGG	ACCTCAAGGTGTTCAAGGTAACACAGGTGCT
ACTGGTGCTACCGGTGCCACTGG	ACCTCAAGGCGTTCAAGGTAACACAGGTGCT
ACTGGTGCTACCGGTGCCACTGG	ACCTCAAGGCGTTCAAGGTAACACAGGTGCT
ACTGGCGCTACCGGTGCTACTGG	ACCTCAAGGTGTTCAAGGTAAC
ACTGGCGCTACTGGTGCTACCGG	TGCCACTGGACCTCAGGGTGTTCAAGGTAAC
ACTGGCGCTACCGGTGCCACTGG	ACCTCAAGGCATTCAAGGACCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029468.1\|WP_000450326.1\|3625023_3625989_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP029468.1\|WP_002026213.1\|3638365_3638704_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_006922262.1\|3629794_3630748_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP029468.1\|WP_000813896.1\|3629548_3629773_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP029468.1\|WP_000814429.1\|3630928_3631174_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_000656783.1\|3619866_3620256_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP029468.1\|WP_000283430.1\|3617071_3617284_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_000228315.1\|3637504_3638047_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP029468.1\|WP_000391393.1\|3621694_3622969_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP029468.1\|WP_000092763.1\|3618483_3619818_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP029468.1\|WP_025708990.1\|3636223_3637387_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP029468.1\|WP_000438178.1\|3623953_3624910_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP029468.1\|WP_006922254.1\|3634405_3635317_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP029468.1\|WP_033695267.1\|3617487_3618147_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885
NZ_CP029468.1\|WP_016123256.1\|3635313_3636066_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP029468.1\|WP_000181500.1\|3623784_3623922_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_025708985.1\|3631236_3632187_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP029468.1\|WP_006922259.1\|3632535_3634392_-\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP029468.1\|WP_025710425.1\|3620430_3621702_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP029468.1\|WP_000312267.1\|3623061_3623685_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415

Protein	Function_ID	Function_description	E-value
NZ_CP029468.1\|WP_000450326.1\|3625023_3625989_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.53009e-12
NZ_CP029468.1\|WP_006922262.1\|3629794_3630748_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.02223e-164
NZ_CP029468.1\|WP_000813896.1\|3629548_3629773_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP029468.1\|WP_000656783.1\|3619866_3620256_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP029468.1\|WP_006922259.1\|3632535_3634392_-\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	6.42697e-143
NZ_CP029468.1\|WP_000228315.1\|3637504_3638047_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57
NZ_CP029468.1\|WP_025710425.1\|3620430_3621702_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP029468.1\|WP_000092763.1\|3618483_3619818_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP029468.1\|WP_000438178.1\|3623953_3624910_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.99085e-156
NZ_CP029468.1\|WP_006922254.1\|3634405_3635317_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.14238e-141
NZ_CP029468.1\|WP_033695267.1\|3617487_3618147_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	3.13251e-29
NZ_CP029468.1\|WP_025708990.1\|3636223_3637387_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP029468.1\|WP_016123256.1\|3635313_3636066_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.14879e-82
NZ_CP029468.1\|WP_025708985.1\|3631236_3632187_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.90081e-36
NZ_CP029468.1\|WP_000391393.1\|3621694_3622969_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP029468.1\|WP_000312267.1\|3623061_3623685_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60

>NZ_CP029468.1|WP_000450326.1|3625023_3625989_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDVEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDPLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NZ_CP029468.1|WP_000438178.1|3623953_3624910_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTIKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKNDLIGISSMDLMLEEETHST
>NZ_CP029468.1|WP_000181500.1|3623784_3623922_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMEHFHKAHQEKAKKE
>NZ_CP029468.1|WP_000312267.1|3623061_3623685_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NZ_CP029468.1|WP_000391393.1|3621694_3622969_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEESDVLRIKEAIEMKMKKEMDRYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NZ_CP029468.1|WP_025710425.1|3620430_3621702_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEGGLVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDELIEKNLLIIS
>NZ_CP029468.1|WP_000656783.1|3619866_3620256_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP029468.1|WP_000092763.1|3618483_3619818_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP029468.1|WP_033695267.1|3617487_3618147_+|helix-turn-helix-domain-containing-protein
MKKAEVVTRLIKEAGYSKRAFAEKIGLPPTTLQSMLSRGIGKASVDNVIKVCKGLGITTDDLEKLATQEDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPILAEENIEGYLPMLSTFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISKSGSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQAVKNY
>NZ_CP029468.1|WP_000283430.1|3617071_3617284_-|hypothetical-protein
MYPNLRAEMARKRIMITQISSHLKLRHATVSDKINGKFRFYYDEAFEIKKTFFPEHNLEYLFEFEENEAN
>NZ_CP029468.1|WP_000813896.1|3629548_3629773_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP029468.1|WP_006922262.1|3629794_3630748_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKAEMDGIPHYMIDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNARRVIRALEIFHMTGEKMSDQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRASLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQVKSNNSK
>NZ_CP029468.1|WP_000814429.1|3630928_3631174_+|hypothetical-protein
MKQSTINFSSLTKDLILATSTKEQNCSQEELYFALNCLLRAFHSTLHETTLHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NZ_CP029468.1|WP_025708985.1|3631236_3632187_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETVVTTDVLNVRENPNVESKLVGKVFSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPARTNTPVKNNTVVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>NZ_CP029468.1|WP_006922259.1|3632535_3634392_-|PTS-sugar-transporter-subunit-IIA
MKITELLKRDTVIMDLTASNKEAVIDELVEKLNGANRLNSKTEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEETEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTENLLKRAVKQDAPIFKGVKEDGKSESIEGEKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAVMLGVWKKKVQ
>NZ_CP029468.1|WP_006922254.1|3634405_3635317_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVSSFDLGTINRAEKDMKFPGGKGINVSRVLQRLGVKNIALGFTGGFTGQFIKEVLQTEGVTTNFVQVDEDTRINVKIKGEEETELNGQGPIVTKEQFEQLMKKIESMQPGDCVVLAGSVPVSIPSTFYESIAAFGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGVKHVIVSMAGEGALLFTAEGIYEATVPRGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NZ_CP029468.1|WP_016123256.1|3635313_3636066_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVIEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKQQTNVIEADKQ
>NZ_CP029468.1|WP_025708990.1|3636223_3637387_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFANEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTTSVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCEAVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEENVSRFKQFAIRVFNVETDGKTDREIALEGIQALRQFWTSIEAPVTLSDYAIGENEIDLMADKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP029468.1|WP_000228315.1|3637504_3638047_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP029468.1|WP_002026213.1|3638365_3638704_-|hypothetical-protein
MVKKEGGMMMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDVQREPLLNYANVNYEQFPFVVFFMIRFITAIVRKKESDDEECHSTCNIANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP029468_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029468_2

4803938-4804053

Orphan

Consensus_repeat	Method
TTAATTAAAAGCGGAAGCGGCTCGTTCAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP029468_2

>merge|NZ_CP029468|2|4803938-4804053|CRISPRCasFinder
TTAATTAAAAGCGGAAGCGGCTCGTTCAAAATGCCTCGGCGGAAGAAGCGAAGCCACCGAACATTTTAGCCGCTGGAGCTGGATATTAATCTAAAAGCGGAAGCGGCTCGTTCAAA

>NZ_CP029468|2|1|4803938-4804053|CRISPRCasFinder
TTAATTAAAAGCGGAAGCGGCTCGTTCAAA	ATGCCTCGGCGGAAGAAGCGAAGCCACCGAACATTTTAGCCGCTGGAGCTGGATAT
TAATCTAAAAGCGGAAGCGGCTCGTTCAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029468.1\|WP_000470316.1\|4796130_4796790_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP029468.1\|WP_000665103.1\|4805621_4806113_+\|phosphatidylglycerophosphatase-A	unknown	unknown	gnl\|CDD\|224186
NZ_CP029468.1\|WP_000683439.1\|4811657_4812239_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225158
NZ_CP029468.1\|WP_000049690.1\|4801562_4802231_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_000351151.1\|4806136_4806616_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP029468.1\|WP_000614215.1\|4804499_4805501_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131951
NZ_CP029468.1\|WP_000856301.1\|4807825_4809172_+\|phosphoribosyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379740
NZ_CP029468.1\|WP_114555937.1\|4798623_4799421_-\|DUF2628-domain-containing-protein	unknown	unknown	gnl\|CDD\|313994
NZ_CP029468.1\|WP_006918875.1\|4800107_4800746_+\|DUF4304-domain-containing-protein	unknown	unknown	gnl\|CDD\|379489
NZ_CP029468.1\|WP_025709845.1\|4810286_4811102_+\|HAD-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|319822
NZ_CP029468.1\|WP_000212737.1\|4797770_4798112_-\|alkylphosphonate-utilization-operon-protein-PhnA	unknown	unknown	gnl\|CDD\|225380
NZ_CP029468.1\|WP_001125507.1\|4804222_4804438_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_000248588.1\|4803200_4803509_-\|YuzD-family-protein	unknown	unknown	gnl\|CDD\|377812
NZ_CP029468.1\|WP_025709846.1\|4809177_4810290_+\|cysteine-protease-StiP-family-protein	unknown	unknown	gnl\|CDD\|378594
NZ_CP029468.1\|WP_025709848.1\|4796773_4797571_+\|iron-export-ABC-transporter-permease-subunit-FetB	unknown	unknown	gnl\|CDD\|377092
NZ_CP029468.1\|WP_025709847.1\|4806777_4807881_+\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	unknown	unknown	gnl\|CDD\|379744
NZ_CP029468.1\|WP_000007243.1\|4799720_4800071_-\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|199834
NZ_CP029468.1\|WP_000276467.1\|4812384_4813149_-\|TIGR01457-family-HAD-type-hydrolase	unknown	unknown	gnl\|CDD\|130524
NZ_CP029468.1\|WP_000483946.1\|4800748_4801552_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380193
NZ_CP029468.1\|WP_025709851.1\|4802354_4803149_-\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393

Protein	Function_ID	Function_description	E-value
NZ_CP029468.1\|WP_000470316.1\|4796130_4796790_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	3.63842e-51
NZ_CP029468.1\|WP_000683439.1\|4811657_4812239_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|225158	COG2249, MdaB, Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only].	5.86172e-62
NZ_CP029468.1\|WP_000614215.1\|4804499_4805501_-\|spore-coat-protein-CotS	gnl\|CDD\|131951	TIGR02905, conserved_hypothetical_protein, spore coat protein YutH. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria. [Cellular processes, Sporulation and germination].	6.68544e-109
NZ_CP029468.1\|WP_000856301.1\|4807825_4809172_+\|phosphoribosyltransferase-domain-containing-protein	gnl\|CDD\|379740	pfam15609, PRTase_2, Phosphoribosyl transferase. This PRTase family, and C-terminal TRSP domain, are related to OPRTases, and are predicted to use Orotate as substrate. These genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response.	3.62082e-93
NZ_CP029468.1\|WP_114555937.1\|4798623_4799421_-\|DUF2628-domain-containing-protein	gnl\|CDD\|313994	pfam10947, DUF2628, Protein of unknown function (DUF2628). Some members in this family of proteins are annotated as yigF however currently no function is known.	4.76724e-17
NZ_CP029468.1\|WP_006918875.1\|4800107_4800746_+\|DUF4304-domain-containing-protein	gnl\|CDD\|379489	pfam14137, DUF4304, Domain of unknown function (DUF4304). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 154 and 223 amino acids in length.	2.33109e-18
NZ_CP029468.1\|WP_025709845.1\|4810286_4811102_+\|HAD-hydrolase-family-protein	gnl\|CDD\|319822	cd07520, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The haloacid dehalogenase-like (HAD) hydrolases are a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members include 2-L-haloalkanoic acid dehalogenase (C-Cl bond hydrolysis), azetidine hydrolase (C-N bond hydrolysis); phosphonoacetaldehyde hydrolase (C-P bond hydrolysis), phosphoserine phosphatase and phosphomannomutase (CO-P bond hydrolysis), P-type ATPases (PO-P bond hydrolysis) and many others. Members are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.24459e-06
NZ_CP029468.1\|WP_000351151.1\|4806136_4806616_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	7.3108e-07
NZ_CP029468.1\|WP_000483946.1\|4800748_4801552_-\|hypothetical-protein	gnl\|CDD\|380193	NF033189, internalin_A, class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.	4.68556e-05
NZ_CP029468.1\|WP_000212737.1\|4797770_4798112_-\|alkylphosphonate-utilization-operon-protein-PhnA	gnl\|CDD\|225380	COG2824, PhnA, Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism].	1.28715e-64
NZ_CP029468.1\|WP_000248588.1\|4803200_4803509_-\|YuzD-family-protein	gnl\|CDD\|377812	pfam07315, DUF1462, Protein of unknown function (DUF1462). This family consists of several hypothetical bacterial proteins of around 100 residues in length. The function of this family is unknown.	2.0162e-51
NZ_CP029468.1\|WP_025709846.1\|4809177_4810290_+\|cysteine-protease-StiP-family-protein	gnl\|CDD\|378594	pfam11202, PRTase_1, Phosphoribosyl transferase (PRTase). This PRTase family is fused to a C-terminal RNA binding Pelota domain, pfam01248. These genes are found in the biosynthetic operon associated with the Ter stress response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response.	1.14904e-152
NZ_CP029468.1\|WP_025709848.1\|4796773_4797571_+\|iron-export-ABC-transporter-permease-subunit-FetB	gnl\|CDD\|377092	pfam03649, UPF0014, Uncharacterized protein family (UPF0014).	9.54338e-97
NZ_CP029468.1\|WP_025709847.1\|4806777_4807881_+\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	gnl\|CDD\|379744	pfam15617, C-C_Bond_Lyase, C-C_Bond_Lyase of the TIM-Barrel fold. This family of TIM-Barrel fold C-C bond lyase is related to citrate-lyase. These genes are found in the biosynthetic operon, with other enzymatic domains, associated with the Ter stress response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response.	0
NZ_CP029468.1\|WP_000007243.1\|4799720_4800071_-\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|199834	cd10276, BamB_YfgL, Beta-barrel assembly machinery (Bam) complex component B and related proteins. BamB (YflG) is a non-essential component of the beta-barrel assembly machinery (Bam), a multi-subunit complex that inserts proteins with beta-barrel topology into the outer membrane. BamB has been found to interact with BamA, which in turn binds and stabilizes pre-folded beta-barrel proteins; it has been suggested that BamB participates in the stabilization.	6.23528e-08
NZ_CP029468.1\|WP_000276467.1\|4812384_4813149_-\|TIGR01457-family-HAD-type-hydrolase	gnl\|CDD\|130524	TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily IIA hydrolase, TIGR01457. This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all gram positive (low-GC) bacteria. Sequences found in this model are annotated variously as related to NagD or 4-nitrophenyl phosphatase, and this hypothetical equivalog, of all of those within the Class IIA subfamily, is most closely related to the E. coli NagD enzyme and the PGP_euk equivalog (TIGR01452). However, there is presently no evidence that this hypothetical equivalog has the same function of either those. [Unknown function, Enzymes of unknown specificity].	2.41134e-134
NZ_CP029468.1\|WP_000665103.1\|4805621_4806113_+\|phosphatidylglycerophosphatase-A	gnl\|CDD\|224186	COG1267, PgpA, Phosphatidylglycerophosphatase A and related proteins [Lipid metabolism].	2.78337e-58
NZ_CP029468.1\|WP_025709851.1\|4802354_4803149_-\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	9.67348e-05

>NZ_CP029468.1|WP_000248588.1|4803200_4803509_-|YuzD-family-protein
MVNVQVYGTKVICASCVGMPSSTETFEWLQAAIGRKYEGQENKFNFEYIDFQEEQEDADKKAFAERVVEEDLFYPVVLVNGEIVGEGNPRLKDVYEEIEKYL
>NZ_CP029468.1|WP_025709851.1|4802354_4803149_-|nucleotidyltransferase-domain-containing-protein
MKNGVKHALPTEVQRLMERYTVELKEIFLDEKIVGVYIYGSIALGAFHKETSDVDFVTVINDSVNEAEKQQLVELHKKLSDNTLGKRMDGMYIPLADLGKYNDEMNEYVYCADGKANVGHWDINAVTWWTLKNQGITVTGKEAEDLPLQIQWNDVVNTMKYNVEQYWSEKAKKPYLFFIEEWVESAVVTMGRILYTLDHKTIVSKDRGLQYLSERSAEEWELLLKEVARIRHNPKETRMLSRWRRADMTKRYLLHLIETCREKW
>NZ_CP029468.1|WP_000049690.1|4801562_4802231_-|hypothetical-protein
MSKYKLHIDKEQLWKGCVLNSIAHAINVAHCPDFSHESSWDGFNYSMQDSQGGQGTITFHPNYTIVCLQDVNSERIDEWIDAKNYFEGAPSEVIDIAKEEALQYVLEEVEGETVPFITTAFWIEDSGAYSIDSFEEMEEHGGFLLEIPLLDTESAMERLEEEYELTEEQIELLQLVYEKKIQRPNEEIKLSKEEVAMIGTEDSEGLEVSKDSFEEMNITWEL
>NZ_CP029468.1|WP_000483946.1|4800748_4801552_-|hypothetical-protein
MFPIGDQPKIMKDLASIAGDLEEVAIEGKTKNIERLASLKVKKLWVFTVNQKQFDHILTYVCPDILYVYKMRVEDLSSLQKLSNLQQLYMCWNTKAKTLWDIDYNKKLKSLLIDDFSKLEDLSALSKCTQLNTFYMGGGINTAMKVQTLKPLAELQQLQKLTLMNLKVKDDSLEPLMQLKNLKELSLSNQFKVEEYAKLSVALPYTVCESFKPYVYMNDAIDGKNIMVTGRRRPVLNSKTDTVKMQKYEERFKKLQEEYKALVESTM
>NZ_CP029468.1|WP_006918875.1|4800107_4800746_+|DUF4304-domain-containing-protein
MTKNKPGSKKEQDFITNLHATLKPLGFKKKRHTFFKAENGFYKLINIQKSQFGDDFYINIGVHPIGLPQLITNQLQIKENISIFACILQTRIEPIHIKQNQLLHNVSHETINIPNYLSTIFDWFQTWASYENLVEINIHSITPVLAVVPILEEKAFLLLTCFSFYKLKQYEQANRYLQQYLHCTVHLNTEEKEPIFFHEVDMYMKKLVESTM
>NZ_CP029468.1|WP_000007243.1|4799720_4800071_-|PQQ-binding-like-beta-propeller-repeat-protein
MSFEIELPPFLIGEMMVLSLGEGRICGINIQTGKVLWNNTTLHDITEVLLYKDGEIYIATSNLELIILDAECGEVKDIIKLPKNVVVIDFIVSIEEGNNGLFISCVSGNMFEIVEG
>NZ_CP029468.1|WP_114555937.1|4798623_4799421_-|DUF2628-domain-containing-protein
MMYVKDTVLQETISPQELHKVVQKNTAYYDFKWGKVENPAQGNTWNWVAFFFPTFWLAYRKMYKLFIIFALLAIPSIVIPPFIDIPDGIYVTFSLALQLGMMIFTGWQGNRLYYKQAVRVFRKGEDASDHEKAYFLQSKGGVSIAGMIGLQIIVGIVYGLAAFGLSFLPTEPNIKNVVRSSGEGVTLEIMTDNPTWKFVKKEKDYDVVEFTGYDYTEKKNVKIKFAVYFDEDDFEWQEVYENNKKLSEEEVEEYQIYIEENNLGF
>NZ_CP029468.1|WP_000212737.1|4797770_4798112_-|alkylphosphonate-utilization-operon-protein-PhnA
MATLPNCPKCNSEYTYEDGVLFVCPECAHEWGQEAEAENNDGAKVVKDANGNVLQDGDAVTVIKDLKVKGTSSVVKIGTKVKSIRLVDGDHDIDCKIDGFGAMKLKSQFVKKA
>NZ_CP029468.1|WP_025709848.1|4796773_4797571_+|iron-export-ABC-transporter-permease-subunit-FetB
MKGVIELQIWQLAAAYIFILILIGLVKLKGIPREKQIALATFRMTIQLVLVAYVLTYVFENSNPFYTIALITSITTFAIFNIYKRVNIPMSKELKRIAALSMVAGSIGPLLLFIFVIIGHDPWYAPQYIVPITGMLVGNAMTGVSLGANTFLNNMKSQRGQIEGALMLGATPKEAAAPLIRDAFDSAILPTINSMVGMGIISLPGMMTGQILSGVSPFTAIQYQIAIILGISGSTAFAVIIFLQLGYKTFFNKRCQLKEIDYGAR
>NZ_CP029468.1|WP_000470316.1|4796130_4796790_+|ABC-transporter-ATP-binding-protein
MFILKNVIYKDILYIPYLQIQKEKITCIIGESGSGKSTLLRMLNDLQSPTSGTIEYNGKLISDYHPIQLRRDVVMLGQTPPIFDGTVKDNLLMGLRLSEKPFPNDDALRSALQTVSLDKQLENSASSLSGGEKQRLAFARIVLMDPPVYLLDEPTSALDSDTERRVMKQFTELARKKKKTIIFITHSQQLPEEIADDIIEISKANGATRKEVLSVEGRY
>NZ_CP029468.1|WP_001125507.1|4804222_4804438_+|hypothetical-protein
MPKMGNTFVTIQELEKKKEYLLGLSSVIPTWNTSYQFLFKEIQQELLGKVNEKLERHQFVLNICTDQQVGA
>NZ_CP029468.1|WP_000614215.1|4804499_4805501_-|spore-coat-protein-CotS
MIQHIYEHYHMHVKELIPLGPYKSFWIRNKIYVLVPIGEMEEEVLVEMKKLSDYMNQQGDITVATFVPTIHGYYVSEIEEQNYCLLKGMRALERHATSLGSELSIFHKRGAFFPEEIEQLSRIGEWKALWEKRLDQLEKFWQSQVMNHPTDVFDQLFIESFPYYLGVAENAIQYVVDTEMDDTPQLTDAATICQERFTPLLWHQTKRLKLPFDWVYDHPTRDIAEWIRYMMIEKKKDWDQTIVQFVTDYERNYSLSSFGWRLLFARLLFPLHYFETVERYYQTGNEEQKSIYRDRLEAILHDVNRSEQFMKHFYGSLRLPVDKLGIRKLDWLS
>NZ_CP029468.1|WP_000665103.1|4805621_4806113_+|phosphatidylglycerophosphatase-A
MKESNQLQERALQLLQERGVTIDDIAELVHFLQKKYHPNLEMSECRYNVERVLSKREVQNALITGIELDVLAEKGMLSEPLQDIVKRDEGLYGIDEVIALSIVNVYGSIGFTNFGYIDKLKPGILEYLNDKSTGKVHTFLDDIVGGIAAAASSRLAHRAEHSE
>NZ_CP029468.1|WP_000351151.1|4806136_4806616_-|GNAT-family-N-acetyltransferase
MDIHKLTEEEANEINTWTYEEPYSLYSFSGEKEVIEELLDGTYYGCCDDQGDLIGYFCFGGNAQVPGGRDANLYGGEDVIDIGLGMKPALTGKGIGKEFFQAGIAFATKEFNAKMFRLSVATFNTRAITVYKNIGFKQGTIFLSRGREFMLMEYERPSA
>NZ_CP029468.1|WP_025709847.1|4806777_4807881_+|HpcH/HpaI-aldolase/citrate-lyase-family-protein
MNYFSYLSSEERQNFFYKEPLSFSKNIGKEQLAYALGATLYTPGTKETIAEDIIRKKHVDATSIILCLEDAISDEEVKLAEQNIVVQIQQIANLVSANILNQADIPLLFIRVRQPSQMKTIVTELGSAVHCLCGFVFPKFTPINGKTYIDQLAYINELYSLSLYGMPILESPEIMYKETRAESLLQIKNLLDSYHDYILNVRIGATDFSSIFSIRRNKYTPIYHITVVRDCISDIINVFSRATNEYIISGCVWEYFSNDHEEGLIQEVSLDHANGLIGKTVIHPSHIKVVQAMHIVTMEDYLDARSILQNADTCNGVLKSSFSNKMNEVKPHYSWARKTILKSNIYGVLHENKQFTDLLITNAKQHV
>NZ_CP029468.1|WP_000856301.1|4807825_4809172_+|phosphoribosyltransferase-domain-containing-protein
MKTNNSPISLLQTQSNTYNVLNNIQVHVEVRDNPYNLALDNLFQMAARINKKRSFLFVSTILGKHLPIKPAVSLSSGVALAARYMEILHNISHPFQKEILNLISLEIDEIPEEVFRYQYPLQEEVLFIGFAETATSLGHSMFQCFQNAKYVHTTRESIPHLESVITFEEEHSHATSHRCYVDESFFQNNNPIVLVDDEMTTGKTALNIIRSIQNKFPREEYIIASLLDWRSHTNRKQFKQLEEELQIKVHVISLLEGSIHTTGQPLNIAKKEIQIEETKPDFKKHTLTCLKSPYTSNYIKYTGRFGISAYEQKHIHSFAQEAGKTLKRERMGKRTLCLGTGEFMYIPMKIADEMGENILYQSTTRSPIHSVSNDVNYAIHNHFSYPSPEDSTITNYFYNISPHDYDEVFVFIERDLGEEALSPLLQQLQTVIPFIHIVSFSNSIEKEG
>NZ_CP029468.1|WP_025709846.1|4809177_4810290_+|cysteine-protease-StiP-family-protein
MVKLNSHISSYNPNDAIFLLKDISDLMKESSTETREQAIQAGTHYSEMLPMEYKPSKAYMDLFFSSLQQYKHKLAIAVGVVAEQIIQTKGTNLVLVSLARAGTPIGILIKRYIRYQYDLDVPHYCISIVRGRGIDENALHFILEHHPKETIQFIDGWTGKGAIKKELEYAVHTFNERNNTHISHCMAVLADPGYCTSIYGTREDFLIPSACLNATVSGLISRTVLNDTYIGPNDFHGVKYYKELEQEDLSNFFVDEVTELFPSVHSHIDNQLRYITSTYTDPSWQGLKDIQSIQNHFEIDDINLIKPGVGETTRVLLRRIPWKILIRKQNNPDLKHILLLAKEKNVPIEIYENMAYSCCGLIKPLRKETI
>NZ_CP029468.1|WP_025709845.1|4810286_4811102_+|HAD-hydrolase-family-protein
MIFASDLDQTLIYSRKSFRAPIEDKSIQLIETLDGKEISFISHKTISLLKKLQLHSHFIPVTTRTIKQFQRIALFQNEIIPEYAITSNGGNILHNGKQDGTWNRKVKERLSVECIERNDILKEFGQIAHKDWVISQKTADDLFHYCIIKRENIPYDELSSFTSWLDKQGWNHSLQGRKLYFVPKPINKWDAVQYIKEILQIDTIITAGDSLLDLCMLEKANHAFAPLHGELGAMHDNLQPHILKTDAIGIYAAEEIVNKSLQIIHSSLPTS
>NZ_CP029468.1|WP_000683439.1|4811657_4812239_+|NAD(P)H-dependent-oxidoreductase
MKHVIVYAHPNTESFNHAILETVKSELEGKGHEVRVRDLYELNFNPVLGASDFISFSQGNTPEDIKEEQEHISWADSITFIYPVWWAGLPAILKGYVDRVFSHGFAYAYGENGIEKLLSGKKGLLLSTMGNTKEAYTAGGMFDAMKKTADVGIFEFTGIETIEHTFYTSVPSVDDSVRKQYLEEVKDVVNRAF
>NZ_CP029468.1|WP_000276467.1|4812384_4813149_-|TIGR01457-family-HAD-type-hydrolase
MYKGYLIDLDGTMYRGEEQIEEASDFVKALGERGIPYLFVTNNSTRKPEQVAEKLVRFDIPAKAEQVFTTSMATANFIYERKQDATVYMIGEEGLHDALVEKGFELVDENPDFVVVGLDRDITYEKLAKACLAVRNGATFISTNGDIAIPTERGLLPGNGSLTSVVAVSTGVDPIFIGKPESIIMEQALKVLGIEKNEALMVGDNYDTDILAGINAGMHTLLVHTGVTTVEKLTEYEVQPTQVVHNLTEWIEKM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP029468_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029468_3

5122340-5122473

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP029468_3

>merge|NZ_CP029468|3|5122340-5122473|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGGTTCTTCTTTTTTGTCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTACTTTCTGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NZ_CP029468|3|2|5122340-5122473|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGG	TTCTTCTTTTTTGTCACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTACTTTCTGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029468.1\|WP_000672663.1\|5126196_5127216_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP029468.1\|WP_025709678.1\|5123361_5124066_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|225260
NZ_CP029468.1\|WP_000411274.1\|5127422_5128727_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP029468.1\|WP_025709674.1\|5132982_5134845_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP029468.1\|WP_025709680.1\|5115815_5116583_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NZ_CP029468.1\|WP_002005985.1\|5128766_5129477_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP029468.1\|WP_025709681.1\|5112823_5114632_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|224011
NZ_CP029468.1\|WP_000057889.1\|5129522_5129759_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP029468.1\|WP_000008901.1\|5122017_5122152_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029468.1\|WP_025709679.1\|5118389_5119067_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP029468.1\|WP_000931959.1\|5119411_5119846_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP029468.1\|WP_000457978.1\|5120274_5121276_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP029468.1\|WP_000544012.1\|5121436_5121709_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP029468.1\|WP_025709675.1\|5131483_5132986_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP029468.1\|WP_000757805.1\|5114692_5115574_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP029468.1\|WP_000243845.1\|5116694_5117396_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP029468.1\|WP_000393128.1\|5117385_5118129_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP029468.1\|WP_025709677.1\|5125088_5126096_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP029468.1\|WP_122974145.1\|5129961_5131482_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP029468.1\|WP_000170855.1\|5124065_5124908_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054

Protein	Function_ID	Function_description	E-value
NZ_CP029468.1\|WP_000672663.1\|5126196_5127216_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	5.80584e-135
NZ_CP029468.1\|WP_025709678.1\|5123361_5124066_-\|ABC-transporter-permease	gnl\|CDD\|225260	COG2386, CcmB, ABC-type transport system involved in cytochrome c biogenesis, permease component [Posttranslational modification, protein turnover, chaperones].	0.000827236
NZ_CP029468.1\|WP_000411274.1\|5127422_5128727_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP029468.1\|WP_025709674.1\|5132982_5134845_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP029468.1\|WP_025709680.1\|5115815_5116583_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	1.31022e-105
NZ_CP029468.1\|WP_002005985.1\|5128766_5129477_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	5.16446e-34
NZ_CP029468.1\|WP_025709681.1\|5112823_5114632_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
NZ_CP029468.1\|WP_000057889.1\|5129522_5129759_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NZ_CP029468.1\|WP_025709679.1\|5118389_5119067_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	2.01081e-81
NZ_CP029468.1\|WP_000931959.1\|5119411_5119846_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP029468.1\|WP_000457978.1\|5120274_5121276_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP029468.1\|WP_000544012.1\|5121436_5121709_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP029468.1\|WP_025709675.1\|5131483_5132986_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	1.38678e-177
NZ_CP029468.1\|WP_000757805.1\|5114692_5115574_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NZ_CP029468.1\|WP_000243845.1\|5116694_5117396_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	5.63397e-83
NZ_CP029468.1\|WP_000393128.1\|5117385_5118129_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	9.79397e-84
NZ_CP029468.1\|WP_025709677.1\|5125088_5126096_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.70941e-31
NZ_CP029468.1\|WP_122974145.1\|5129961_5131482_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	4.19684e-150
NZ_CP029468.1\|WP_000170855.1\|5124065_5124908_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.54653e-90

>NZ_CP029468.1|WP_000008901.1|5122017_5122152_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEEFEREE
>NZ_CP029468.1|WP_000544012.1|5121436_5121709_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP029468.1|WP_000457978.1|5120274_5121276_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NZ_CP029468.1|WP_000931959.1|5119411_5119846_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP029468.1|WP_025709679.1|5118389_5119067_-|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLMQCIQKTDIENVYLMAAGPIPPNPAELLGSRVMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKLLGVVLNDKREEKEQYGYY
>NZ_CP029468.1|WP_000393128.1|5117385_5118129_-|capsular-polysaccharide-biosynthesis-protein
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQLGEIQSNIQLTNTYKVIIKSPVILDRVNEKLNLNMTAQALTKKINIANEKDSQVISVTAEDKDPKLARDIANATADVFKDEVAKIMNVDNVTVLSKAEVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKVRGQTIGS
>NZ_CP029468.1|WP_000243845.1|5116694_5117396_-|CpsD/CapB-family-tyrosine-protein-kinase
MVLNLFKKKKSHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDMNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>NZ_CP029468.1|WP_025709680.1|5115815_5116583_-|tyrosine-protein-phosphatase
MIDLHCHILPGIDDGAQTVTDSLAMAQQAVAEGIHTIVATPHHQNGKYVNERTPIIHHVKQLNDELQQHNIPLTILPGQEVRLYGDLLEDYEADKIVTLNETNKYIFIEFPSNHVPRYAEQLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMVASDAHNTTSRGFHLAESYELIEKEFGMNVMSDLKENPYLLISGKAIYKEDPEQIRRKKLFGIF
>NZ_CP029468.1|WP_000757805.1|5114692_5115574_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQSLLEKGKHEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPIEQNNRRYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEVQRVFAYDFEGTRYDVGEKFGFIKTTIEMALQNEELNVELMKYMKELVKKEGVHS
>NZ_CP029468.1|WP_025709681.1|5112823_5114632_-|polysaccharide-biosynthesis-protein
MSYRRRLSLLILLDSFIVLTAVYLSYWFIHPNVLNKIPMTVVISSITLLCSHHVFAAIYKLYNKAWEYASIGELKQIFKAITLSILVTAIVQQIINHDIYVRILAIAWMLHLLLIGGSRFVWRMFRDTYISKATDKKRTLIIGAGSAGTMVVRQLQHNKEADLYPIAFVDDDRNKQKLEIYNVPVIGTTNHIQEIVEDNDIEHIIIAIPSLNRGQINEIFEKCRKTKAKTQIVPMLEDLLDGKVSVNEFRDVQVEDLLGREPVQLDDKGIGEKIQDKTVLITGAGGSIGSEICRQILKYKPAKMVLLGHGENSIYHIEMELRTKYKEQAEFVTEIADIQDRNKIFEIMKKHKPFVVYHAAAHKHVPLMERNPEEAVKNNIIGTKNVAEAADTFGINTFVMVSTDKAVNPTNVMGATKRVAEMVVQHMAMISQTRFVAVRFGNVLGSRGSVIPLFKKQIQSGGPVTVTHPDITRYFMTIPEASRLVIQAGSLARGGELFVLDMGEPVKIADLAKNLIQLSGYSIEEIGIEYSGLRPGEKMYEELLNDNEIHKEQVFPKIHIGKAVLKDFESIQQFINEFEQMSQESIRKTLLDFANNKVEVNS
>NZ_CP029468.1|WP_025709678.1|5123361_5124066_-|ABC-transporter-permease
MTFSMRRVSAIFRKEVQDFKTNSQVLLMAFLPIILSFLFSRFGVGKEMLGITTITAFLFVAGFVQSMVIAEEKEKHTLRVLMLSPASSVEVLLGKSILTACLTLGICIVNLFILDQFSGNLLLLGFIFLCGTILFIVIGTMIGLLAASVPQTSIIGMPILMTMYLAVQFEPMVENKVIKTMIGYLPTSHIVKALNSLVGGAGFGSISGHVLNVAVWLIISLFVCLIVYKKKQLD
>NZ_CP029468.1|WP_000170855.1|5124065_5124908_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFNEKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNKEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIQVVLKDKKKETVQKDELGAKRISEWMNKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP029468.1|WP_025709677.1|5125088_5126096_-|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MALLELKQLGKANQLPEMELKVEKGRCIVLQCNNHTAKVLHRIIIGQEEASTGNVLFEGEAIGKKNYSRIGFCFLKDEAYDRLKVKEYFKFLIGLYESKISIEEVVQSVGLLDKLNVKIEKLSFSEKRRLHIGRVMIHNPDLIILEEPEQNVDIESTVIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKVEIEQEEAEEVDEEKVVQIIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLGELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP029468.1|WP_000672663.1|5126196_5127216_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVETLPVEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKDELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP029468.1|WP_000411274.1|5127422_5128727_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVAATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVNFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP029468.1|WP_002005985.1|5128766_5129477_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKEKANIQKWEVEQSPDGYKATSYKKLSSYEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQNMNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP029468.1|WP_000057889.1|5129522_5129759_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP029468.1|WP_122974145.1|5129961_5131482_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASALILCTAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITLFVGLELLSLSSYILVGIRKKSRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGAATPVTAFLGTISKIAGFLLIIRLFLMIFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTMDSMWFYMLAYMLMNIGAFAIIHGLILQNNEENITIFTGLYKRSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGATVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP029468.1|WP_025709675.1|5131483_5132986_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAAVLACTYASGKNLSLFDEKMKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMVLTALLATLAAIAAFSIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSVNAEGALVIPSSLQLSVFIAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVMAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITALGGLAKSVPVLSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKSDIHGWEYVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP029468.1|WP_025709674.1|5132982_5134845_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSETSVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEEVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEETHGPVWIMIVATLVSFAGIALAYFIYSKKSISRNWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEVYVVEGIAVLIASVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP029468_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029468_4

5168977-5169089

Orphan

Consensus_repeat	Method
TTCTGAAGGAGCTGCTTACGCTTTTTATTTAAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP029468_4

>merge|NZ_CP029468|4|5168977-5169089|CRISPRCasFinder
TTCTGAAGGAGCTGCTTACGCTTTTTATTTAATCTAGCTTCAGCAGCTAGAATGGTCGGTGGCTTCACTTCTTCCTCCCATTCTGAACGAGCTGCTTACGCTTTTTATTTAAT

>NZ_CP029468|4|3|5168977-5169089|CRISPRCasFinder
TTCTGAAGGAGCTGCTTACGCTTTTTATTTAAT	CTAGCTTCAGCAGCTAGAATGGTCGGTGGCTTCACTTCTTCCTCCCA
TTCTGAACGAGCTGCTTACGCTTTTTATTTAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029468.1\|WP_000238599.1\|5176528_5177158_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP029468.1\|WP_001053903.1\|5167456_5168728_-\|transcription-termination-factor-Rho	unknown	unknown	gnl\|CDD\|236490
NZ_CP029468.1\|WP_001267065.1\|5163804_5164656_-\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236467
NZ_CP029468.1\|WP_025709669.1\|5178385_5179516_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NZ_CP029468.1\|WP_000398594.1\|5172852_5173221_-\|sporulation-initiation-phosphotransferase-Spo0F	unknown	unknown	gnl\|CDD\|381105
NZ_CP029468.1\|WP_000887064.1\|5164655_5165723_-\|peptide-chain-release-factor-1	unknown	unknown	gnl\|CDD\|234801
NZ_CP029468.1\|WP_000912404.1\|5173422_5173947_+\|DUF2529-domain-containing-protein	unknown	unknown	gnl\|CDD\|378487
NZ_CP029468.1\|WP_000280859.1\|5166237_5166825_-\|thymidine-kinase	unknown	unknown	gnl\|CDD\|235272
NZ_CP029468.1\|WP_000346280.1\|5175843_5176374_-\|DNA-directed-RNA-polymerase-subunit-delta	unknown	unknown	gnl\|CDD\|275360
NZ_CP029468.1\|WP_000557354.1\|5161174_5162215_-\|threonylcarbamoyl-AMP-synthase	unknown	unknown	gnl\|CDD\|223088
NZ_CP029468.1\|WP_000758437.1\|5162323_5162782_-\|mechanosensitive-ion-channel-protein	unknown	unknown	gnl\|CDD\|224167
NZ_CP029468.1\|WP_025709670.1\|5162831_5163692_-\|stage-II-sporulation-protein-R	unknown	unknown	gnl\|CDD\|378205
NZ_CP029468.1\|WP_000197472.1\|5160039_5160318_-\|DUF3935-domain-containing-protein	unknown	unknown	gnl\|CDD\|372460
NZ_CP029468.1\|WP_000643433.1\|5166933_5167179_-\|type-B-50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|234969
NZ_CP029468.1\|WP_000170460.1\|5173978_5175586_-\|CTP-synthase	unknown	unknown	gnl\|CDD\|235437
NZ_CP029468.1\|WP_000545538.1\|5177224_5178364_-\|acyl-CoA-dehydrogenase-AcdA	unknown	unknown	gnl\|CDD\|173847
NZ_CP029468.1\|WP_000142475.1\|5160548_5161097_-\|manganese-efflux-pump	unknown	unknown	gnl\|CDD\|308338
NZ_CP029468.1\|WP_001131855.1\|5171784_5172642_-\|fructose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|169068
NZ_CP029468.1\|WP_000413254.1\|5170162_5171452_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|183779
NZ_CP029468.1\|WP_000538880.1\|5179589_5180441_-\|3-hydroxybutyryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|180269

Protein	Function_ID	Function_description	E-value
NZ_CP029468.1\|WP_000238599.1\|5176528_5177158_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.60731e-13
NZ_CP029468.1\|WP_001053903.1\|5167456_5168728_-\|transcription-termination-factor-Rho	gnl\|CDD\|236490	PRK09376, rho, transcription termination factor Rho; Provisional.	0
NZ_CP029468.1\|WP_001267065.1\|5163804_5164656_-\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	gnl\|CDD\|236467	PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.	2.34125e-117
NZ_CP029468.1\|WP_025709669.1\|5178385_5179516_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	0
NZ_CP029468.1\|WP_000398594.1\|5172852_5173221_-\|sporulation-initiation-phosphotransferase-Spo0F	gnl\|CDD\|381105	cd17553, REC_Spo0F-like, phosphoacceptor receiver (REC) domain of Spo0F and similar domains. Spo0F, a stand-alone response regulator containing only a REC domain with no output/effector domain, controls sporulation in Bacillus subtilis through the exchange of a phosphoryl group. Bacillus subtilis forms spores when conditions for growth become unfavorable. The initiation of sporulation is controlled by a phosphorelay (an expanded version of the two-component system) that consists of four main components: a histidine kinase (KinA), a secondary messenger (Spo0F), a phosphotransferase (Spo0B), and a transcription factor (Spo0A). REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.77706e-64
NZ_CP029468.1\|WP_000887064.1\|5164655_5165723_-\|peptide-chain-release-factor-1	gnl\|CDD\|234801	PRK00591, prfA, peptide chain release factor 1; Validated.	0
NZ_CP029468.1\|WP_000912404.1\|5173422_5173947_+\|DUF2529-domain-containing-protein	gnl\|CDD\|378487	pfam10740, DUF2529, Domain of unknown function (DUF2529). This domain is conserved in the Bacillales. The function is not known, but given this domains relationship to the SIS domain it may carry out a sugar isomerase reaction. Several members are annotated as being YWJG, a protein expressed downstream of pyrG, a gene encoding for cytidine triphosphate synthetase.	1.97566e-73
NZ_CP029468.1\|WP_000280859.1\|5166237_5166825_-\|thymidine-kinase	gnl\|CDD\|235272	PRK04296, PRK04296, thymidine kinase; Provisional.	2.78015e-105
NZ_CP029468.1\|WP_000346280.1\|5175843_5176374_-\|DNA-directed-RNA-polymerase-subunit-delta	gnl\|CDD\|275360	TIGR04567, DNA-directed_RNA_polymerase_subunit_delta, DNA-directed RNA polymerase delta subunit. Members of this family are the RNA polymerase delta subunit, as found in the Firmicutes and the Mollicutes. All members of the seed alignment have an extended C-terminal low-complexity region, consisting largely of Asp and Glu, that is not included in the model. Proteins giving borderline scores should be checked to confirm a similar acidic C-terminal domain. [Transcription, DNA-dependent RNA polymerase].	2.5161e-33
NZ_CP029468.1\|WP_000557354.1\|5161174_5162215_-\|threonylcarbamoyl-AMP-synthase	gnl\|CDD\|223088	COG0009, SUA5, Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis].	1.15307e-93
NZ_CP029468.1\|WP_000758437.1\|5162323_5162782_-\|mechanosensitive-ion-channel-protein	gnl\|CDD\|224167	COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism].	0.00482578
NZ_CP029468.1\|WP_025709670.1\|5162831_5163692_-\|stage-II-sporulation-protein-R	gnl\|CDD\|378205	pfam09551, Spore_II_R, Stage II sporulation protein R (spore_II_R). SpoIIR is designated stage II sporulation protein R. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. SpoIIR is a signalling protein that links the activation of sigma E to the transcriptional activity of sigma F during sporulation.	1.42833e-67
NZ_CP029468.1\|WP_000197472.1\|5160039_5160318_-\|DUF3935-domain-containing-protein	gnl\|CDD\|372460	pfam13071, DUF3935, Protein of unknown function (DUF3935). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length. There are two conserved sequence motifs: FVF and LGV.	1.86353e-30
NZ_CP029468.1\|WP_000643433.1\|5166933_5167179_-\|type-B-50S-ribosomal-protein-L31	gnl\|CDD\|234969	PRK01678, rpmE2, type B 50S ribosomal protein L31.	2.01142e-51
NZ_CP029468.1\|WP_000170460.1\|5173978_5175586_-\|CTP-synthase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NZ_CP029468.1\|WP_000545538.1\|5177224_5178364_-\|acyl-CoA-dehydrogenase-AcdA	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	0
NZ_CP029468.1\|WP_000142475.1\|5160548_5161097_-\|manganese-efflux-pump	gnl\|CDD\|308338	pfam02659, Mntp, Putative manganese efflux pump. MntP is a family of bacterial proteins with a signal peptide and four transmembrane domains. It is a putative manganese efflux pump, since deletion of the gene leads to profound manganese sensitivity and elevated intracellular manganese levels in bacteria. Manganese is a highly important trace nutrient for organisms from bacteria to humans, and acts as an important element in the defense against oxidative stress and as an enzyme cofactor.	2.14383e-39
NZ_CP029468.1\|WP_001131855.1\|5171784_5172642_-\|fructose-bisphosphate-aldolase	gnl\|CDD\|169068	PRK07709, PRK07709, fructose-bisphosphate aldolase; Provisional.	0
NZ_CP029468.1\|WP_000413254.1\|5170162_5171452_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|183779	PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed.	0
NZ_CP029468.1\|WP_000538880.1\|5179589_5180441_-\|3-hydroxybutyryl-CoA-dehydrogenase	gnl\|CDD\|180269	PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	0

>NZ_CP029468.1|WP_001053903.1|5167456_5168728_-|transcription-termination-factor-Rho
MNLSIAALENMKLKELYELAKEFKISYYSKLTKKELIFSILKARAEKEGFFFMEGVLEIIQSEGFGFLRPINYSPSSEDIYISASQIRRFDLRNGDKVSGKVRPPKENERYFGLLQVEAVNGDDPDSAKERVHFPALTPLYPDRQMKLETEPKKLPTRIMDLIAPVGFGQRGLIVAPPKAGKTSLLKEIAHSVTTNHPEAELIVLLIDERPEEVTDIERSVKGDVVSSTFDEVPENHIKVAELVLERAMRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARNIEEGGSLTILATALVDTGSRMDDVIYEEFKGTGNMELHLDRSLAERRIFPAIDIRRSGTRKEDLLIPKEHLDKLWGIRKTMRDTPDFVESFLRKLRQTKTNEEFLQNIVADSKRYVTTK
>NZ_CP029468.1|WP_000643433.1|5166933_5167179_-|type-B-50S-ribosomal-protein-L31
MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGRVDRFNKKYGLK
>NZ_CP029468.1|WP_000280859.1|5166237_5166825_-|thymidine-kinase
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPANKDK
>NZ_CP029468.1|WP_000887064.1|5164655_5165723_-|peptide-chain-release-factor-1
MLDRLQAVENRYEKLNELLSDPAIISDSNKLREYSKEQSDIQETVEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQDKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQKMEAAE
>NZ_CP029468.1|WP_001267065.1|5163804_5164656_-|peptide-chain-release-factor-N(5)-glutamine-methyltransferase
MRVYEALKWASSFLQENGRDENAGEIVLCHVLKVNRTGLLMNMREEITEEQEKSFTEFIHKHVEGIPIQYMIGYEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLALENKNLHVYTVDIAQESIEVAKENAKALGAEVTFYHGDLLSPFHKTGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKRLLQQAFPHAHVEVVFDINGKDRMVFAEME
>NZ_CP029468.1|WP_025709670.1|5162831_5163692_-|stage-II-sporulation-protein-R
MKKQVIAYLLILLIGAQLLVQFGYMKADAKGPSVIPKEAVRLRILANSDSDKDQALKRKVRDEVKAQIDGWVADLTSFEEARKVIQSHIPEIEKTVENTLKREGSEDSFQVKFSKNVKFPTKVYGNFIYPAGEYEAVLITIGEGEGANWWCVLFPPMCFLDFSSGTAVRKEEHVVKAESPEEEQVQLDEEVVDTEENKVGKVKETKVVKREAVKKVTASEKKVVKNEAKVEEQPVSKEETKNVEKVEKPVEKKQEKQNEYVKVEEEEKKPEVKLFIVEAFTSLFSK
>NZ_CP029468.1|WP_000758437.1|5162323_5162782_-|mechanosensitive-ion-channel-protein
MKKVYFATKADVERLHSFFGQANKKDDKINELYAQFMILEEAEEIRAVIGYEQSGEDVLIRSCLFTPHVDKQTFLYFFEMFLQYMKEKSVQQLYLLTNHPQSVPIFQFFDFFTIEKDEVPEGIQQLEHFCKNIKEQNAIILNCQLFTKLSTD
>NZ_CP029468.1|WP_000557354.1|5161174_5162215_-|threonylcarbamoyl-AMP-synthase
MHTNMWVVDNVVERKKYYPQLQEAAKLLRENEAVAFPTETVYGLGANAMDDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMAHFWPGPLTIILPRKEGISEKVTAGLNTVGVRMPDHPIALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGIVDGGATGVGVESTVIDCTSTVPTILRPGGITKEQLEAVIGTVSLDPALKDEKEKPKSPGMKYTHYAPKAPLSIVEGSREFIQHLVDEKKKEGFKVGVLTTEEYQYVYSADVILSCGVRSDLASVATKLYDVLRTFDASEVDVIFSESFPNEGIGNAIMNRLTKAAGHHIIIE
>NZ_CP029468.1|WP_000142475.1|5160548_5161097_-|manganese-efflux-pump
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLKLRQILYIGMTIGIFHIIMPFIGMVLGRFLSEKYGDIAHFAGAILLIGLGFYIVYSTILQNEETRTAPIGISLFVFAFGVSIDSFSVGLSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKDMLGTYGEIVGGIILVGFGLYILFPI
>NZ_CP029468.1|WP_000197472.1|5160039_5160318_-|DUF3935-domain-containing-protein
MTRLKQVFGIIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVIKLGKPKKEKMPTLEEKKEELQ
>NZ_CP029468.1|WP_000413254.1|5170162_5171452_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKLLIEGGRALNGTIRVSGAKNSAVALIPATILADTPVTIGGVPNISDVKMLGDLLEEIGGKVTYGQEEEMVVDPSNMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLGPRPIDQHIKGFEALGAHVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLAAVRAKGRTVIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYMILGAASGGEVTVDNVIPQHLESVTAKLREAGVQVETNDDQITVNGNRKLKVVDIKTLVYPGFPTDLQQPFTTLLTKAHGTGVVTDTIYGARFKHIDELRRMNAQIKVEGRSAIVTGPVLLQGAKVKASDLRAGAALVIAGLMADGITEVTGLEHIDRGYENIVDKLKGLGANIWREQMTKQEIEEMKNA
>NZ_CP029468.1|WP_001131855.1|5171784_5172642_-|fructose-bisphosphate-aldolase
MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKQVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA
>NZ_CP029468.1|WP_000398594.1|5172852_5173221_-|sporulation-initiation-phosphotransferase-Spo0F
MEGKILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKDNPDLVVLDMKIPGMDGIEILKHVKEIDESIKVILMTAYGELDMIQEAKDLGALMHFAKPFDIDEIRQAVRNELAVEA
>NZ_CP029468.1|WP_000912404.1|5173422_5173947_+|DUF2529-domain-containing-protein
MLKIFSTQLSGYFSRVSQKEEMNIEDSARLLAQALVGDGFIYLHGTNEMEGVVAEALFGAEPMKQAKRLFENGKEVEVTSADRVLLISRFSTDEAVVEIAKKLQEEGHSIVGISALQEGTESLERYTDVHIDTKLLKGLIPDDEGNRYGFPSLIVALFAYHGIKFTIDEMLNEY
>NZ_CP029468.1|WP_000170460.1|5173978_5175586_-|CTP-synthase
MTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNPAADMTEWTALVNKVRNLSKKTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVKELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLAEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKEGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRASITNKESK
>NZ_CP029468.1|WP_000346280.1|5175843_5176374_-|DNA-directed-RNA-polymerase-subunit-delta
MDFKQYSPEELKECSMIEVVHSVLGDKKQATTFNELVQEIAQVLGLSQEQVNAKIAQFYTDLNIDGRFINLGENRWGLRSWYPYEQIDEEILPQPKPKKKRKVEEDGFDDYIEEDEDDFDDADVSEDEDDVEDLDKVLEEEDGDDDDLDDLDEDDDDFAEEELEYDETEEEEEEEL
>NZ_CP029468.1|WP_000238599.1|5176528_5177158_-|TetR/AcrR-family-transcriptional-regulator
MVKHNVHASVKDEKLVALRREQMIKGAVQLFKQKGFPRTTTREIAKAAGFSIGTLYEYIRTKDDVLYLVCDSIYEHVKERLEEVVCTEKGSIESLKIAITNYFKVMDELQEEVLIMYQEVRFLPKESLPYVLEKEFQMVGMFENILEQCTENGTFTLNKKEIQLLAHNIFIQGQMWGFRRWALQKLYTLEEYTEMQIRYVLQGAHMLPK
>NZ_CP029468.1|WP_000545538.1|5177224_5178364_-|acyl-CoA-dehydrogenase-AcdA
MHFKLSEEHEMIRKMVRDFAKNEVAPTAAERDEEERFDRELFDQMAEIGLTGIPWPEEYGGIGSDYLAYVIAIEELSRVCASTGVTLSAHTSLAGWPIFKFGTEEQKQKFLRPMAEGKKIGAYGLTEPGSGSDAGGMKTIAKRDGDHYILNGSKIFITNGGIADIYVVFALTDPESKQRGTSAFIVESDTPGFSVGKKESKLGIRSSPTTEIMFEDCRIPVENLLGGEGQGFKVAMQTLDGGRNGIAAQAVGIAQGALDASVEYARERHQFGKPIAAQQGIGFKLADMATDVEAARLLTYQAAWLESEGLPYGKESAMSKVFAGDAAMKVTTEAVQVFGGYGYTKDYPVERYMRDAKITQIYEGTQEIQRLVISRMLTK
>NZ_CP029468.1|WP_025709669.1|5178385_5179516_-|acyl-CoA-dehydrogenase
MNFRFNEEQQMMRKMVRDFAQKEIAPFVPSMEQGVFPKEILQKMGELGLMGIPAPAKYGGAEMDFISYILAIEEISKVSATVGVILAVHTSVGMNPILYFGTEEQKKKYVSKLATGEYLGAFALTEPNAGSDAGSLKSRAVKKGDHYIINGSKVFITNGGEASTYIVFASTNPEAGKSGISAFIVEKDTPGLIIGKDEHKMGLLGSRTVQLTFEDMKVPAENLLGEEGQGFKVAMANLDVGRIGIGAQALGIAEAAIGCAIDYAKEREQFGKPIAAQQGIGFKLADMATSVEAARLLVYRAASLRAQGLPCGKEASIAKLFASKTAVEVAIEAVQVFGGYGYTKDYPVERFFRDAKITQIYEGTSEIQKLVISRAL
>NZ_CP029468.1|WP_000538880.1|5179589_5180441_-|3-hydroxybutyryl-CoA-dehydrogenase
MGVQNIVVIGAGQMGSGIAQVCAMAGYDVKVQDLKQEQLDRGMAIITKNLARQVEKGRMKEEEKEATLNRLTVTLDLDCVKEADLIIEAAVEKMDIKKKIFANLDEIAPEHAILATNTSSLPITEIAAVTKRPEKVIGMHFMNPVPVMKLVEIIRGLATDDAVYEAIEDITKKIGKVPVEVNDFPGFVSNRILLPMINEAIYTLYEGVATKEAIDEVMKLGMNHPMGPLTLADFIGLDTCLYIMEVLHEGLGDSKYRPCPLLRKYVNAGWLGRKTGRGFYVYE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP029468_1	1.39\|3628961\|22\|NZ_CP029468\|CRT	3628961-3628982	22	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3061-3082	1	0.955
NZ_CP029468_1	1.39\|3628961\|22\|NZ_CP029468\|CRT	3628961-3628982	22	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2911-2932	1	0.955
NZ_CP029468_1	1.39\|3628961\|22\|NZ_CP029468\|CRT	3628961-3628982	22	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	412-433	1	0.955
NZ_CP029468_1	1.39\|3628961\|22\|NZ_CP029468\|CRT	3628961-3628982	22	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	195-216	1	0.955
NZ_CP029468_1	1.39\|3628961\|22\|NZ_CP029468\|CRT	3628961-3628982	22	NC_024210	Escherichia phage e4/1c, complete genome	7547-7568	1	0.955
NZ_CP029468_1	1.24\|3628178\|22\|NZ_CP029468\|CRT	3628178-3628199	22	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	610880-610901	2	0.909
NZ_CP029468_1	1.24\|3628178\|22\|NZ_CP029468\|CRT	3628178-3628199	22	NC_011889	Methylobacterium nodulans ORS 2060 plasmid pMNOD06, complete sequence	6950-6971	2	0.909
NZ_CP029468_1	1.26\|3628277\|22\|NZ_CP029468\|CRT	3628277-3628298	22	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	610880-610901	2	0.909
NZ_CP029468_1	1.26\|3628277\|22\|NZ_CP029468\|CRT	3628277-3628298	22	NC_011889	Methylobacterium nodulans ORS 2060 plasmid pMNOD06, complete sequence	6950-6971	2	0.909
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	2	0.926
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	2	0.926
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	803-829	2	0.926
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83709-83735	2	0.926
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88214-88240	2	0.926
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	803-829	2	0.926
NZ_CP029468_1	1.39\|3628961\|22\|NZ_CP029468\|CRT	3628961-3628982	22	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1203-1224	3	0.864
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	3	0.889
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	3	0.889
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	3	0.889
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	3	0.889
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	3	0.889
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	3	0.889
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	3	0.889
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	3	0.889
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	3	0.889
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	3	0.889
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	3	0.889
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	3	0.889
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	3	0.889
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	3	0.889
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	3	0.889
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	3	0.889
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	3	0.889
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	3	0.889
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	3	0.889
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	3	0.889
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	3	0.889
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	3	0.889
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	3	0.889
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	3	0.889
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	3	0.889
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	3	0.889
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	3	0.889
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	3	0.889
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	3	0.889
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	3	0.889
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	3	0.889
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	3	0.889
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	3	0.889
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	3	0.889
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	3	0.889
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	3	0.889
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	3	0.889
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	3	0.889
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	3	0.889
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	3	0.889
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	3	0.889
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	3	0.889
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	3	0.889
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	3	0.889
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	3	0.889
NZ_CP029468_1	1.58\|3627410\|27\|NZ_CP029468\|CRT	3627410-3627436	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10520-10546	3	0.889
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	3	0.889
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3666-3692	3	0.889
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693092	Marine virus AFVG_25M37, complete genome	19108-19134	3	0.889
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29813-29839	3	0.889
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71434-71460	3	0.889
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2031962-2031988	3	0.889
NZ_CP029468_1	1.60\|3627500\|27\|NZ_CP029468\|CRT	3627500-3627526	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10520-10546	3	0.889
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1998-2024	3	0.889
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3666-3692	3	0.889
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693092	Marine virus AFVG_25M37, complete genome	19108-19134	3	0.889
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29813-29839	3	0.889
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71434-71460	3	0.889
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2031962-2031988	3	0.889
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	4	0.852
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	4	0.852
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	4	0.852
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	4	0.852
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	4	0.852
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	4	0.852
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	4	0.852
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	4	0.852
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	4	0.852
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	4	0.852
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	4	0.852
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	4	0.852
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	4	0.852
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	4	0.852
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	4	0.852
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	4	0.852
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	4	0.852
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	4	0.852
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	4	0.852
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285763-285789	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286411-286437	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286465-286491	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	287743-287769	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23715-23741	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23805-23831	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23877-23903	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27937-27963	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28045-28071	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28099-28125	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538228-538254	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538282-538308	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538390-538416	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177291-177317	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177345-177371	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177453-177479	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282158-282184	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282266-282292	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282320-282346	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155171-155197	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155351-155377	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114907-114933	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114961-114987	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115033-115059	4	0.852
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	4	0.852
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	4	0.852
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	4	0.852
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	4	0.852
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	4	0.852
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	4	0.852
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	4	0.852
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	4	0.852
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	4	0.852
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	4	0.852
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285763-285789	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286411-286437	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286465-286491	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	287743-287769	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23715-23741	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23805-23831	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23877-23903	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27937-27963	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28045-28071	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28099-28125	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538228-538254	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538282-538308	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538390-538416	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177291-177317	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177345-177371	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177453-177479	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282158-282184	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282266-282292	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282320-282346	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155171-155197	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155351-155377	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114907-114933	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114961-114987	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115033-115059	4	0.852
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	4	0.852
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	4	0.852
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	4	0.852
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	4	0.852
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	4	0.852
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452466-452492	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94423-94449	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	285763-285789	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286411-286437	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	286465-286491	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	287743-287769	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23715-23741	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23805-23831	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	23877-23903	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	27937-27963	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28045-28071	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	28099-28125	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538228-538254	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538282-538308	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	538390-538416	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177291-177317	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177345-177371	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	177453-177479	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282158-282184	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282266-282292	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	282320-282346	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155171-155197	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	155351-155377	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	535862-535888	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_020385	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence	272028-272054	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114907-114933	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	114961-114987	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	115033-115059	4	0.852
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	166925-166951	4	0.852
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3975-4001	4	0.852
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29504-29530	4	0.852
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15751-15777	4	0.852
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15748-15774	4	0.852
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	GU323708	Lactobacillus phage phiPYB5, complete genome	19357-19383	4	0.852
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693099	Marine virus AFVG_25M184, complete genome	13873-13899	4	0.852
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3975-4001	4	0.852
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29504-29530	4	0.852
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15751-15777	4	0.852
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15748-15774	4	0.852
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	GU323708	Lactobacillus phage phiPYB5, complete genome	19357-19383	4	0.852
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693099	Marine virus AFVG_25M184, complete genome	13873-13899	4	0.852
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	5	0.839
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	5	0.839
NZ_CP029468_1	1.38\|3628907\|31\|NZ_CP029468\|CRT	3628907-3628937	31	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10523-10553	5	0.839
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	5	0.815
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	5	0.815
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	5	0.815
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	5	0.815
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	5	0.815
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	5	0.815
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	5	0.815
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	5	0.815
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110873-110899	5	0.815
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110927-110953	5	0.815
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NC_004821	Bacillus prophage phBC6A52, complete genome	12610-12636	5	0.815
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	5	0.815
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	5	0.815
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	5	0.815
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	5	0.815
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110873-110899	5	0.815
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110927-110953	5	0.815
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NC_004821	Bacillus prophage phBC6A52, complete genome	12610-12636	5	0.815
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452538-452564	5	0.815
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452556-452582	5	0.815
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94333-94359	5	0.815
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94351-94377	5	0.815
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2025-2051	5	0.815
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	5	0.815
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110873-110899	5	0.815
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110927-110953	5	0.815
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NC_004821	Bacillus prophage phBC6A52, complete genome	12610-12636	5	0.815
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	MH825709	Mycobacterium phage NicoleTera, complete genome	5047-5073	5	0.815
NZ_CP029468_1	1.58\|3627410\|27\|NZ_CP029468\|CRT	3627410-3627436	27	MK798142	Pantoea phage vB_PagM_AAM22, complete genome	10764-10790	5	0.815
NZ_CP029468_1	1.58\|3627410\|27\|NZ_CP029468\|CRT	3627410-3627436	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP029468_1	1.58\|3627410\|27\|NZ_CP029468\|CRT	3627410-3627436	27	HQ632859	Loktanella phage pCB2051-A genomic sequence	37343-37369	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693092	Marine virus AFVG_25M37, complete genome	19063-19089	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	174974-175000	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	16801-16827	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	176996-177022	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	17719-17745	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9183-9209	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9336-9362	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21362-21388	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21515-21541	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10335-10361	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10713-10739	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10794-10820	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	176370-176396	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693405	Marine virus AFVG_25M416, complete genome	18961-18987	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693333	Marine virus AFVG_25M417, complete genome	18961-18987	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT197175	Klebsiella phage VLC5, complete genome	15241-15267	5	0.815
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693241	Marine virus AFVG_25M13, complete genome	20809-20835	5	0.815
NZ_CP029468_1	1.60\|3627500\|27\|NZ_CP029468\|CRT	3627500-3627526	27	MK798142	Pantoea phage vB_PagM_AAM22, complete genome	10764-10790	5	0.815
NZ_CP029468_1	1.60\|3627500\|27\|NZ_CP029468\|CRT	3627500-3627526	27	MN693092	Marine virus AFVG_25M37, complete genome	19117-19143	5	0.815
NZ_CP029468_1	1.60\|3627500\|27\|NZ_CP029468\|CRT	3627500-3627526	27	HQ632859	Loktanella phage pCB2051-A genomic sequence	37343-37369	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2043-2069	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693092	Marine virus AFVG_25M37, complete genome	19063-19089	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	174974-175000	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	16801-16827	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	176996-177022	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	17719-17745	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9183-9209	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9336-9362	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21362-21388	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21515-21541	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10335-10361	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10713-10739	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10794-10820	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	176370-176396	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693405	Marine virus AFVG_25M416, complete genome	18961-18987	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693333	Marine virus AFVG_25M417, complete genome	18961-18987	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT197175	Klebsiella phage VLC5, complete genome	15241-15267	5	0.815
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693241	Marine virus AFVG_25M13, complete genome	20809-20835	5	0.815
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255641	6	0.806
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255641	6	0.806
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255641	6	0.806
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255641	6	0.806
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	6	0.806
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	6	0.806
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	6	0.806
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	6	0.806
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	6	0.806
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255611-255641	6	0.806
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	6	0.806
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.40\|3626645\|27\|NZ_CP029468\|CRT	3626645-3626671	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	437131-437157	6	0.778
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.41\|3626690\|27\|NZ_CP029468\|CRT	3626690-3626716	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	437131-437157	6	0.778
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.42\|3626735\|27\|NZ_CP029468\|CRT	3626735-3626761	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	437131-437157	6	0.778
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.43\|3626780\|27\|NZ_CP029468\|CRT	3626780-3626806	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	437131-437157	6	0.778
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110837-110863	6	0.778
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116839-116865	6	0.778
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116875-116901	6	0.778
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NZ_CP029468_1	1.44\|3626825\|27\|NZ_CP029468\|CRT	3626825-3626851	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.45\|3626870\|27\|NZ_CP029468\|CRT	3626870-3626896	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	437131-437157	6	0.778
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.46\|3626915\|27\|NZ_CP029468\|CRT	3626915-3626941	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	437131-437157	6	0.778
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110837-110863	6	0.778
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116839-116865	6	0.778
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116875-116901	6	0.778
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NZ_CP029468_1	1.47\|3626960\|27\|NZ_CP029468\|CRT	3626960-3626986	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	452484-452510	6	0.778
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	94405-94431	6	0.778
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1980-2006	6	0.778
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	117028-117054	6	0.778
NZ_CP029468_1	1.48\|3627005\|27\|NZ_CP029468\|CRT	3627005-3627031	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	111008-111034	6	0.778
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110837-110863	6	0.778
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116839-116865	6	0.778
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116875-116901	6	0.778
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NZ_CP029468_1	1.49\|3627050\|27\|NZ_CP029468\|CRT	3627050-3627076	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1872-1898	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1962-1988	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14923-14949	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	170998-171024	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14920-14946	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	172948-172974	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14920-14946	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	172322-172348	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693405	Marine virus AFVG_25M416, complete genome	18925-18951	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693333	Marine virus AFVG_25M417, complete genome	18925-18951	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MN693189	Marine virus AFVG_25M326, complete genome	18855-18881	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NC_047917	Erwinia phage vB_EamP-S2, complete genome	29593-29619	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103810-103836	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103846-103872	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103882-103908	6	0.778
NZ_CP029468_1	1.59\|3627455\|27\|NZ_CP029468\|CRT	3627455-3627481	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103918-103944	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1872-1898	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1962-1988	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14923-14949	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	170998-171024	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14920-14946	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	172948-172974	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14920-14946	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	172322-172348	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693405	Marine virus AFVG_25M416, complete genome	18925-18951	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693333	Marine virus AFVG_25M417, complete genome	18925-18951	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MN693189	Marine virus AFVG_25M326, complete genome	18855-18881	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT066160	Vibrio phage Saratov-12, complete genome	4498-4524	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NC_047917	Erwinia phage vB_EamP-S2, complete genome	29593-29619	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	MT767883	Vibrio phage Saratov-15, complete genome	10808-10834	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103810-103836	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103846-103872	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103882-103908	6	0.778
NZ_CP029468_1	1.61\|3627545\|27\|NZ_CP029468\|CRT	3627545-3627571	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	103918-103944	6	0.778
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	7	0.774
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.21\|3628025\|31\|NZ_CP029468\|CRT	3628025-3628055	31	NC_014792	Enterobacteria phage vB_EcoM-VR7, complete genome	108763-108793	7	0.774
NZ_CP029468_1	1.21\|3628025\|31\|NZ_CP029468\|CRT	3628025-3628055	31	KP007359	Enterobacteria phage vB_EcoM_VR5, complete genome	108609-108639	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	7	0.774
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	7	0.774
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	7	0.774
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	7	0.774
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	7	0.774
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81951-81981	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	7	0.774
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	7	0.774
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85218-85248	7	0.774
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	7	0.774
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	7	0.774
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79811-79841	7	0.774
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84316-84346	7	0.774
NZ_CP029468_1	1.38\|3628907\|31\|NZ_CP029468\|CRT	3628907-3628937	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2677-2707	7	0.774
NZ_CP029468_1	1.38\|3628907\|31\|NZ_CP029468\|CRT	3628907-3628937	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2731-2761	7	0.774
NZ_CP029468_1	1.38\|3628907\|31\|NZ_CP029468\|CRT	3628907-3628937	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2785-2815	7	0.774
NZ_CP029468_1	1.38\|3628907\|31\|NZ_CP029468\|CRT	3628907-3628937	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168897-168927	7	0.774
NZ_CP029468_1	1.58\|3627410\|27\|NZ_CP029468\|CRT	3627410-3627436	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29812-29838	7	0.741
NZ_CP029468_1	1.58\|3627410\|27\|NZ_CP029468\|CRT	3627410-3627436	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29814-29840	7	0.741
NZ_CP029468_1	1.60\|3627500\|27\|NZ_CP029468\|CRT	3627500-3627526	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29812-29838	7	0.741
NZ_CP029468_1	1.60\|3627500\|27\|NZ_CP029468\|CRT	3627500-3627526	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29814-29840	7	0.741
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	8	0.742
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	8	0.742
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	8	0.742
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.21\|3628025\|31\|NZ_CP029468\|CRT	3628025-3628055	31	MN163280	Klebsiella phage KpGranit, complete genome	83369-83399	8	0.742
NZ_CP029468_1	1.21\|3628025\|31\|NZ_CP029468\|CRT	3628025-3628055	31	MN163280	Klebsiella phage KpGranit, complete genome	84572-84602	8	0.742
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	8	0.742
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	8	0.742
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	8	0.742
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	8	0.742
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	8	0.742
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	8	0.742
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	8	0.742
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	8	0.742
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	8	0.742
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	8	0.742
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	8	0.742
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	8	0.742
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	8	0.742
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	8	0.742
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	8	0.742
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	8	0.742
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MN163280	Klebsiella phage KpGranit, complete genome	81266-81296	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76463-76493	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78599-78629	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79766-79796	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80968-80998	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83104-83134	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84271-84301	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29524-29554	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	JQ691611	Cronobacter phage CR9, complete genome	9702-9732	8	0.742
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3981	8	0.742
NZ_CP029468_1	1.35\|3628754\|31\|NZ_CP029468\|CRT	3628754-3628784	31	MN694528	Marine virus AFVG_250M165, complete genome	1649-1679	8	0.742
NZ_CP029468_1	1.36\|3628808\|31\|NZ_CP029468\|CRT	3628808-3628838	31	MN694528	Marine virus AFVG_250M165, complete genome	1649-1679	8	0.742
NZ_CP029468_3	3.1\|5122363\|31\|NZ_CP029468\|CRISPRCasFinder	5122363-5122393	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742
NZ_CP029468_1	1.15\|3627701\|31\|NZ_CP029468\|CRT	3627701-3627731	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	9	0.71
NZ_CP029468_1	1.23\|3628124\|31\|NZ_CP029468\|CRT	3628124-3628154	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	9	0.71
NZ_CP029468_1	1.25\|3628223\|31\|NZ_CP029468\|CRT	3628223-3628253	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	9	0.71
NZ_CP029468_1	1.27\|3628322\|31\|NZ_CP029468\|CRT	3628322-3628352	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	9	0.71
NZ_CP029468_1	1.31\|3628547\|31\|NZ_CP029468\|CRT	3628547-3628577	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	9	0.71
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	9	0.71
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	MN694321	Marine virus AFVG_250M307, complete genome	32959-32989	9	0.71
NZ_CP029468_1	1.38\|3628907\|31\|NZ_CP029468\|CRT	3628907-3628937	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168951-168981	9	0.71
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812210	Flavobacterium phage vB_FspS_hemulen9-1, complete genome	22854-22887	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812215	Flavobacterium phage vB_FspS_lillamy9-4, complete genome	22191-22224	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812216	Flavobacterium phage vB_FspS_lillamy9-5, complete genome	22191-22224	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NC_048835	Flavobacterium phage vB_FspS_lillamy9-1, complete genome	22191-22224	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812213	Flavobacterium phage vB_FspS_lillamy9-2, complete genome	22191-22224	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812230	Flavobacterium phage vB_FspS_sniff9-2, complete genome	21831-21864	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812209	Flavobacterium phage vB_FspS_hemulen6-2, complete genome	22983-23016	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812218	Flavobacterium phage vB_FspS_lillamy9-7, complete genome	21454-21487	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812233	Flavobacterium phage vB_FspS_snork9-1, complete genome	22007-22040	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812219	Flavobacterium phage vB_FspS_morran9-1, complete genome	22308-22341	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812217	Flavobacterium phage vB_FspS_lillamy9-6, complete genome	21930-21963	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NC_048840	Flavobacterium phage vB_FspS_snork6-1, complete genome	22137-22170	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NC_048839	Flavobacterium phage vB_FspS_sniff9-1, complete genome	22057-22090	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NC_048842	Flavobacterium phage vB_FspS_stinky9-1, complete genome	21673-21706	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812232	Flavobacterium phage vB_FspS_snork6-2, complete genome	21655-21688	9	0.735
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	MN812208	Flavobacterium phage vB_FspS_hemulen6-1, complete genome	22983-23016	9	0.735
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	10	0.677
NZ_CP029468_1	1.28\|3628376\|31\|NZ_CP029468\|CRT	3628376-3628406	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	10	0.677
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	10	0.677
NZ_CP029468_1	1.29\|3628430\|31\|NZ_CP029468\|CRT	3628430-3628460	31	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	14488-14518	10	0.677
NZ_CP029468_1	1.32\|3628601\|31\|NZ_CP029468\|CRT	3628601-3628631	31	KM262192	Leuconostoc phage Ln-9, complete genome	17568-17598	10	0.677
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47181-47214	11	0.676
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47565-47598	11	0.676
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	47949-47982	11	0.676
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48333-48366	11	0.676
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	48717-48750	11	0.676
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49101-49134	11	0.676
NZ_CP029468_3	3.2\|5122417\|34\|NZ_CP029468\|CRISPRCasFinder	5122417-5122450	34	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	49485-49518	11	0.676

1. spacer 1.39|3628961|22|NZ_CP029468|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 1, identity: 0.955

acctcaaggcattcaaggacca	CRISPR spacer
acctcaaggtattcaaggacca	Protospacer
*********.************

2. spacer 1.39|3628961|22|NZ_CP029468|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 1, identity: 0.955

acctcaaggcattcaaggacca	CRISPR spacer
acctcaaggtattcaaggacca	Protospacer
*********.************

3. spacer 1.39|3628961|22|NZ_CP029468|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 1, identity: 0.955

acctcaaggcattcaaggacca	CRISPR spacer
acctcaaggtattcaaggacca	Protospacer
*********.************

4. spacer 1.39|3628961|22|NZ_CP029468|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 1, identity: 0.955

acctcaaggcattcaaggacca	CRISPR spacer
acctcaaggtattcaaggacca	Protospacer
*********.************

5. spacer 1.39|3628961|22|NZ_CP029468|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 1, identity: 0.955

acctcaaggcattcaaggacca	CRISPR spacer
acctcaaggtattcaaggacca	Protospacer
*********.************

6. spacer 1.24|3628178|22|NZ_CP029468|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

tgctcaagggcctgctggtgct	CRISPR spacer
ggctcaacggcctgctggtgct	Protospacer
 ****** **************

7. spacer 1.24|3628178|22|NZ_CP029468|CRT matches to NC_011889 (Methylobacterium nodulans ORS 2060 plasmid pMNOD06, complete sequence) position: , mismatch: 2, identity: 0.909

tgctcaagggcctgctggtgct	CRISPR spacer
tgctcaagggcctgctcgtgca	Protospacer
**************** ****

8. spacer 1.26|3628277|22|NZ_CP029468|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

tgctcaagggcctgctggtgct	CRISPR spacer
ggctcaacggcctgctggtgct	Protospacer
 ****** **************

9. spacer 1.26|3628277|22|NZ_CP029468|CRT matches to NC_011889 (Methylobacterium nodulans ORS 2060 plasmid pMNOD06, complete sequence) position: , mismatch: 2, identity: 0.909

tgctcaagggcctgctggtgct	CRISPR spacer
tgctcaagggcctgctcgtgca	Protospacer
**************** ****

10. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 2, identity: 0.926

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
.*********************** **

11. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 2, identity: 0.926

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
.*********************** **

12. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

cggcgctactggtgctactggacctca	CRISPR spacer
cggagctactggtgctactggccctca	Protospacer
*** ***************** *****

13. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 2, identity: 0.926

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
.*********************** **

14. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 2, identity: 0.926

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgctactggaccgca	Protospacer
.*********************** **

15. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

cggcgctactggtgctactggacctca	CRISPR spacer
cggagctactggtgctactggccctca	Protospacer
*** ***************** *****

16. spacer 1.39|3628961|22|NZ_CP029468|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.864

acctcaaggcattcaaggacca	CRISPR spacer
acctcaaggcattcaaggaatg	Protospacer
******************* ..

17. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

18. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

19. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

20. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

21. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

22. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

23. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

24. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

25. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

26. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

27. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

28. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

29. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

30. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

31. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

32. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

33. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

34. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

35. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

36. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

37. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*********

38. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

39. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

40. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

41. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

42. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

43. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

44. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

45. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

46. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

47. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

48. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

49. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

50. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

51. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** **********

52. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*********

53. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

54. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

55. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

56. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

57. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*********

58. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

59. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

60. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

61. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 3, identity: 0.889

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** **********

62. spacer 1.58|3627410|27|NZ_CP029468|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 3, identity: 0.889

tggtgccactggacctcagggtgttca	CRISPR spacer
aggtgacactggacctcagggtattca	Protospacer
 **** ****************.****

63. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
*********.***************

64. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgcaactggacctca	Protospacer
.**.*********** ***********

65. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
tggggcaactggtgctactggacctca	Protospacer
.** ** ********************

66. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgcaactggacctca	Protospacer
.**.*********** ***********

67. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
aggggctactggtgctactggtcctca	Protospacer
 ** ***************** *****

68. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.889

cggcgcta-ctggtgctactggacctca	CRISPR spacer
-ggcccgatctggtgctactggacctca	Protospacer
 *** * * *******************

69. spacer 1.60|3627500|27|NZ_CP029468|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 3, identity: 0.889

tggtgccactggacctcagggtgttca	CRISPR spacer
aggtgacactggacctcagggtattca	Protospacer
 **** ****************.****

70. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
cggcgctaccggtgctactggacctac	Protospacer
*********.***************

71. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgcaactggacctca	Protospacer
.**.*********** ***********

72. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
tggggcaactggtgctactggacctca	Protospacer
.** ** ********************

73. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgcaactggacctca	Protospacer
.**.*********** ***********

74. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

cggcgctactggtgctactggacctca	CRISPR spacer
aggggctactggtgctactggtcctca	Protospacer
 ** ***************** *****

75. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.889

cggcgcta-ctggtgctactggacctca	CRISPR spacer
-ggcccgatctggtgctactggacctca	Protospacer
 *** * * *******************

76. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

77. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

78. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

79. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

80. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.***

81. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

82. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

83. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

84. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

85. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.***

86. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

87. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

88. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

89. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

90. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.***

91. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

92. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

93. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

94. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

95. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.***

96. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* **********

97. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

98. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* **********

99. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

100. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

101. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

102. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

103. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

104. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

105. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

106. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

107. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

108. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

109. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

110. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

111. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

112. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

113. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

114. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

115. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

116. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

117. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

118. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

119. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

120. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

121. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

122. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

123. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

124. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

125. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

126. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

127. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

128. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

129. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

130. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

131. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.***

132. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

133. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

134. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

135. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.***

136. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.***

137. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* **********

138. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

139. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* **********

140. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

141. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

142. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

143. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

144. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

145. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

146. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

147. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

148. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

149. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

150. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

151. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

152. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

153. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

154. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

155. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

156. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

157. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

158. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

159. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

160. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

161. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

162. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

163. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

164. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

165. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

166. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

167. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

168. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** *********.

169. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** *********.

170. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** *********.

171. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** *********.

172. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** *********.

173. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* **********

174. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

175. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* **********

176. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

177. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

178. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

179. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

180. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

181. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

182. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

183. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

184. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

185. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

186. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

187. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

188. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

189. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

190. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

191. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

192. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

193. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

194. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

195. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

196. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

197. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagcaactggacctac	Protospacer
************ ** *********

198. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

199. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_020385 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-328, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

200. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

201. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

202. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctacaggtgacactggacctac	Protospacer
********* **** **********

203. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 4, identity: 0.852

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgacactgggcctac	Protospacer
************** ******.***

204. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
tggtccaactggtgctactggacctca	Protospacer
.**. * ********************

205. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
tggtccaactggtgctactggacctca	Protospacer
.**. * ********************

206. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
gggagctactggtgctactggacccga	Protospacer
 ** ********************. *

207. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
gggagctactggtgctactggacccga	Protospacer
 ** ********************. *

208. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
agggcctactggtgctactggaccaca	Protospacer
 **  ******************* **

209. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
tggatcaactggtgctactggacctca	Protospacer
.**  * ********************

210. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
tggtccaactggtgctactggacctca	Protospacer
.**. * ********************

211. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
tggtccaactggtgctactggacctca	Protospacer
.**. * ********************

212. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
gggagctactggtgctactggacccga	Protospacer
 ** ********************. *

213. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
gggagctactggtgctactggacccga	Protospacer
 ** ********************. *

214. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
agggcctactggtgctactggaccaca	Protospacer
 **  ******************* **

215. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

cggcgctactggtgctactggacctca	CRISPR spacer
tggatcaactggtgctactggacctca	Protospacer
.**  * ********************

216. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.839

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
* ****.******** ************ *

217. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.839

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
* ****.******** ************ *

218. spacer 1.38|3628907|31|NZ_CP029468|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 5, identity: 0.839

tgccactggacctcagggtgttcaaggtaac	CRISPR spacer
tgacactggacctcagggtattcaaggtcca	Protospacer
** ****************.********

219. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

220. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

221. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

222. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

223. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

224. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

225. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

226. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

227. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

228. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

229. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

230. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

231. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

232. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagacactggacccac	Protospacer
************ * *********.

233. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagacactggacccac	Protospacer
************ * *********.

234. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctactggttccactggacctac	Protospacer
.********.*** ***********

235. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

236. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

237. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

238. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

239. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.***

240. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggcctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

241. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

242. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagacactggacccac	Protospacer
************ * *********.

243. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
tggacctaccggagacactggacccac	Protospacer
************ * *********.

244. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctactggttccactggacctac	Protospacer
.********.*** ***********

245. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.**.

246. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.**.

247. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.**.

248. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgacactggacctac	Protospacer
************** ******.**.

249. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgctactggacctac	Protospacer
***************.*****.**.

250. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  **

251. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagacactggacccac	Protospacer
************ * *********.

252. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctcg	CRISPR spacer
tggacctaccggagacactggacccac	Protospacer
************ * *********.

253. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NC_004821 (Bacillus prophage phBC6A52, complete genome) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctcg	CRISPR spacer
cggacctactggttccactggacctac	Protospacer
.********.*** ***********

254. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to MH825709 (Mycobacterium phage NicoleTera, complete genome) position: , mismatch: 5, identity: 0.815

tggacctaccggtgccactggacctcg	CRISPR spacer
aggagctaccggtgccacgggaccgca	Protospacer
 *** ************* ***** *.

255. spacer 1.58|3627410|27|NZ_CP029468|CRT matches to MK798142 (Pantoea phage vB_PagM_AAM22, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcagggtgttca	CRISPR spacer
aggagccactggaccacagggtgttac	Protospacer
 ** *********** *********

256. spacer 1.58|3627410|27|NZ_CP029468|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcagggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
******.***********.****.*

257. spacer 1.58|3627410|27|NZ_CP029468|CRT matches to HQ632859 (Loktanella phage pCB2051-A genomic sequence) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcagggtgttca	CRISPR spacer
gggtgcctctggtcctcagggtgtcaa	Protospacer
 ****** **** ***********. *

258. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.*****.***************

259. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
cggtgctactggtgctactggatcaac	Protospacer
***.******************.*

260. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgatactggtcctgt	Protospacer
.************* ****** ***

261. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggatctactggtgctactggtcctct	Protospacer
.**  **************** ****

262. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgatactggtcctgt	Protospacer
.************* ****** ***

263. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggatctactggtgctactggtcctct	Protospacer
.**  **************** ****

264. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

265. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

266. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

267. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

268. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggagctactggagctactggacctac	Protospacer
.** ******** ************

269. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

270. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

271. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgatactggtcctgt	Protospacer
.************* ****** ***

272. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggagctac	Protospacer
.**.****************** **

273. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggagctac	Protospacer
.**.****************** **

274. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT197175 (Klebsiella phage VLC5, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
gggcgctactggtgctacaggagctgc	Protospacer
 ***************** *** **

275. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693241 (Marine virus AFVG_25M13, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
cgccgctactggtgctattggacgtac	Protospacer
** **************.***** *

276. spacer 1.60|3627500|27|NZ_CP029468|CRT matches to MK798142 (Pantoea phage vB_PagM_AAM22, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcagggtgttca	CRISPR spacer
aggagccactggaccacagggtgttac	Protospacer
 ** *********** *********

277. spacer 1.60|3627500|27|NZ_CP029468|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcagggtgttca	CRISPR spacer
tggtgctactggacctcaaggtgctac	Protospacer
******.***********.****.*

278. spacer 1.60|3627500|27|NZ_CP029468|CRT matches to HQ632859 (Loktanella phage pCB2051-A genomic sequence) position: , mismatch: 5, identity: 0.815

tggtgccactggacctcagggtgttca	CRISPR spacer
gggtgcctctggtcctcagggtgtcaa	Protospacer
 ****** **** ***********. *

279. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggtgctaccggtgctactggacctac	Protospacer
 **.*****.***************

280. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
cggtgctactggtgctactggatcaac	Protospacer
***.******************.*

281. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgatactggtcctgt	Protospacer
.************* ****** ***

282. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggatctactggtgctactggtcctct	Protospacer
.**  **************** ****

283. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgatactggtcctgt	Protospacer
.************* ****** ***

284. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggatctactggtgctactggtcctct	Protospacer
.**  **************** ****

285. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

286. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

287. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

288. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

289. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggagctactggagctactggacctac	Protospacer
.** ******** ************

290. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

291. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
aggagctactggagctactggacctac	Protospacer
 ** ******** ************

292. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggtgatactggtcctgt	Protospacer
.************* ****** ***

293. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggagctac	Protospacer
.**.****************** **

294. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggagctac	Protospacer
.**.****************** **

295. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT197175 (Klebsiella phage VLC5, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
gggcgctactggtgctacaggagctgc	Protospacer
 ***************** *** **

296. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693241 (Marine virus AFVG_25M13, complete genome) position: , mismatch: 5, identity: 0.815

cggcgctactggtgctactggacctca	CRISPR spacer
cgccgctactggtgctattggacgtac	Protospacer
** **************.***** *

297. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
* . ********** ***** *********.

298. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

299. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

300. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

301. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

302. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
cgctaaaggtgacaccggtgctactggtgca	Protospacer
.*.* *****.**** **************

303. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
* . ********** ***** *********.

304. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

305. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

306. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

307. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

308. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
cgctaaaggtgacaccggtgctactggtgca	Protospacer
.*.* *****.**** **************

309. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
* . ********** ***** *********.

310. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

311. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

312. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

313. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

314. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
cgctaaaggtgacaccggtgctactggtgca	Protospacer
.*.* *****.**** **************

315. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
* . ********** ***** *********.

316. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

317. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

318. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

319. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

320. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
cgctaaaggtgacaccggtgctactggtgca	Protospacer
.*.* *****.**** **************

321. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
. * ********** ***** *********.

322. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. * **.********************* *.

323. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. * **.********************* *.

324. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
. * **.******** **************.

325. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
. * **.******** **************.

326. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
. * ********** ***** *********.

327. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. * **.********************* *.

328. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. * **.********************* *.

329. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
. * **.******** **************.

330. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
. * **.******** **************.

331. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
* . ********** ***** *********.

332. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

333. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
* . **.********************* *.

334. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

335. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
* . **.******** **************.

336. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 6, identity: 0.806

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
cgctaaaggtgacaccggtgctactggtgca	Protospacer
.*.* *****.**** **************

337. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.806

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
* .***.******** ************ *

338. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

339. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

340. spacer 1.40|3626645|27|NZ_CP029468|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
gtctcctacctgtgcccctgggcctcg	Protospacer
    ****** ***** **********

341. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

342. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

343. spacer 1.41|3626690|27|NZ_CP029468|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
gtctcctacctgtgcccctgggcctcg	Protospacer
    ****** ***** **********

344. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

345. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

346. spacer 1.42|3626735|27|NZ_CP029468|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
gtctcctacctgtgcccctgggcctcg	Protospacer
    ****** ***** **********

347. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

348. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

349. spacer 1.43|3626780|27|NZ_CP029468|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
gtctcctacctgtgcccctgggcctcg	Protospacer
    ****** ***** **********

350. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

351. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

352. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

353. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 ** ***********.********

354. spacer 1.44|3626825|27|NZ_CP029468|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 ** ***********.********

355. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

356. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

357. spacer 1.45|3626870|27|NZ_CP029468|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
gtctcctacctgtgcccctgggcctcg	Protospacer
    ****** ***** **********

358. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

359. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

360. spacer 1.46|3626915|27|NZ_CP029468|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggcctcg	CRISPR spacer
gtctcctacctgtgcccctgggcctcg	Protospacer
    ****** ***** **********

361. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

362. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

363. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

364. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 ** ***********.********

365. spacer 1.47|3626960|27|NZ_CP029468|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 ** ***********.********

366. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggccccg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.**.

367. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggccccg	CRISPR spacer
cggacctaccggtgacactggacctac	Protospacer
.************* ******.**.

368. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggccccg	CRISPR spacer
tggacctaccggtgctactggcgctac	Protospacer
***************.*****  *.

369. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggccccg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

370. spacer 1.48|3627005|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactgggccccg	CRISPR spacer
aggacctaccggagacactgggccaac	Protospacer
 *********** * *********

371. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctcg	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

372. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctcg	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

373. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctcg	CRISPR spacer
cggacctaccggagacactggacccac	Protospacer
.*********** * *********.

374. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 ** ***********.********

375. spacer 1.49|3627050|27|NZ_CP029468|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

tggacctaccggtgccactggacctcg	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 ** ***********.********

376. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggcgctactggagatac	Protospacer
.***********.*********  *

377. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggcgctactggagatac	Protospacer
.***********.*********  *

378. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggatttac	Protospacer
.**.******************..*

379. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggctctactggtgctactggtcccag	Protospacer
.*** **************** **. .

380. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggatttac	Protospacer
.**.******************..*

381. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggctctactggtgctactggtcccag	Protospacer
.*** **************** **. .

382. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggatttac	Protospacer
.**.******************..*

383. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggctctactggtgctactggtcccag	Protospacer
.*** **************** **. .

384. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
cggagctactggtgctactggggcaac	Protospacer
*** *****************. *

385. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
cggagctactggtgctactggggcaac	Protospacer
*** *****************. *

386. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggagctactggtgctactggagcaac	Protospacer
.** ****************** *

387. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** ****.**************

388. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NC_047917 (Erwinia phage vB_EamP-S2, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
gggcgctactggtgctgctggaggtgc	Protospacer
 ***************.*****  *

389. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** ****.**************

390. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

391. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

392. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

393. spacer 1.59|3627455|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

394. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggcgctactggagatac	Protospacer
.***********.*********  *

395. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctactggcgctactggagatac	Protospacer
.***********.*********  *

396. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggatttac	Protospacer
.**.******************..*

397. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggctctactggtgctactggtcccag	Protospacer
.*** **************** **. .

398. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggatttac	Protospacer
.**.******************..*

399. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggctctactggtgctactggtcccag	Protospacer
.*** **************** **. .

400. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggtgctactggtgctactggatttac	Protospacer
.**.******************..*

401. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggctctactggtgctactggtcccag	Protospacer
.*** **************** **. .

402. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
cggagctactggtgctactggggcaac	Protospacer
*** *****************. *

403. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
cggagctactggtgctactggggcaac	Protospacer
*** *****************. *

404. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggagctactggtgctactggagcaac	Protospacer
.** ****************** *

405. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** ****.**************

406. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NC_047917 (Erwinia phage vB_EamP-S2, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
gggcgctactggtgctgctggaggtgc	Protospacer
 ***************.*****  *

407. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
aggccctaccggtgctactggaccagt	Protospacer
 *** ****.**************

408. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

409. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

410. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

411. spacer 1.61|3627545|27|NZ_CP029468|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

cggcgctactggtgctactggacctca	CRISPR spacer
tggcgctacgggggctactggaccatc	Protospacer
.******** ** *********** .

412. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
. .***.******** ************ *

413. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
* . **.******** ************ *

414. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

415. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

416. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

417. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

418. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

419. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

420. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
* .**************** ****.**  *.

421. spacer 1.21|3628025|31|NZ_CP029468|CRT matches to NC_014792 (Enterobacteria phage vB_EcoM-VR7, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgccactggtgcc	CRISPR spacer
cgacaaaggtgatacaggtgccactggtcca	Protospacer
** . *****.*.*************** *

422. spacer 1.21|3628025|31|NZ_CP029468|CRT matches to KP007359 (Enterobacteria phage vB_EcoM_VR5, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgccactggtgcc	CRISPR spacer
cgacaaaggtgatacaggtgccactggtcca	Protospacer
** . *****.*.*************** *

423. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
. .***.******** ************ *

424. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
* . **.******** ************ *

425. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

426. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

427. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

428. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

429. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

430. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

431. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
* .**************** ****.**  *.

432. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
. .***.******** ************ *

433. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
* . **.******** ************ *

434. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

435. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

436. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

437. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

438. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

439. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

440. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
* .**************** ****.**  *.

441. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
. .***.******** ************ *

442. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
* . **.******** ************ *

443. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

444. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

445. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

446. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

447. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

448. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

449. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
* .**************** ****.**  *.

450. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
. * **.******** ************ *

451. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

452. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

453. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

454. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

455. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
. ***************** ****.**  *.

456. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  * ********.***** ********* *

457. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  * ********.***** ********* *

458. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
. * **.******** ************ *

459. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

460. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

461. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

462. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. * **.******** ************ *.

463. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
. ***************** ****.**  *.

464. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  * ********.***** ********* *

465. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.774

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  * ********.***** ********* *

466. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
ccctcagggtaacactggtgctactggtcca	Protospacer
. .***.******** ************ *

467. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
* . **.******** ************ *

468. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

469. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

470. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

471. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

472. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
* . **.******** ************ *.

473. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
*. * *****.******* ********* *.

474. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 7, identity: 0.774

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
* .**************** ****.**  *.

475. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacaaggtaacaaaggtgatactggtgct	Protospacer
. . ********** ***** *********.

476. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. . **.********************* *.

477. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. . **.********************* *.

478. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
. . **.******** **************.

479. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 7, identity: 0.774

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccgcagggtaacactggtgctactggtgct	Protospacer
. . **.******** **************.

480. spacer 1.38|3628907|31|NZ_CP029468|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgccactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ***********.** ********** .

481. spacer 1.38|3628907|31|NZ_CP029468|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgccactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggtatt	Protospacer
  * ***********.** ********** .

482. spacer 1.38|3628907|31|NZ_CP029468|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

tgccactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ***********.** ********** .

483. spacer 1.38|3628907|31|NZ_CP029468|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

tgccactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggagttcaaggtatt	Protospacer
  * ***********.** ********** .

484. spacer 1.58|3627410|27|NZ_CP029468|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcagggtgttca	CRISPR spacer
cggcgccactggacctcagggtccggg	Protospacer
.**.****************** .  .

485. spacer 1.58|3627410|27|NZ_CP029468|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcagggtgttca	CRISPR spacer
cggcgccactggacctcagggtccggg	Protospacer
.**.****************** .  .

486. spacer 1.60|3627500|27|NZ_CP029468|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcagggtgttca	CRISPR spacer
cggcgccactggacctcagggtccggg	Protospacer
.**.****************** .  .

487. spacer 1.60|3627500|27|NZ_CP029468|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 7, identity: 0.741

tggtgccactggacctcagggtgttca	CRISPR spacer
cggcgccactggacctcagggtccggg	Protospacer
.**.****************** .  .

488. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

489. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

490. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
* * . ***** *** ************* .

491. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
**..  *********** **** ****** .

492. spacer 1.21|3628025|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgccactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. . **.**************.****** *.

493. spacer 1.21|3628025|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgccactggtgcc	CRISPR spacer
tccacagggtaacacaggtgctactggtcct	Protospacer
. . **.**************.****** *.

494. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

495. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

496. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
* * . ***** *** ************* .

497. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
**..  *********** **** ****** .

498. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

499. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

500. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
* * . ***** *** ************* .

501. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
**..  *********** **** ****** .

502. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

503. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

504. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
* * . ***** *** ************* .

505. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
**..  *********** **** ****** .

506. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 8, identity: 0.742

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
.. * *****.******* ********* *.

507. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 8, identity: 0.742

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
.. * *****.******* ********* *.

508. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
.**.  *********** **** ****** .

509. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 8, identity: 0.742

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
.. * *****.******* ********* *.

510. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 8, identity: 0.742

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
.. * *****.******* ********* *.

511. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
.**.  *********** **** ****** .

512. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

513. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

514. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
* * . ***** *** ************* .

515. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 8, identity: 0.742

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
**..  *********** **** ****** .

516. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacaccggtgctactggtcca	Protospacer
. . **.******** ************ *

517. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. . **.******** ************ *.

518. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. . **.******** ************ *.

519. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
.. * *****.******* ********* *.

520. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. . **.******** ************ *.

521. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tccacagggtaacactggtgctactggtcct	Protospacer
. . **.******** ************ *.

522. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tagtaaaggtgacacaggggctactggtcct	Protospacer
.. * *****.******* ********* *.

523. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

524. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tcctcaaggtaacacaggtcctaccgggcct	Protospacer
. .**************** ****.**  *.

525. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.742

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
accacaaggtaatacaggagctactggtcca	Protospacer
  . ********.***** ********* *

526. spacer 1.35|3628754|31|NZ_CP029468|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 8, identity: 0.742

acctcaaggcgttcaaggtaacacaggtgct	CRISPR spacer
tgaccaaggcgttcaaggtaatactggtggg	Protospacer
   .*****************.** ****

527. spacer 1.36|3628808|31|NZ_CP029468|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 8, identity: 0.742

acctcaaggcgttcaaggtaacacaggtgct	CRISPR spacer
tgaccaaggcgttcaaggtaatactggtggg	Protospacer
   .*****************.** ****

528. spacer 3.1|5122363|31|NZ_CP029468|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

529. spacer 1.15|3627701|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 9, identity: 0.71

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
*.  . ***** ***********.***** .

530. spacer 1.23|3628124|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 9, identity: 0.71

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
*.  . ***** ***********.***** .

531. spacer 1.25|3628223|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 9, identity: 0.71

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
*.  . ***** ***********.***** .

532. spacer 1.27|3628322|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 9, identity: 0.71

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
*.  . ***** ***********.***** .

533. spacer 1.31|3628547|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 9, identity: 0.71

tgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
*.  . ***** ***********.***** .

534. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 9, identity: 0.71

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
. * . ***** *** ************* .

535. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 9, identity: 0.71

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tgccacaggtaacacagttgcttctggtggt	Protospacer
.*..  *********** **** ****** .

536. spacer 1.38|3628907|31|NZ_CP029468|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 9, identity: 0.71

tgccactggacctcagggtgttcaaggtaac	CRISPR spacer
accaactggacctcaaggggttcaaggactt	Protospacer
  * ***********.** ********   .

537. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812210 (Flavobacterium phage vB_FspS_hemulen9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

538. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812215 (Flavobacterium phage vB_FspS_lillamy9-4, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

539. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812216 (Flavobacterium phage vB_FspS_lillamy9-5, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

540. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NC_048835 (Flavobacterium phage vB_FspS_lillamy9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

541. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812213 (Flavobacterium phage vB_FspS_lillamy9-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

542. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812230 (Flavobacterium phage vB_FspS_sniff9-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

543. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812209 (Flavobacterium phage vB_FspS_hemulen6-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

544. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812218 (Flavobacterium phage vB_FspS_lillamy9-7, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

545. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812233 (Flavobacterium phage vB_FspS_snork9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

546. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812219 (Flavobacterium phage vB_FspS_morran9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

547. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812217 (Flavobacterium phage vB_FspS_lillamy9-6, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

548. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NC_048840 (Flavobacterium phage vB_FspS_snork6-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

549. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NC_048839 (Flavobacterium phage vB_FspS_sniff9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

550. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NC_048842 (Flavobacterium phage vB_FspS_stinky9-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

551. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812232 (Flavobacterium phage vB_FspS_snork6-2, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

552. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to MN812208 (Flavobacterium phage vB_FspS_hemulen6-1, complete genome) position: , mismatch: 9, identity: 0.735

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
ttcggcttctgttttattttctggttgcgatatt	Protospacer
.*.* ***********.********* **   *.

553. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 10, identity: 0.677

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
..  . ***** ***********.***** .

554. spacer 1.28|3628376|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 10, identity: 0.677

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
. . . ***** *** ************* .

555. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 10, identity: 0.677

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
..  . ***** ***********.***** .

556. spacer 1.29|3628430|31|NZ_CP029468|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 10, identity: 0.677

cgctcaaggtaacacaggtgctactggtgcc	CRISPR spacer
tttattaggtaccactggtgctactggtgat	Protospacer
. . . ***** *** ************* .

557. spacer 1.32|3628601|31|NZ_CP029468|CRT matches to KM262192 (Leuconostoc phage Ln-9, complete genome) position: , mismatch: 10, identity: 0.677

cgttcaaggtaacacaggtgctactggtgcc	CRISPR spacer
taaatcaggtatcacaggtgctattggtggt	Protospacer
..  . ***** ***********.***** .

558. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

559. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

560. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

561. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

562. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

563. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

564. spacer 3.2|5122417|34|NZ_CP029468|CRISPRCasFinder matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

cttgtcttctgttttactttctggtttcgtgctc	CRISPR spacer
tatgtcttctgtttttgtttctggttccccagct	Protospacer
. *************  *********.* .. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

257937 : 265885

uncultured_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917311.1\|257937_258222_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_025710422.1\|258260_259895_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.2e-157	58.0
WP_164876608.1\|260298_261840_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.9e-22	31.7
WP_000833082.1\|262224_263550_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.4e-45	30.1
WP_000929885.1\|263694_264396_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000719205.1\|264379_265885_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	5.4e-32	30.3

DBSCAN-SWA_2

311458 : 319834

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|311458_312766_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170544.1\|312854_313574_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000278823.1\|313566_313821_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666786.1\|313817_314501_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055562.1\|314484_316704_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.6e-163	41.2
WP_000879025.1\|316688_318104_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_001262439.1\|318209_319250_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
WP_000088594.1\|319246_319834_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4

DBSCAN-SWA_3

726745 : 734897

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171009799.1\|726745_727729_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	1.4e-17	29.9
WP_000085783.1\|727793_728315_+	dihydrofolate reductase	NA	NA	NA	NA
WP_006918010.1\|728480_729872_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.1e-31	29.2
WP_006918011.1\|729883_730561_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-32	35.6
WP_000738879.1\|730736_731984_+	hypothetical protein	NA	NA	NA	NA
WP_000277056.1\|732117_732648_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	2.5e-16	34.3
WP_025710086.1\|732660_733005_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	4.2e-41	77.2
WP_025710085.1\|733445_734897_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	9.8e-140	54.0

DBSCAN-SWA_4

1927353 : 1935455

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006929130.1\|1927353_1928643_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.3e-13	32.3
WP_001194306.1\|1928742_1929507_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_025710348.1\|1929747_1931508_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-273	98.2
WP_025710347.1\|1931592_1932270_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.3e-122	98.7
WP_033695257.1\|1932266_1933346_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	8.0e-187	98.0
WP_000818985.1\|1933573_1934293_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_001258539.1\|1934582_1935455_+	aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	2.8e-65	44.4

DBSCAN-SWA_5

3607993 : 3618147

Bacillus_phage(45.45%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000413738.1\|3607993_3608614_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
WP_000976237.1\|3608704_3609508_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000031387.1\|3609508_3610051_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_001102628.1\|3610043_3610367_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000392444.1\|3610738_3610969_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.5e-23	73.7
WP_000405767.1\|3611030_3611927_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A0S2MVR5	Bacillus_phage	4.1e-80	52.4
WP_088859613.1\|3612200_3613043_-	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	6.1e-33	47.7
WP_167913535.1\|3613160_3614147_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.7e-34	43.9
WP_025710429.1\|3614385_3614772_-	DUF1492 domain-containing protein	A0A288WG73	Bacillus_phage	2.6e-47	71.4
WP_025710428.1\|3614890_3615763_-	DnaD domain protein	A0A2H4J394	uncultured_Caudovirales_phage	1.8e-96	65.6
WP_001189064.1\|3615911_3616106_-	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	5.9e-16	71.0
WP_025710427.1\|3616117_3616876_-	ORF6C domain-containing protein	A0A2H4JBC7	uncultured_Caudovirales_phage	3.2e-97	69.4
WP_000283430.1\|3617071_3617284_-	hypothetical protein	A6M975	Geobacillus_virus	1.6e-11	63.0
WP_033695267.1\|3617487_3618147_+	helix-turn-helix domain-containing protein	A0A2H4J441	uncultured_Caudovirales_phage	3.3e-34	41.0

DBSCAN-SWA_6

4405060 : 4412746

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221064.1\|4405060_4405984_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.0e-46	44.0
WP_000247679.1\|4406109_4407045_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.1e-22	25.3
WP_000018029.1\|4407046_4407739_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_001293578.1\|4407907_4408081_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|4408081_4408276_+	YwbE family protein	NA	NA	NA	NA
WP_001255971.1\|4408314_4409514_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.6e-71	41.2
WP_000587820.1\|4409809_4410133_+	heme oxygenase	NA	NA	NA	NA
WP_001086122.1\|4410205_4410970_-	class B sortase	NA	NA	NA	NA
WP_025709899.1\|4411002_4411773_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	27.4
WP_001036848.1\|4411762_4412746_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.1e-17	27.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP029468

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection