CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040515	Bacillus paranthracis strain PR1 chromosome, complete genome	3 crisprs	cas14k,DEDDh,csa3,cas3,RT,WYL,cas14j,c2c9_V-U4,DinG	22	22	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040515_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040515_1

851932-852039

Orphan

Consensus_repeat	Method
GATATATTTAAAAAATCGCTGATATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040515_1

>merge|NZ_CP040515|1|851932-852039|CRISPRCasFinder
GATATATTTAAAAAATCGCTGATATATTTCGAGTTGTGGTCGATATATTTAGAAAATCGCTGATATATTTCGAGTTGTGATTGATATATTCAAAAAATCGCTGATATA

>NZ_CP040515|1|1|851932-852039|CRISPRCasFinder
GATATATTTAAAAAATCGCTGATATA	TTTCGAGTTGTGGTCGATATATTTAGAAAATCGCTGATATATTTCGAGTTGTGATT
GATATATTCAAAAAATCGCTGATATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040515.1\|WP_041184254.1\|853370_853733_-\|DUF4288-domain-containing-protein	unknown	unknown	gnl\|CDD\|379479
NZ_CP040515.1\|WP_000738019.1\|850709_851726_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227188
NZ_CP040515.1\|WP_138320966.1\|847782_847965_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_001998456.1\|849708_850266_+\|DUF948-domain-containing-protein	unknown	unknown	gnl\|CDD\|227109
NZ_CP040515.1\|WP_138320960.1\|846268_846817_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP040515.1\|WP_138320964.1\|847381_847786_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369049
NZ_CP040515.1\|WP_138320970.1\|853734_853971_-\|DUF3949-domain-containing-protein	unknown	unknown	gnl\|CDD\|315735
NZ_CP040515.1\|WP_001971083.1\|845788_846133_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP040515.1\|WP_138320972.1\|854051_854348_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_138320963.1\|846813_847305_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP040515.1\|WP_138320968.1\|852337_853336_+\|catabolite-control-protein-A	unknown	unknown	gnl\|CDD\|130546
NZ_CP040515.1\|WP_001982862.1\|858642_859332_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP040515.1\|WP_001039704.1\|855350_856277_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP040515.1\|WP_044790868.1\|857186_858641_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP040515.1\|WP_044790867.1\|856356_857037_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP040515.1\|WP_044790863.1\|847980_848415_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_044790864.1\|850265_850592_+\|bacillithiol-system-redox-active-protein-YtxJ	unknown	unknown	gnl\|CDD\|378538
NZ_CP040515.1\|WP_138320974.1\|854823_855222_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|184416
NZ_CP040515.1\|WP_000636591.1\|854500_854773_+\|DUF3917-domain-containing-protein	unknown	unknown	gnl\|CDD\|372449
NZ_CP040515.1\|WP_000654739.1\|848450_849566_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|225191

Protein	Function_ID	Function_description	E-value
NZ_CP040515.1\|WP_041184254.1\|853370_853733_-\|DUF4288-domain-containing-protein	gnl\|CDD\|379479	pfam14119, DUF4288, Domain of unknown function (DUF4288). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.	1.36004e-19
NZ_CP040515.1\|WP_000738019.1\|850709_851726_+\|hypothetical-protein	gnl\|CDD\|227188	COG4851, CamS, Protein involved in sex pheromone biosynthesis [General function prediction only].	1.2061e-64
NZ_CP040515.1\|WP_000636591.1\|854500_854773_+\|DUF3917-domain-containing-protein	gnl\|CDD\|372449	pfam13055, DUF3917, Protein of unknown function (DUF3917). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.26871e-23
NZ_CP040515.1\|WP_001998456.1\|849708_850266_+\|DUF948-domain-containing-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	4.44562e-36
NZ_CP040515.1\|WP_138320960.1\|846268_846817_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.64174e-27
NZ_CP040515.1\|WP_138320964.1\|847381_847786_+\|PH-domain-containing-protein	gnl\|CDD\|369049	pfam06713, bPH_4, Bacterial PH domain. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown. Members of this family have a PH domain like structure.	1.54151e-10
NZ_CP040515.1\|WP_138320970.1\|853734_853971_-\|DUF3949-domain-containing-protein	gnl\|CDD\|315735	pfam13133, DUF3949, Protein of unknown function (DUF3949). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 69 and 87 amino acids in length.	3.82267e-25
NZ_CP040515.1\|WP_001971083.1\|845788_846133_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	8.21676e-25
NZ_CP040515.1\|WP_001039704.1\|855350_856277_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	2.32362e-50
NZ_CP040515.1\|WP_138320963.1\|846813_847305_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.92213e-17
NZ_CP040515.1\|WP_138320968.1\|852337_853336_+\|catabolite-control-protein-A	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	0
NZ_CP040515.1\|WP_001982862.1\|858642_859332_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29328e-84
NZ_CP040515.1\|WP_044790868.1\|857186_858641_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	2.71e-62
NZ_CP040515.1\|WP_044790867.1\|856356_857037_-\|hypothetical-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	3.49988e-25
NZ_CP040515.1\|WP_044790864.1\|850265_850592_+\|bacillithiol-system-redox-active-protein-YtxJ	gnl\|CDD\|378538	pfam11009, DUF2847, Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed.	3.59109e-47
NZ_CP040515.1\|WP_138320974.1\|854823_855222_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|184416	PRK13955, mscL, large conductance mechanosensitive channel protein MscL.	9.69525e-76
NZ_CP040515.1\|WP_000654739.1\|848450_849566_-\|aminopeptidase	gnl\|CDD\|225191	COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism].	2.90365e-128

>NZ_CP040515.1|WP_000738019.1|850709_851726_+|hypothetical-protein
MKKMALSFAVVSLLLGACSNDTISKKDEVIQKDTKEKSMIPRTAVSKDYYRTVIPLKEQKVINTANVKTNSKLDLAEYENGLMNIAKEQFDTENHVLQLNQYIPEKLVDELVAKVEAPVLTNIIEQDYFGKQNSNELSLSGVVIGLAMSSSVSNEEAMSKGTEVAKQLIEAIHKNDKYNKSPITFAIFKQESTSSLKNGTYIASATVQKNDTNLGNWNAIEEKAYSYPSDEFTQAHGEDNEKINKFAEAMKGFSPGDFIPVNAKVSYKKNQMDTLNMDIVIKYNGKTELMALTQLAAQSMLDQLPKDAKVQLQIKSENKIEAIVIKEKNSDKPFVSFL
>NZ_CP040515.1|WP_044790864.1|850265_850592_+|bacillithiol-system-redox-active-protein-YtxJ
MNMTKLETIEEFEVLVEKNEPYVLFKHSTTCPISHGAYTEFQAYCSEERAVPAYYLYVQDARDVSNRVAEQYSMKHESPQVLYIKDGMVVWNTSHWNIKKDVLEENIK
>NZ_CP040515.1|WP_001998456.1|849708_850266_+|DUF948-domain-containing-protein
MYNRGKYEKDKGSDEMQVLLYVSAAIIAVAFAVLVVYVCRTLLSVQKTLENVASTLEGLEKQMQGISVETEQLLHKTNALADDIQQKSQSLNKVVSGVDGIGTTIHSLNTKLRNVSESVTDEIENNADKVAQVVQWSSAAIEVYNHYRATRQEKKVEKEERKLERLEKKAEKKEKRSRLRMRGES
>NZ_CP040515.1|WP_000654739.1|848450_849566_-|aminopeptidase
MKDPRIEKLAYNLINYSIRLQKGEKVLIENFGLQKELVTALVKEAYAAGGFPFVSLKDHQVDRSLLMGATEEHFEQIAAYEASVMKDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDIRVPKTRWVVLRYPNASMAQLAKMSTEAFEDFYFEVCNLDYGKMDKAMDSLVTLMNKTDKVRLTGPGTDLTFSIKDIPAIKCSGHLNIPDGEVYSAPVRDSVNGTVSYNTPSPYNGYTFENVQLKFENGQIVEATANDTERINKIFDTDEGARYVGEFAIGVNPYILHPMGDILFDEKIDGSFHFTPGQAYDDAWNGNNSNIHWDLVCIQRPEYGGGEIYFDDVLIRKDGRFVVPELEALNPENLK
>NZ_CP040515.1|WP_044790863.1|847980_848415_+|hypothetical-protein
MKKVLMLFVFLLTASFLLLGCSTKKEKTNLNLEKAQKVEIESLTDSSEKKVITDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTPKLSESSKDKKELHEIGTMTVYQDVPYVEVEMKNKKMSFKVPEDVAKDLLKY
>NZ_CP040515.1|WP_138320966.1|847782_847965_+|hypothetical-protein
MKYVKPLFCLEILLVIVICTRGYMKWDLPLYVPILIGTVAVVLLYYFHFQQTKGEKSSSI
>NZ_CP040515.1|WP_138320964.1|847381_847786_+|PH-domain-containing-protein
MNFPIQRSKSVVIFVCLTLAFMFVYPLVMIIANKEQWMTALIGMGLCFLVNVPLVWEVFIKKHKVENGVLKYGVLNGDIVLKEIRIIRQVGKSLEITTNAYKVHMIAMPQHMTEFLALIEKENPNVKIEMAGKK
>NZ_CP040515.1|WP_138320963.1|846813_847305_+|GNAT-family-N-acetyltransferase
MNEKIRIIPYESTFQDEVVDLIVHIQKKEYNVPITKEEQPDLLEIETFYQRNHGNFWVAIYDGKVVGTVALLDIGNHQVALRKMFVKKEFRGKEWGASHKLLQTAISWAKNKKLKDIYLGTTVKFLAAHRFYEKNGFQSVDIEDLPKSFPVLQVDKKFYRYIV
>NZ_CP040515.1|WP_138320960.1|846268_846817_+|GNAT-family-N-acetyltransferase
MFTLRVDDEIELQLLEKYHKEELYQLIDQNRNHLRRWLPWVDGTKSADAYNEICPMWLKKFAEGDGFESGIRYKGKLVGMVGIHPVSWGKKAASLGYYLAEDAGGKGIMTRSVKAVLHYAFENLKLNKMEIRCGVENVKSRAIPERLGFKLDGVLRDEEWLYDHFHDLAVYSLLASEWKEIR
>NZ_CP040515.1|WP_001971083.1|845788_846133_-|PadR-family-transcriptional-regulator
MEKNDNFIIQLRKGVFDLAILSLIGKQPMYGYEITSALQEIPVFHIPNGSIYPILNRITKNNWAVSYWEESGDGPKRKYYRITDEGREILHNRLHDYDAVYQALMLLAKGEDKK
>NZ_CP040515.1|WP_138320968.1|852337_853336_+|catabolite-control-protein-A
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKTTTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGIVFMGEDITDIHAEEFKKSPVPIVLAASFDEQNETPSVNIDYTQAAYDAMKHFIEQGHKRIGFVSGPFIDKAGSAKKLQGYRKALEEAGISYDENLVIDGDYTYDSGIEAFEKLWSLDEKPTAIFVSSDEMALGVIHAAQDTGLNVPIDVEVLGFDNTRLALMVRPQLSTVVQPMYDIGAVAMRLLTKYMNKEKVEDHTVILPHRIQFRDSTK
>NZ_CP040515.1|WP_041184254.1|853370_853733_-|DUF4288-domain-containing-protein
MYAVKLLFESVHSGEPNPTKMDEDYEKDCDTLFEESIILVKASSLEEAHALGEQIAIQSEHTYDNMYGEQVTWTFRKLLHVFELDETPFETGKELYARFLHVKKNETVNTVVKAYYPEYE
>NZ_CP040515.1|WP_138320970.1|853734_853971_-|DUF3949-domain-containing-protein
MFWISLIVLAYFIILVPIQYNYIKILKEKQKKMNMSQNELYDNMSYEESQIHYHYQSNVFTIPASLVASIIYRVKHAA
>NZ_CP040515.1|WP_138320972.1|854051_854348_-|hypothetical-protein
MEEDIVGYFKQVEKFDYITIDLDKKFFYMEIVQLETNITLLKISLNLNKDETIVQGKTEHYDPYRLEQLIQSFKHTAQTCIEHNLRSPEELFAFWKGN
>NZ_CP040515.1|WP_000636591.1|854500_854773_+|DUF3917-domain-containing-protein
MIVLWIITLCMTAIFAYMTLKQNGLKRFVPGSILAGIALITYVISIFIESVSVDMSTSLMFIGITLFASSIMVLMVAGIILFIHMNSETL
>NZ_CP040515.1|WP_138320974.1|854823_855222_-|large-conductance-mechanosensitive-channel-protein-MscL
MWNEFKKFAFKGNVVDLAVGVVIGAAFGKIVSSLVKDVITPLLGMVLGGVDFTDLKLTFGKSSIMYGNFIQTIFDFLIIAAAIFMFVKVFNKLTSKKEEEKEEEIPESTKEEELLSEIRDLLKQQNSSKDRA
>NZ_CP040515.1|WP_001039704.1|855350_856277_-|Gfo/Idh/MocA-family-oxidoreductase
MNKPKIGMIGLGSIAQKAYLPTLTKETDWNFVGAFTPNAEKRKQVCQQYRIQDFHSIETLASECDAIFVHSSTASHYEIVSKLLKKGIDVYVDKPLAATVEQAEKLVELSEKYNRKLMVGFNRRFVPMYVAAKEQAHNISWIRIEKHRTNKVGPYTYDFTMLDDYLHIVDTARWLANDELNVVHNMMQINEKNELLYGHHTYTTANGMLLSTAMHRHAGTNLEQIELVTTGKIIRVKNMNTFEVEQENAVSQIGSPSWDTTLKQRGFEDAVHHFIACVQGDTKPVVDGLEGLKTQQLLQSLLDATSKN
>NZ_CP040515.1|WP_044790867.1|856356_857037_-|hypothetical-protein
MFKKTVSMICCVFFLQGCLQEQEVKKEMTNMETALLTATEKQETNTVISLLKKGADINITDNKGRTPLMIATYKNDVKTAKALIDAGADVNIQDDMKNNPFLYAGAEGYLDILKLTIDAGADPSLTNRYGGTALTPASEHGYIDVIKELLTRTNIDVNHVNNLGWTALMEAIVLSNGNETQQQVIRLLIEHGADVNIPDNDGVTPLEHARAHHFEEIEKILLEEHK
>NZ_CP040515.1|WP_044790868.1|857186_858641_+|HAMP-domain-containing-histidine-kinase
MSIKTRFLFSYIAVILVSITLILIAGFLIVFSITGDLEAVKNFYKSSYIQKPLTSEEENAYIELKTAAKKHQSQLLDESFVSSLEKEGVKIVVRKGETISYATKVFESGALKEALPKFESANINSRGTTELGDTFYRYVKFDFYFPQEEEGSIFVLKKQSSFVDLTQKLFPILFVSLLLLAILLIGLLSYLVSRSVIKPIFVLKDATEKIKEGNLDFQIPVTSHDEIGQLNQGFEEMRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLTTIHTKARHMDTLIDELFLFSKLDLNRVPFQFETVELNMFMQELIEEMQMDLSKEGIEVNLQLHASPLYVKADCEKINRVISNLIHNSVKYMDKEEKKITVTVSSDNNKVIVKVMDNGSGIESDTLPYIFERFYRAEKSRNSSTGGSGLGLAIAKQIIEEHGGNIWAESELGEGTSIFFSLEKVEKCGE
>NZ_CP040515.1|WP_001982862.1|858642_859332_+|response-regulator-transcription-factor
MKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQMALQEDYDLIILDIMLPKMNGFEICKQIRAIKDIPILLVSAKKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHISRYERLLGNVSKQRDTLYIHGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040515_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040515_2

1825595-1827016

Orphan

Consensus_repeat	Method
NAGNNCCAGTAGCNCCNG	CRT

31 spacers

The CRISPR arrays of NZ_CP040515_2

>merge|NZ_CP040515|2|1825595-1827016|CRT
GAGGTCCAGTGGCACCAGTAGCGCCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCCTGGACGCCTTGAGGTCCAGTAGCACCAGTAGCGCCTGTGTTACCTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTGGCACCGGTAGCGCCCGCCGGCCCTTGAGCACCTTGAGGTCCAGTAGCGCCGGTAGCACCCGTGTTACCTTGAGCACCCTGAGGTCCAGTGGCGCCGGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCCTGGACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCAGTAGCGCCTGTGTTACCTTGAGGCCCTTGAGGCCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCCTGGACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCAGTAGCGCCTGTGTTACCTTGAGGCCCTTGAGGCCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCCTGGACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCAGTAGCGCCGGTAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCAGTAGCGCCGGTAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCAGTGGCACCAGTAGCGCCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCACCAGTAGCACCTGCTGGTCCTTGAACGCCTTGAGGTCCAGTAGCACCGGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCCTGGACGCCTTGAGGTCCAGTAGCACCAGTAGCACCCGCCGGCCCTTGAACGCCTTGAGGTCCAGTAGCACCAGTAGCACCTGCTGGTCCTTGGACGCCTTGAGGTCCAGTAGCACCAGTAGCACCCGCCGGTCCTTGGACGCCTTGAGGTCCAGTAGCACCAGTAGCACCCGCCGGTCCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCACCCGCCGGTCCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCCGCCGGCCCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCACCCGCCGGTCCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCACCAGTAGCACCTGCTGGTCCTTGGACGCCTTGAGATCCAGTGGCACCAGTAGCACCCG

>NZ_CP040515|2|1|1825595-1827016|CRT
GAGGTCCAGTGGCACCAG	TAGCGCCTGTGTTACCTTGAACGCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCTGCTGGTCCTTGAACGCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCTGCTGGTCCCTGGACGCCTT
GAGGTCCAGTAGCACCAG	TAGCGCCTGTGTTACCTTGAGCACCTT
GAGGTCCAGTGGCACCAG	TAGCACCCGTGTTACCTTGAACGCCTT
GAGGTCCAGTGGCACCGG	TAGCGCCCGCCGGCCCTTGAGCACCTT
GAGGTCCAGTAGCGCCGG	TAGCACCCGTGTTACCTTGAGCACCCT
GAGGTCCAGTGGCGCCGG	TAGCACCCGTGTTACCTTGAACGCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCTGCTGGTCCCTGGACGCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCCGCCGGTCCTTGAATACCTT
GAGGTCCAGTAGCGCCTG	TGTTACCTTGAGGCCCTTGAGGCCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCTGCTGGTCCCTGGACGCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCCGCCGGTCCTTGAATACCTT
GAGGTCCAGTAGCGCCTG	TGTTACCTTGAGGCCCTTGAGGCCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCTGCTGGTCCCTGGACGCCTT
GAGGTCCAGTAGCGCCGG	TAGCACCCGCCGGTCCTTGAATACCTT
GAGGTCCAGTAGCGCCGG	TAGCACCCGCCGGTCCTTGAATACCTT
GAGGTCCAGTAGCGCCGG	TAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCAG
TGGCACCAGTAGCGCCTG	TGTTACCTTGAACGCCTTGAGGTCCAG
TAGCACCAGTAGCACCTG	CTGGTCCTTGAACGCCTTGAGGTCCAG
TAGCACCGGTAGCACCCG	TGTTACCTTGAACGCCTTGAGGTCCAG
TAGCGCCGGTAGCACCTG	CTGGTCCCTGGACGCCTTGAGGTCCAG
TAGCACCAGTAGCACCCG	CCGGCCCTTGAACGCCTTGAGGTCCAG
TAGCACCAGTAGCACCTG	CTGGTCCTTGGACGCCTTGAGGTCCAG
TAGCACCAGTAGCACCCG	CCGGTCCTTGGACGCCTTGAGGTCCAG
TAGCACCAGTAGCACCCG	CCGGTCCTTGAACGCCTTGAGGTCCAG
TGGCACCAGTAGCACCCG	CCGGTCCTTGAACGCCTTGAGGTCCAG
TAGCGCCGGTAGCACCCG	CCGGCCCTTGAACGCCTTGAGGTCCAG
TGGCACCAGTAGCACCCG	CCGGTCCTTGAACGCCTTGAGGTCCAG
TGGCACCAGTAGCACCCG	TGTTACCTTGAACGCCTT
GAGGTCCAGTAGCACCAG	TAGCACCTGCTGGTCCTTGGACGCCTTGAGATCCAG
TGGCACCAGTAGCACCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040515.1\|WP_000135327.1\|1834409_1835744_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP040515.1\|WP_070806710.1\|1836437_1836980_+\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NZ_CP040515.1\|WP_000813896.1\|1824618_1824843_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP040515.1\|WP_000312265.1\|1830541_1831165_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP040515.1\|WP_138321301.1\|1836980_1837787_+\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NZ_CP040515.1\|WP_000656783.1\|1833971_1834361_+\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP040515.1\|WP_000228316.1\|1816358_1816901_+\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP040515.1\|WP_000734631.1\|1822221_1823154_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP040515.1\|WP_000504949.1\|1823643_1824597_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP040515.1\|WP_000391391.1\|1831257_1832532_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP040515.1\|WP_000957269.1\|1818339_1819092_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP040515.1\|WP_130983681.1\|1815702_1816041_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_000704628.1\|1820013_1821873_+\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP040515.1\|WP_001102620.1\|1836121_1836445_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP040515.1\|WP_001179082.1\|1817018_1818182_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP040515.1\|WP_000438181.1\|1829298_1830255_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP040515.1\|WP_138321299.1\|1828219_1829185_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP040515.1\|WP_000640767.1\|1819088_1820000_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP040515.1\|WP_000814415.1\|1823216_1823462_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_000460298.1\|1832524_1833796_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036

Protein	Function_ID	Function_description	E-value
NZ_CP040515.1\|WP_070806710.1\|1836437_1836980_+\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	1.05392e-84
NZ_CP040515.1\|WP_138321301.1\|1836980_1837787_+\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	3.3902e-17
NZ_CP040515.1\|WP_000813896.1\|1824618_1824843_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP040515.1\|WP_000504949.1\|1823643_1824597_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.63015e-167
NZ_CP040515.1\|WP_000656783.1\|1833971_1834361_+\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP040515.1\|WP_000228316.1\|1816358_1816901_+\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP040515.1\|WP_000734631.1\|1822221_1823154_+\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	4.8335e-36
NZ_CP040515.1\|WP_000438181.1\|1829298_1830255_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	9.60567e-156
NZ_CP040515.1\|WP_000391391.1\|1831257_1832532_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP040515.1\|WP_000957269.1\|1818339_1819092_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	4.29645e-81
NZ_CP040515.1\|WP_000135327.1\|1834409_1835744_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP040515.1\|WP_001179082.1\|1817018_1818182_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP040515.1\|WP_000704628.1\|1820013_1821873_+\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	3.16528e-142
NZ_CP040515.1\|WP_001102620.1\|1836121_1836445_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.56565e-24
NZ_CP040515.1\|WP_000312265.1\|1830541_1831165_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	7.95315e-60
NZ_CP040515.1\|WP_138321299.1\|1828219_1829185_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	1.18024e-12
NZ_CP040515.1\|WP_000640767.1\|1819088_1820000_+\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	6.01496e-144
NZ_CP040515.1\|WP_000460298.1\|1832524_1833796_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0

>NZ_CP040515.1|WP_000813896.1|1824618_1824843_+|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP040515.1|WP_000504949.1|1823643_1824597_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDASDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP040515.1|WP_000814415.1|1823216_1823462_-|hypothetical-protein
MKQSTINFSSLTKDLILATATKEHNCSQEELYFALNCLLRSFHSALQETTLHLENKDTEYIQNQFCSAYKIITGKTIYPFQ
>NZ_CP040515.1|WP_000734631.1|1822221_1823154_+|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVVNTENGWTKIKLNGQEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKTGYVHVPFLTGTAPVIEKKEVATKEEAPERVNTPVKSNKVAKSKESVKNVESSKPVAKQQSTTKQVAKSNETSAPTSGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP040515.1|WP_000704628.1|1820013_1821873_+|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEEVEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGVKEDGKAENTEKENGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKKLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAKNFGVHSAVMAGGMVPPLAIALATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP040515.1|WP_000640767.1|1819088_1820000_+|1-phosphofructokinase
MIYTVTLNPSIDYIVQVNSLELGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFIQVNEDTRINVKIKGKEETELNGQGPSVTKEQFEQLMKQIESMQKGDCVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATIPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVTKR
>NZ_CP040515.1|WP_000957269.1|1818339_1819092_+|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLVNKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGAHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP040515.1|WP_001179082.1|1817018_1818182_+|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFANEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPLHTASVPRDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVETDGKTDREIALEGIEALRQFWTSIEAPVKLSDYAIGENEIDLMADKAMANGEFGNFKKLNKDDVLSIYKASL
>NZ_CP040515.1|WP_000228316.1|1816358_1816901_+|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP040515.1|WP_130983681.1|1815702_1816041_+|hypothetical-protein
MVKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVFFFMIRFITAIVKKKESDDEECHSTCNIANVF
>NZ_CP040515.1|WP_138321299.1|1828219_1829185_-|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLTNEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIIKETPESEIIKLAGFKSKISLKRYYQYAENRKNALS
>NZ_CP040515.1|WP_000438181.1|1829298_1830255_+|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLIGISSSDLMLEEETHST
>NZ_CP040515.1|WP_000312265.1|1830541_1831165_-|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRADVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP040515.1|WP_000391391.1|1831257_1832532_+|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRARVDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADIILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEENDLLHIKEAIETKMKEEMNCYQVKIPPSEGKLLTLLKTETLLTKMEFLEEKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP040515.1|WP_000460298.1|1832524_1833796_+|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDFRAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP040515.1|WP_000656783.1|1833971_1834361_+|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP040515.1|WP_000135327.1|1834409_1835744_+|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISKALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP040515.1|WP_001102620.1|1836121_1836445_+|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQLNLLVTEWRDFAKGVQEIIEGVEWDE
>NZ_CP040515.1|WP_070806710.1|1836437_1836980_+|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKTESEIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLFAIIAFIFSFWVGGIASVVTPFFVIGKVFMGTFIWLDLFVGITFVGVGLLLCIIAYYSTKWFKKLCVRYVIWNFKMIKGE
>NZ_CP040515.1|WP_138321301.1|1836980_1837787_+|DUF4097-family-beta-strand-repeat-protein
MMKKILLAAIACIIIGVIGISQTYEKAVQAAEEGNKEDKIKNETLKNIEVKLDVGDIVVQKSPDASFYVKQSGDARKQEIRITEDGDTLKIIGEREKDASFDFSFYDFRFQTSTLTLLVPERSYQDVKVNSSAGQIEISDVKSDRVRARTLTGEVDLKHVTAKNVEGSTKAGEVNFKKVIGKVTAKTTSGEINILDHDSKYNLEASSTAGDINITLSEKPKDAVITGQSAAGDVTIFNEENKDVTIGNGSKKISGKTAAGDVTIETRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040515_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040515_3

4078266-4078521

Orphan

Consensus_repeat	Method
TTCTCATGCGGAAGGTAAACATACA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP040515_3

>merge|NZ_CP040515|3|4078266-4078521|CRISPRCasFinder
CTCTCATGCAGAGGGTACAGCTTCACATGCAGAAGGACTTCTGACACATGCAAAAGGTTCTTTCTCTCATGCAGAAGGATCAAAAACGAAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCCTATTCTCATGCGGAAGGTAAACATACAATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTCTTCTCATGCGGAAGGTAATCATACA

>NZ_CP040515|3|2|4078266-4078521|CRISPRCasFinder
CTCTCATGCAGAGGGTACAGCTTCA	CATGCAGAAGGACTTCTGACACATGCAAAAGGTTCTTT
CTCTCATGCAGAAGGATCAAAAACG	AAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCCTA
TTCTCATGCGGAAGGTAAACATACA	ATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTC
TTCTCATGCGGAAGGTAATCATACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040515.1\|WP_138322316.1\|4073763_4074522_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP040515.1\|WP_138322315.1\|4071807_4072659_+\|exosporium-leader-peptide-containing-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP040515.1\|WP_138322317.1\|4075606_4076767_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP040515.1\|WP_001180003.1\|4081611_4081983_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_138322319.1\|4086576_4087821_-\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP040515.1\|WP_001087868.1\|4069700_4070390_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369778
NZ_CP040515.1\|WP_000673184.1\|4080126_4080924_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP040515.1\|WP_014481609.1\|4079217_4080111_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP040515.1\|WP_044792727.1\|4074528_4075464_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|366154
NZ_CP040515.1\|WP_000191107.1\|4082129_4082708_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP040515.1\|WP_000932905.1\|4070541_4071642_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP040515.1\|WP_000043380.1\|4082888_4083287_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP040515.1\|WP_000360653.1\|4083286_4084180_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP040515.1\|WP_000651514.1\|4068324_4069005_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP040515.1\|WP_000003388.1\|4084699_4086526_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP040515.1\|WP_000872679.1\|4076841_4077582_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP040515.1\|WP_001271197.1\|4069017_4069704_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP040515.1\|WP_000428851.1\|4072781_4073627_+\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP040515.1\|WP_041184086.1\|4084409_4084583_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040515.1\|WP_001081482.1\|4080942_4081581_-\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232

Protein	Function_ID	Function_description	E-value
NZ_CP040515.1\|WP_138322316.1\|4073763_4074522_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.02976e-19
NZ_CP040515.1\|WP_138322315.1\|4071807_4072659_+\|exosporium-leader-peptide-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	8.51405e-15
NZ_CP040515.1\|WP_138322317.1\|4075606_4076767_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	8.11684e-100
NZ_CP040515.1\|WP_138322319.1\|4086576_4087821_-\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	1.58057e-55
NZ_CP040515.1\|WP_001087868.1\|4069700_4070390_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.42999e-18
NZ_CP040515.1\|WP_000673184.1\|4080126_4080924_-\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP040515.1\|WP_014481609.1\|4079217_4080111_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.21769e-98
NZ_CP040515.1\|WP_044792727.1\|4074528_4075464_+\|glycosyltransferase	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.68181e-21
NZ_CP040515.1\|WP_000191107.1\|4082129_4082708_+\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	4.31773e-82
NZ_CP040515.1\|WP_000932905.1\|4070541_4071642_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.46271e-52
NZ_CP040515.1\|WP_000043380.1\|4082888_4083287_+\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.69795e-69
NZ_CP040515.1\|WP_000360653.1\|4083286_4084180_+\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	2.99249e-93
NZ_CP040515.1\|WP_000651514.1\|4068324_4069005_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	3.81194e-107
NZ_CP040515.1\|WP_000003388.1\|4084699_4086526_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP040515.1\|WP_000872679.1\|4076841_4077582_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP040515.1\|WP_001271197.1\|4069017_4069704_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	2.91248e-108
NZ_CP040515.1\|WP_000428851.1\|4072781_4073627_+\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	5.75752e-150
NZ_CP040515.1\|WP_001081482.1\|4080942_4081581_-\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95

>NZ_CP040515.1|WP_000872679.1|4076841_4077582_+|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCFQEFQDLTKKLGYNWNSDLPIHPDQRKLAFVGDITDRGPHSLRMIEIVWELVINKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHQQNMIKEKFITLYEQSPLYHVLDEKRLIVCHAGIRQDYIGRKDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTAWVVYGHTPVKEPRFVKHTVNIDTGAVFGGKLTGLRYPEMEIVSVPSSLPFVPEKFRPIS
>NZ_CP040515.1|WP_138322317.1|4075606_4076767_+|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLCILFAIGIVSCFAITSAQASLPPFLQNVNFVLKQIQWYFIGFIAIGVIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLASGIFATGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP040515.1|WP_044792727.1|4074528_4075464_+|glycosyltransferase
MNNIKNLPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRHYLHKHKNITYIRNATTLGQFHNALMLLKQSNGEYINFLMDDDIFYSSKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMNRLYDEDTLLNGKDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQETDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP040515.1|WP_138322316.1|4073763_4074522_+|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGNYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYLSEISRVLKKDGRCFITFFLINPGSSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYLEKDILTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDMILTQKIAER
>NZ_CP040515.1|WP_000428851.1|4072781_4073627_+|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVDPNVSESERQGGKDWPRAAHSMIGRKRMNQLHEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPVEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLVTCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP040515.1|WP_138322315.1|4071807_4072659_+|exosporium-leader-peptide-containing-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGPTGATGPTGPTGPSGLGLPAGLYAFNSATVSLALGVNDPVPFNTVGSQFGTAISQMDPDTFVISETGFYKITVIAYTAAVGLLGSLAIQVNGNTVPGTGTSLISLGAPIVIQAITQITTTPSLVEAIVTGIGLSLALGTSASIIIEKIA
>NZ_CP040515.1|WP_000932905.1|4070541_4071642_-|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDSVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALNLLKRELDPNVDAVSMPYHLVMDSNGKPLYCTKRYRLVKREKQFQWFGKVHEYLAIFGEIFNSNVAITHKKEKKVTNRNLKIFQDAVAAGEELSPRDLFYYANESMDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSVFDKQYKSL
>NZ_CP040515.1|WP_001087868.1|4069700_4070390_-|methyltransferase-domain-containing-protein
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKERLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSKL
>NZ_CP040515.1|WP_001271197.1|4069017_4069704_-|streptomycin-biosynthesis-protein-StrF
MSAADKTILFVTCINDRKMYAQCARHILQLPVPPGYTIQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIVNVGFLYGLLQLFQEHEHLGMIGMVGAQYVPPNGIWNVGRGVVGKVIGYMNDLFYMASQEKPYHDSKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVDMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP040515.1|WP_000651514.1|4068324_4069005_-|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRQNYQLLNLDQVFYGNQPFLSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANVWCIHYNGDEFDADTYEKDRKVFVEHYKDILSPS
>NZ_CP040515.1|WP_014481609.1|4079217_4080111_-|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFHGGSIEVNGQHASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKRHLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSVNHKTHVSLELDTGRTHQIRVHMAYIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTPIPSDMQAILRHI
>NZ_CP040515.1|WP_000673184.1|4080126_4080924_-|NAD-kinase
MKFTIMSKGDQSSDALASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP040515.1|WP_001081482.1|4080942_4081581_-|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP040515.1|WP_001180003.1|4081611_4081983_-|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP040515.1|WP_000191107.1|4082129_4082708_+|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHTLCKSFSIEGFTKQVNHYFETPSLSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVITADEARLMMETNTIIQGAVVDQLHTLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEEAGKAAFIHLLKQHDIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP040515.1|WP_000043380.1|4082888_4083287_+|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP040515.1|WP_000360653.1|4083286_4084180_+|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSNIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPTLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP040515.1|WP_041184086.1|4084409_4084583_+|hypothetical-protein
MKKTYILLIILAVIISFFLYILSLLQAFPKMIAFPLLFGVIVIALSYFNHKKRFKGF
>NZ_CP040515.1|WP_000003388.1|4084699_4086526_-|oligoendopeptidase-F
MSEQNTAKTLPDRKEIEESSTWRLEDIFQTDAEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQSVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHMIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDSLVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP040515.1|WP_138322319.1|4086576_4087821_-|competence-protein
MIPMFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKKVLMRLGKQKKWHFAHKKEDSCLAFYEAESKYHRHGKELLYRWFKRQNFHVDIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLYKRTYSYWRAGIQVIWIIGGNQLKKYSAYWMKFSSLMAFSLQSYPQPLLIFFCSKQKSFMRCAFLTSFSTSVSFSHIIYLPTETTTFEMLFSPVPFKKEILDREWKKRKDYFRKNALPIWNYNHKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNPFIWQAFLYMKCIGELAVGECISLEYACSYVKKYTKRRMLPYFSTHIWKVAVTEYMTFLCCAGVLRKVGTYKYRKIRGIAMLKTEEEVIKYDAICLAYALSLFEAKYNMREGKGDIIKTDREGIT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP040515.1	1825415-1825441	0	1.0
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP040515.1	1825415-1825441	0	1.0
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP040515.1	1825415-1825441	0	1.0
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827179-1827205	1	0.963
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827341-1827367	1	0.963
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827431-1827457	1	0.963
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827476-1827502	1	0.963
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827512-1827538	1	0.963
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827557-1827583	1	0.963
NZ_CP040515_2	2.10\|1826018\|27\|NZ_CP040515\|CRT	1826018-1826044	27	NZ_CP040515.1	1825451-1825477	1	0.963
NZ_CP040515_2	2.13\|1826153\|27\|NZ_CP040515\|CRT	1826153-1826179	27	NZ_CP040515.1	1825451-1825477	1	0.963
NZ_CP040515_2	2.16\|1826288\|27\|NZ_CP040515\|CRT	1826288-1826314	27	NZ_CP040515.1	1825451-1825477	1	0.963
NZ_CP040515_2	2.17\|1826333\|27\|NZ_CP040515\|CRT	1826333-1826359	27	NZ_CP040515.1	1825451-1825477	1	0.963
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827143-1827169	1	0.963
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827395-1827421	1	0.963
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP040515.1	3845284-3845310	1	0.963
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827143-1827169	1	0.963
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827395-1827421	1	0.963
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP040515.1	1825415-1825441	1	0.963
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP040515.1	1825415-1825441	1	0.963
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP040515.1	1825415-1825441	1	0.963
NZ_CP040515_2	2.30\|1826927\|18\|NZ_CP040515\|CRT	1826927-1826944	18	NZ_CP040515.1	1827143-1827160	1	0.944
NZ_CP040515_2	2.30\|1826927\|18\|NZ_CP040515\|CRT	1826927-1826944	18	NZ_CP040515.1	1827395-1827412	1	0.944
NZ_CP040515_2	2.1\|1825613\|27\|NZ_CP040515\|CRT	1825613-1825639	27	NZ_CP040515.1	1827134-1827160	2	0.926
NZ_CP040515_2	2.1\|1825613\|27\|NZ_CP040515\|CRT	1825613-1825639	27	NZ_CP040515.1	1827386-1827412	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	1825406-1825432	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	3844645-3844671	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	3844807-3844833	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	3844915-3844941	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	3845131-3845157	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	3845239-3845265	2	0.926
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP040515.1	3845383-3845409	2	0.926
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827134-1827160	2	0.926
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827296-1827322	2	0.926
NZ_CP040515_2	2.4\|1825748\|27\|NZ_CP040515\|CRT	1825748-1825774	27	NZ_CP040515.1	1827386-1827412	2	0.926
NZ_CP040515_2	2.5\|1825793\|27\|NZ_CP040515\|CRT	1825793-1825819	27	NZ_CP040515.1	1827134-1827160	2	0.926
NZ_CP040515_2	2.5\|1825793\|27\|NZ_CP040515\|CRT	1825793-1825819	27	NZ_CP040515.1	1827296-1827322	2	0.926
NZ_CP040515_2	2.5\|1825793\|27\|NZ_CP040515\|CRT	1825793-1825819	27	NZ_CP040515.1	1827386-1827412	2	0.926
NZ_CP040515_2	2.7\|1825883\|27\|NZ_CP040515\|CRT	1825883-1825909	27	NZ_CP040515.1	1827224-1827250	2	0.926
NZ_CP040515_2	2.8\|1825928\|27\|NZ_CP040515\|CRT	1825928-1825954	27	NZ_CP040515.1	1827134-1827160	2	0.926
NZ_CP040515_2	2.8\|1825928\|27\|NZ_CP040515\|CRT	1825928-1825954	27	NZ_CP040515.1	1827296-1827322	2	0.926
NZ_CP040515_2	2.8\|1825928\|27\|NZ_CP040515\|CRT	1825928-1825954	27	NZ_CP040515.1	1827386-1827412	2	0.926
NZ_CP040515_2	2.10\|1826018\|27\|NZ_CP040515\|CRT	1826018-1826044	27	NZ_CP040515.1	1825406-1825432	2	0.926
NZ_CP040515_2	2.10\|1826018\|27\|NZ_CP040515\|CRT	1826018-1826044	27	NZ_CP040515.1	3845482-3845508	2	0.926
NZ_CP040515_2	2.13\|1826153\|27\|NZ_CP040515\|CRT	1826153-1826179	27	NZ_CP040515.1	1825406-1825432	2	0.926
NZ_CP040515_2	2.13\|1826153\|27\|NZ_CP040515\|CRT	1826153-1826179	27	NZ_CP040515.1	3845482-3845508	2	0.926
NZ_CP040515_2	2.16\|1826288\|27\|NZ_CP040515\|CRT	1826288-1826314	27	NZ_CP040515.1	1825406-1825432	2	0.926
NZ_CP040515_2	2.16\|1826288\|27\|NZ_CP040515\|CRT	1826288-1826314	27	NZ_CP040515.1	3845482-3845508	2	0.926
NZ_CP040515_2	2.17\|1826333\|27\|NZ_CP040515\|CRT	1826333-1826359	27	NZ_CP040515.1	1825406-1825432	2	0.926
NZ_CP040515_2	2.17\|1826333\|27\|NZ_CP040515\|CRT	1826333-1826359	27	NZ_CP040515.1	3845482-3845508	2	0.926
NZ_CP040515_2	2.18\|1826378\|36\|NZ_CP040515\|CRT	1826378-1826413	36	NZ_CP040515.1	1825406-1825441	2	0.944
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827188-1827214	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827233-1827259	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827305-1827331	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827350-1827376	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827440-1827466	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827485-1827511	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827521-1827547	2	0.926
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP040515.1	1827566-1827592	2	0.926
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP040515.1	3844852-3844878	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827188-1827214	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827233-1827259	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827305-1827331	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827350-1827376	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827440-1827466	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827485-1827511	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827521-1827547	2	0.926
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP040515.1	1827566-1827592	2	0.926
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP040515.1	3845284-3845310	2	0.926

1. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to position: 1825415-1825441, mismatch: 0, identity: 1.0

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgaacgccttgaggtccag	Protospacer
***************************

2. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to position: 1825415-1825441, mismatch: 0, identity: 1.0

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgaacgccttgaggtccag	Protospacer
***************************

3. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to position: 1825415-1825441, mismatch: 0, identity: 1.0

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgaacgccttgaggtccag	Protospacer
***************************

4. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827179-1827205, mismatch: 1, identity: 0.963

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgagcacctt	Protospacer
****.**********************

5. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827341-1827367, mismatch: 1, identity: 0.963

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgagcacctt	Protospacer
****.**********************

6. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827431-1827457, mismatch: 1, identity: 0.963

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgagcacctt	Protospacer
****.**********************

7. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827476-1827502, mismatch: 1, identity: 0.963

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgagcacctt	Protospacer
****.**********************

8. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827512-1827538, mismatch: 1, identity: 0.963

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgagcacctt	Protospacer
****.**********************

9. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827557-1827583, mismatch: 1, identity: 0.963

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgagcacctt	Protospacer
****.**********************

10. spacer 2.10|1826018|27|NZ_CP040515|CRT matches to position: 1825451-1825477, mismatch: 1, identity: 0.963

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggcccttgaatacctt	Protospacer
*************.*************

11. spacer 2.13|1826153|27|NZ_CP040515|CRT matches to position: 1825451-1825477, mismatch: 1, identity: 0.963

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggcccttgaatacctt	Protospacer
*************.*************

12. spacer 2.16|1826288|27|NZ_CP040515|CRT matches to position: 1825451-1825477, mismatch: 1, identity: 0.963

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggcccttgaatacctt	Protospacer
*************.*************

13. spacer 2.17|1826333|27|NZ_CP040515|CRT matches to position: 1825451-1825477, mismatch: 1, identity: 0.963

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggcccttgaatacctt	Protospacer
*************.*************

14. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827143-1827169, mismatch: 1, identity: 0.963

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgaacaccttgaggtccag	Protospacer
*************.*************

15. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827395-1827421, mismatch: 1, identity: 0.963

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgaacaccttgaggtccag	Protospacer
*************.*************

16. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to position: 3845284-3845310, mismatch: 1, identity: 0.963

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgaacgccttgaggtccag	Protospacer
****.**********************

17. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827143-1827169, mismatch: 1, identity: 0.963

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgaacaccttgaggtccag	Protospacer
*************.*************

18. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827395-1827421, mismatch: 1, identity: 0.963

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgaacaccttgaggtccag	Protospacer
*************.*************

19. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to position: 1825415-1825441, mismatch: 1, identity: 0.963

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgaacgccttgaggtccag	Protospacer
****.**********************

20. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to position: 1825415-1825441, mismatch: 1, identity: 0.963

ccggtccttggacgccttgaggtccag	CRISPR spacer
ccggtccttgaacgccttgaggtccag	Protospacer
**********.****************

21. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to position: 1825415-1825441, mismatch: 1, identity: 0.963

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgaacgccttgaggtccag	Protospacer
****.**********************

22. spacer 2.30|1826927|18|NZ_CP040515|CRT matches to position: 1827143-1827160, mismatch: 1, identity: 0.944

tgttaccttgaacgcctt	CRISPR spacer
tgttaccttgaacacctt	Protospacer
*************.****

23. spacer 2.30|1826927|18|NZ_CP040515|CRT matches to position: 1827395-1827412, mismatch: 1, identity: 0.944

tgttaccttgaacgcctt	CRISPR spacer
tgttaccttgaacacctt	Protospacer
*************.****

24. spacer 2.1|1825613|27|NZ_CP040515|CRT matches to position: 1827134-1827160, mismatch: 2, identity: 0.926

tagcgcctgtgttaccttgaacgcctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
****.*****************.****

25. spacer 2.1|1825613|27|NZ_CP040515|CRT matches to position: 1827386-1827412, mismatch: 2, identity: 0.926

tagcgcctgtgttaccttgaacgcctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
****.*****************.****

26. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 1825406-1825432, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcacccgccggtccttgaacgcctt	Protospacer
*******.**.****************

27. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 3844645-3844671, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcgcctgctggtccttgaacacctt	Protospacer
****.*****************.****

28. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 3844807-3844833, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcccctgctggtccttgaacacctt	Protospacer
**** *****************.****

29. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 3844915-3844941, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcccctgctggcccttgaacgcctt	Protospacer
**** ********.*************

30. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 3845131-3845157, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcccctgctggtccttgaacacctt	Protospacer
**** *****************.****

31. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 3845239-3845265, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcccccgctggtccttgaacgcctt	Protospacer
**** **.*******************

32. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to position: 3845383-3845409, mismatch: 2, identity: 0.926

tagcacctgctggtccttgaacgcctt	CRISPR spacer
tagcccctgctggtccttgaacacctt	Protospacer
**** *****************.****

33. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827134-1827160, mismatch: 2, identity: 0.926

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
****.***************.******

34. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827296-1827322, mismatch: 2, identity: 0.926

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacccgtgttaccttgagcacctt	Protospacer
****.**.*******************

35. spacer 2.4|1825748|27|NZ_CP040515|CRT matches to position: 1827386-1827412, mismatch: 2, identity: 0.926

tagcgcctgtgttaccttgagcacctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
****.***************.******

36. spacer 2.5|1825793|27|NZ_CP040515|CRT matches to position: 1827134-1827160, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
*******.**************.****

37. spacer 2.5|1825793|27|NZ_CP040515|CRT matches to position: 1827296-1827322, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tagcacccgtgttaccttgagcacctt	Protospacer
********************.*.****

38. spacer 2.5|1825793|27|NZ_CP040515|CRT matches to position: 1827386-1827412, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
*******.**************.****

39. spacer 2.7|1825883|27|NZ_CP040515|CRT matches to position: 1827224-1827250, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgagcaccct	CRISPR spacer
tagcacctgtgttaccttgaacaccct	Protospacer
*******.************.******

40. spacer 2.8|1825928|27|NZ_CP040515|CRT matches to position: 1827134-1827160, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
*******.**************.****

41. spacer 2.8|1825928|27|NZ_CP040515|CRT matches to position: 1827296-1827322, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tagcacccgtgttaccttgagcacctt	Protospacer
********************.*.****

42. spacer 2.8|1825928|27|NZ_CP040515|CRT matches to position: 1827386-1827412, mismatch: 2, identity: 0.926

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tagcacctgtgttaccttgaacacctt	Protospacer
*******.**************.****

43. spacer 2.10|1826018|27|NZ_CP040515|CRT matches to position: 1825406-1825432, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggtccttgaacgcctt	Protospacer
*********************..****

44. spacer 2.10|1826018|27|NZ_CP040515|CRT matches to position: 3845482-3845508, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcccccgctggtccttgaatacctt	Protospacer
**** *****.****************

45. spacer 2.13|1826153|27|NZ_CP040515|CRT matches to position: 1825406-1825432, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggtccttgaacgcctt	Protospacer
*********************..****

46. spacer 2.13|1826153|27|NZ_CP040515|CRT matches to position: 3845482-3845508, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcccccgctggtccttgaatacctt	Protospacer
**** *****.****************

47. spacer 2.16|1826288|27|NZ_CP040515|CRT matches to position: 1825406-1825432, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggtccttgaacgcctt	Protospacer
*********************..****

48. spacer 2.16|1826288|27|NZ_CP040515|CRT matches to position: 3845482-3845508, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcccccgctggtccttgaatacctt	Protospacer
**** *****.****************

49. spacer 2.17|1826333|27|NZ_CP040515|CRT matches to position: 1825406-1825432, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcacccgccggtccttgaacgcctt	Protospacer
*********************..****

50. spacer 2.17|1826333|27|NZ_CP040515|CRT matches to position: 3845482-3845508, mismatch: 2, identity: 0.926

tagcacccgccggtccttgaatacctt	CRISPR spacer
tagcccccgctggtccttgaatacctt	Protospacer
**** *****.****************

51. spacer 2.18|1826378|36|NZ_CP040515|CRT matches to position: 1825406-1825441, mismatch: 2, identity: 0.944

tagcacccgccggtccttgaataccttgaggtccag	CRISPR spacer
tagcacccgccggtccttgaacgccttgaggtccag	Protospacer
*********************..*************

52. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827188-1827214, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

53. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827233-1827259, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgaacaccctgaggtccag	Protospacer
*************.**.**********

54. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827305-1827331, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

55. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827350-1827376, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

56. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827440-1827466, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

57. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827485-1827511, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

58. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827521-1827547, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

59. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to position: 1827566-1827592, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

60. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to position: 3844852-3844878, mismatch: 2, identity: 0.926

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgaacaccttgaggtccag	Protospacer
****.********.*************

61. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827188-1827214, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

62. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827233-1827259, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgaacaccctgaggtccag	Protospacer
*************.**.**********

63. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827305-1827331, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

64. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827350-1827376, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

65. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827440-1827466, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

66. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827485-1827511, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

67. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827521-1827547, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

68. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to position: 1827566-1827592, mismatch: 2, identity: 0.926

tgttaccttgaacgccttgaggtccag	CRISPR spacer
tgttaccttgagcaccttgaggtccag	Protospacer
***********.*.*************

69. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to position: 3845284-3845310, mismatch: 2, identity: 0.926

ctggtccttggacgccttgaggtccag	CRISPR spacer
ctggcccttgaacgccttgaggtccag	Protospacer
****.*****.****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	3	0.889
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MF403008	Agrobacterium phage Atu_ph07, complete genome	253535-253561	3	0.889
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	AP013980	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S31-C4, * SEQUENCING IN PROGRESS *	14807-14833	3	0.889
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	3	0.889
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	3	0.889
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	3	0.889
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	3	0.889
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30798	3	0.889
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	31716-31742	3	0.889
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30798	3	0.889
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30798	3	0.889
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	AP013980	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S31-C4, * SEQUENCING IN PROGRESS *	14807-14833	3	0.889
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	3	0.889
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	3	0.889
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	3	0.889
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	3	0.889
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30798	3	0.889
NZ_CP040515_2	2.5\|1825793\|27\|NZ_CP040515\|CRT	1825793-1825819	27	MN694528	Marine virus AFVG_250M165, complete genome	1654-1680	4	0.852
NZ_CP040515_2	2.8\|1825928\|27\|NZ_CP040515\|CRT	1825928-1825954	27	MN694528	Marine virus AFVG_250M165, complete genome	1654-1680	4	0.852
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	137954-137980	4	0.852
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	137954-137980	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80562-80588	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54272-54298	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243807-243833	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134757-134783	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239862-239888	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	4	0.852
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2907-2933	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3060-3086	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	408-434	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	191-217	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32198-32224	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1602-1628	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21475-21501	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33324-33350	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33169-33195	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32434-32460	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35186-35212	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32434-32460	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32525-32551	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32525-32551	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32518-32544	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32436-32462	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32525-32551	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48941-48967	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	19003-19029	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32823-32849	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41355-41381	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22381-22407	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22367-22393	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32435-32461	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32435-32461	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32525-32551	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30798	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21381-21407	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22692-22718	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58079-58105	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32907-32933	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9067-9093	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33325-33351	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21774-21800	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59496-59522	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20468-20494	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50193-50219	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32435-32461	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32435-32461	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21607-21633	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32824-32850	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NC_024210	Escherichia phage e4/1c, complete genome	7543-7569	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32524-32550	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43885-43911	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22711-22737	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21786-21812	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32525-32551	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21150-21176	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33219-33245	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32435-32461	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32512-32538	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22352-22378	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2484-2510	4	0.852
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80562-80588	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54272-54298	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243807-243833	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134757-134783	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239862-239888	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	4	0.852
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	4	0.852
NZ_CP040515_2	2.22\|1826567\|27\|NZ_CP040515\|CRT	1826567-1826593	27	MH576968	Streptomyces phage Wofford, complete genome	74332-74358	4	0.852
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30798	4	0.852
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	4	0.852
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	31716-31742	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MF403008	Agrobacterium phage Atu_ph07, complete genome	253535-253561	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_009426	Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence	168421-168447	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_002033	Novosphingobium aromaticivorans plasmid pNL1, complete sequence	111810-111836	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP033228	Sphingobium yanoikuyae strain SJTF8 plasmid pF2, complete sequence	171771-171797	4	0.852
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	31716-31742	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MF403008	Agrobacterium phage Atu_ph07, complete genome	253535-253561	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_009426	Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence	168421-168447	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_002033	Novosphingobium aromaticivorans plasmid pNL1, complete sequence	111810-111836	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP033228	Sphingobium yanoikuyae strain SJTF8 plasmid pF2, complete sequence	171771-171797	4	0.852
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	31716-31742	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MF403008	Agrobacterium phage Atu_ph07, complete genome	253535-253561	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_009426	Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence	168421-168447	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_002033	Novosphingobium aromaticivorans plasmid pNL1, complete sequence	111810-111836	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP033228	Sphingobium yanoikuyae strain SJTF8 plasmid pF2, complete sequence	171771-171797	4	0.852
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	31716-31742	4	0.852
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NC_048106	Synechococcus phage S-CBWM1, complete genome	58607-58633	5	0.815
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	380843-380869	5	0.815
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	1449837-1449863	5	0.815
NZ_CP040515_2	2.2\|1825658\|27\|NZ_CP040515\|CRT	1825658-1825684	27	MF403008	Agrobacterium phage Atu_ph07, complete genome	253526-253552	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	137198-137224	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MN693555	Marine virus AFVG_25M96, complete genome	16865-16891	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	808490-808516	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NZ_CP048419	Sphingomonas insulae strain KCTC 12872 plasmid unnamed1, complete sequence	30291-30317	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	LT598654	Phage NCTB genome assembly, complete genome: monopartite	101448-101474	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MH976516	Corynebacterium phage PeteyPab, complete genome	14358-14384	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MH926057	Corynebacterium phage Kimchi1738, complete genome	13991-14017	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MG198778	Corynebacterium phage PotatoChip, complete genome	14360-14386	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MG198780	Corynebacterium phage Zion, complete genome	14358-14384	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MH926056	Corynebacterium phage Cruella, complete genome	14393-14419	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MG198776	Corynebacterium phage C3PO, complete genome	14393-14419	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	MK977700	Corynebacterium phage Stickynote, complete genome	15170-15196	5	0.815
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_042086	Corynebacterium phage Darwin, complete genome	15138-15164	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	137198-137224	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MN693555	Marine virus AFVG_25M96, complete genome	16865-16891	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	808490-808516	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NZ_CP048419	Sphingomonas insulae strain KCTC 12872 plasmid unnamed1, complete sequence	30291-30317	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	LT598654	Phage NCTB genome assembly, complete genome: monopartite	101448-101474	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MH976516	Corynebacterium phage PeteyPab, complete genome	14358-14384	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MH926057	Corynebacterium phage Kimchi1738, complete genome	13991-14017	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MG198778	Corynebacterium phage PotatoChip, complete genome	14360-14386	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MG198780	Corynebacterium phage Zion, complete genome	14358-14384	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MH926056	Corynebacterium phage Cruella, complete genome	14393-14419	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MG198776	Corynebacterium phage C3PO, complete genome	14393-14419	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	MK977700	Corynebacterium phage Stickynote, complete genome	15170-15196	5	0.815
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_042086	Corynebacterium phage Darwin, complete genome	15138-15164	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169004-169030	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169112-169138	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2844-2870	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	5	0.815
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	MN830258	Lactobacillus phage JNU_P9, complete genome	19968-19994	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169058-169084	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	320590-320616	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	AF246223	Mycoplasma virus P1, complete genome	8322-8348	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	AF246223	Mycoplasma virus P1, complete genome	8394-8420	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NC_002515	Mycoplasma phage P1, complete genome	8322-8348	5	0.815
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NC_002515	Mycoplasma phage P1, complete genome	8394-8420	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169004-169030	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169112-169138	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2844-2870	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	5	0.815
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	MN830258	Lactobacillus phage JNU_P9, complete genome	19968-19994	5	0.815
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	320590-320616	5	0.815
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2637-2663	5	0.815
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	5	0.815
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	5	0.815
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169157-169183	5	0.815
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	5	0.815
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	5	0.815
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	5	0.815
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MT776810	Gordonia phage BigChungus, complete genome	22344-22370	5	0.815
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MN284906	Gordonia phage CherryonLim, complete genome	24081-24107	5	0.815
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MK967385	Gordonia phage SheckWes, complete genome	22307-22333	5	0.815
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MT776808	Gordonia phage Feastonyeet, complete genome	22344-22370	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	KC954774	Cronobacter phage CR8, complete genome	11571-11597	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MT776810	Gordonia phage BigChungus, complete genome	22344-22370	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MN284906	Gordonia phage CherryonLim, complete genome	24081-24107	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MK967385	Gordonia phage SheckWes, complete genome	22307-22333	5	0.815
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MT776808	Gordonia phage Feastonyeet, complete genome	22344-22370	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169058-169084	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3060-3086	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48941-48967	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	19003-19029	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58079-58105	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9067-9093	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20468-20494	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2907-2933	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	408-434	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	191-217	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32198-32224	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1602-1628	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21475-21501	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33324-33350	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33169-33195	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32434-32460	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35186-35212	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32434-32460	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32518-32544	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32436-32462	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32823-32849	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41355-41381	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22381-22407	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22367-22393	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21381-21407	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22692-22718	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32907-32933	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33325-33351	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21774-21800	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59496-59522	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50193-50219	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21607-21633	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32824-32850	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_024210	Escherichia phage e4/1c, complete genome	7543-7569	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43885-43911	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22711-22737	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21786-21812	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21150-21176	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33219-33245	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32512-32538	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22352-22378	5	0.815
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2484-2510	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169058-169084	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3060-3086	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48941-48967	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	19003-19029	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58079-58105	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9067-9093	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20468-20494	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2907-2933	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	408-434	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	191-217	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32198-32224	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1602-1628	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21475-21501	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33324-33350	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33169-33195	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32434-32460	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35186-35212	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32434-32460	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32518-32544	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32436-32462	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32823-32849	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41355-41381	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22381-22407	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22367-22393	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21381-21407	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22692-22718	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32907-32933	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33325-33351	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21774-21800	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59496-59522	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50193-50219	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21607-21633	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32824-32850	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_024210	Escherichia phage e4/1c, complete genome	7543-7569	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43885-43911	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22711-22737	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21786-21812	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21150-21176	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33219-33245	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32512-32538	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22352-22378	5	0.815
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2484-2510	5	0.815
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	320590-320616	5	0.815
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2637-2663	5	0.815
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	124939-124965	5	0.815
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	5	0.815
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169157-169183	5	0.815
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	MH937499	Streptococcus phage CHPC1062, complete genome	17284-17310	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169058-169084	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3060-3086	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497119	Flavobacterium phage vB_Fsp_elemo8-1A, partial genome	48941-48967	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497112	Flavobacterium phage vB_Fsp_elemo6-5A, partial genome	19003-19029	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497105	Flavobacterium phage vB_Fsp_elemo3-5A, partial genome	58079-58105	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497091	Flavobacterium phage vB_Fsp_elemo13-5B, partial genome	9067-9093	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497092	Flavobacterium phage vB_Fsp_elemo13-9B, partial genome	20468-20494	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2907-2933	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	408-434	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	191-217	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497078	Flavobacterium phage vB_Fsp_elemo10-3D, partial genome	32198-32224	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497108	Flavobacterium phage vB_Fsp_elemo4-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497121	Flavobacterium phage vB_Fsp_elemo8-1D, partial genome	1602-1628	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497101	Flavobacterium phage vB_Fsp_elemo2-5B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497069	Flavobacterium phage vB_Fsp_elemo15-9B, partial genome	21475-21501	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497123	Flavobacterium phage vB_Fsp_elemo8-9A, partial genome	33324-33350	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497079	Flavobacterium phage vB_Fsp_elemo10-9A, partial genome	33169-33195	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497094	Flavobacterium phage vB_Fsp_elemo14-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497076	Flavobacterium phage vB_Fsp_elemo1-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497115	Flavobacterium phage vB_Fsp_elemo7-3B, partial genome	32434-32460	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497082	Flavobacterium phage vB_Fsp_elemo11-9B, partial genome	35186-35212	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497088	Flavobacterium phage vB_Fsp_elemo13-1E, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497085	Flavobacterium phage vB_Fsp_elemo12-3A, partial genome	32434-32460	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497095	Flavobacterium phage vB_Fsp_elemo14-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497110	Flavobacterium phage vB_Fsp_elemo5-9A, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497096	Flavobacterium phage vB_Fsp_elemo15-3B, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497114	Flavobacterium phage vB_Fsp_elemo7-3A, partial genome	32518-32544	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497120	Flavobacterium phage vB_Fsp_elemo8-1B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497087	Flavobacterium phage vB_Fsp_elemo13-1B, partial genome	32436-32462	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497117	Flavobacterium phage vB_Fsp_elemo7-9B, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497099	Flavobacterium phage vB_Fsp_elemo15-9C, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497097	Flavobacterium phage vB_Fsp_elemo15-3D, partial genome	32823-32849	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497089	Flavobacterium phage vB_Fsp_elemo13-3B, partial genome	41355-41381	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497070	Flavobacterium phage vB_Fsp_elemo2-5C, partial genome	22381-22407	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497017	Flavobacterium phage vB_Fsp_elemo7-9A, complete genome	22367-22393	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497109	Flavobacterium phage vB_Fsp_elemo5-3D, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497104	Flavobacterium phage vB_Fsp_elemo2-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497125	Flavobacterium phage vB_Fsp_elemo9-1A, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497118	Flavobacterium phage vB_Fsp_elemo7-9C, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497072	Flavobacterium phage vB_Fsp_elemo6-9C, partial genome	21381-21407	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497077	Flavobacterium phage vB_Fsp_elemo1-9C, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	22692-22718	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497107	Flavobacterium phage vB_Fsp_elemo3-9B, partial genome	32907-32933	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497113	Flavobacterium phage vB_Fsp_elemo6-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497116	Flavobacterium phage vB_Fsp_elemo7-5A, partial genome	33325-33351	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497065	Flavobacterium phage vB_Fsp_elemo13-1A, partial genome	21774-21800	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497122	Flavobacterium phage vB_Fsp_elemo8-3A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497106	Flavobacterium phage vB_Fsp_elemo3-9A, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497102	Flavobacterium phage vB_Fsp_elemo2-5F, partial genome	59496-59522	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497074	Flavobacterium phage vB_Fsp_elemo1-5B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497098	Flavobacterium phage vB_Fsp_elemo15-9A, partial genome	50193-50219	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497081	Flavobacterium phage vB_Fsp_elemo11-5C, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497103	Flavobacterium phage vB_Fsp_elemo2-5G, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497124	Flavobacterium phage vB_Fsp_elemo8-9B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497093	Flavobacterium phage vB_Fsp_elemo14-3D, partial genome	21607-21633	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497083	Flavobacterium phage vB_Fsp_elemo11-9C, partial genome	32824-32850	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_024210	Escherichia phage e4/1c, complete genome	7543-7569	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497084	Flavobacterium phage vB_Fsp_elemo12-1B, partial genome	32524-32550	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497086	Flavobacterium phage vB_Fsp_elemo12-9A, partial genome	43885-43911	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497067	Flavobacterium phage vB_Fsp_elemo14-1A, partial genome	22711-22737	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497066	Flavobacterium phage vB_Fsp_elemo13-1C, partial genome	21786-21812	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497100	Flavobacterium phage vB_Fsp_elemo2-5A, partial genome	32525-32551	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497071	Flavobacterium phage vB_Fsp_elemo6-3D, partial genome	21150-21176	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497080	Flavobacterium phage vB_Fsp_elemo10-9C, partial genome	33219-33245	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497111	Flavobacterium phage vB_Fsp_elemo5-9B, partial genome	32435-32461	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497075	Flavobacterium phage vB_Fsp_elemo1-9A, partial genome	32512-32538	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497073	Flavobacterium phage vB_Fsp_elemo8-9C, partial genome	22352-22378	5	0.815
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MT497090	Flavobacterium phage vB_Fsp_elemo13-3D, partial genome	2484-2510	5	0.815
NZ_CP040515_2	2.6\|1825838\|27\|NZ_CP040515\|CRT	1825838-1825864	27	NZ_CP012918	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence	119968-119994	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	137945-137971	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	29292-29318	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2898-2924	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3069-3095	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	399-425	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1409071-1409097	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	182-208	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	EU246945	Lactobacillus phage Lrm1, complete sequence	17399-17425	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_011104	Lactobacillus phage Lrm1, complete genome	17399-17425	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_018687	Bacillus thuringiensis MC28 plasmid pMC189, complete sequence	137945-137971	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	29292-29318	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2898-2924	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	3069-3095	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	399-425	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1409071-1409097	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	182-208	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	EU246945	Lactobacillus phage Lrm1, complete sequence	17399-17425	6	0.778
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_011104	Lactobacillus phage Lrm1, complete genome	17399-17425	6	0.778
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	6	0.778
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	NC_024385	Leuconostoc phage phiLN12, complete genome	26910-26936	6	0.778
NZ_CP040515_2	2.19\|1826432\|27\|NZ_CP040515\|CRT	1826432-1826458	27	AP018399	Xanthomonas phage XacN1 DNA, complete genome	302139-302165	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8371-8397	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8425-8451	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8479-8505	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134205-134231	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274884-274910	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	253756-253782	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	562909-562935	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30904-30930	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	NC_007734	Bacillus phage WBeta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3821-3847	6	0.778
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168950-168976	6	0.778
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	NC_024385	Leuconostoc phage phiLN12, complete genome	26910-26936	6	0.778
NZ_CP040515_2	2.21\|1826522\|27\|NZ_CP040515\|CRT	1826522-1826548	27	AP018399	Xanthomonas phage XacN1 DNA, complete genome	302139-302165	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP032924	Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108b, complete sequence	138537-138563	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274938-274964	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275046-275072	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	230694-230720	6	0.778
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134205-134231	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	KC954774	Cronobacter phage CR8, complete genome	11571-11597	6	0.778
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MN369758	Gordonia phage NHagos, complete genome	45577-45603	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	664306-664332	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134205-134231	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	167925-167951	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	334740-334766	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MN369758	Gordonia phage NHagos, complete genome	45577-45603	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	393460-393486	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	201729-201755	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NC_028672	Cronobacter phage PBES 02, complete genome	65748-65774	6	0.778
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	NC_017974	Cronobacter phage CR3, complete genome	11569-11595	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8371-8397	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8425-8451	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8479-8505	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134205-134231	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274884-274910	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1202-1228	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	AF246223	Mycoplasma virus P1, complete genome	8322-8348	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	AF246223	Mycoplasma virus P1, complete genome	8394-8420	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_002515	Mycoplasma phage P1, complete genome	8322-8348	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_002515	Mycoplasma phage P1, complete genome	8394-8420	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	562909-562935	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30904-30930	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	NC_007734	Bacillus phage WBeta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.26\|1826747\|27\|NZ_CP040515\|CRT	1826747-1826773	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3821-3847	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8371-8397	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8425-8451	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8479-8505	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134205-134231	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274884-274910	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1202-1228	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	AF246223	Mycoplasma virus P1, complete genome	8322-8348	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	AF246223	Mycoplasma virus P1, complete genome	8394-8420	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_002515	Mycoplasma phage P1, complete genome	8322-8348	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_002515	Mycoplasma phage P1, complete genome	8394-8420	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	562909-562935	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30904-30930	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	NC_007734	Bacillus phage WBeta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.27\|1826792\|27\|NZ_CP040515\|CRT	1826792-1826818	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3821-3847	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP032924	Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108b, complete sequence	138537-138563	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274938-274964	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275046-275072	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	230694-230720	6	0.778
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168896-168922	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2682-2708	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2736-2762	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2790-2816	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8371-8397	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8425-8451	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8479-8505	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134205-134231	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274884-274910	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1713019-1713045	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1202-1228	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	AF246223	Mycoplasma virus P1, complete genome	8322-8348	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	AF246223	Mycoplasma virus P1, complete genome	8394-8420	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_002515	Mycoplasma phage P1, complete genome	8322-8348	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_002515	Mycoplasma phage P1, complete genome	8394-8420	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	562909-562935	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	30904-30930	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	NC_007734	Bacillus phage WBeta, complete genome	33704-33730	6	0.778
NZ_CP040515_2	2.29\|1826882\|27\|NZ_CP040515\|CRT	1826882-1826908	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	3821-3847	6	0.778
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	EU246945	Lactobacillus phage Lrm1, complete sequence	16943-16969	7	0.741
NZ_CP040515_2	2.11\|1826063\|27\|NZ_CP040515\|CRT	1826063-1826089	27	NC_011104	Lactobacillus phage Lrm1, complete genome	16943-16969	7	0.741
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	EU246945	Lactobacillus phage Lrm1, complete sequence	16943-16969	7	0.741
NZ_CP040515_2	2.14\|1826198\|27\|NZ_CP040515\|CRT	1826198-1826224	27	NC_011104	Lactobacillus phage Lrm1, complete genome	16943-16969	7	0.741
NZ_CP040515_2	2.20\|1826477\|27\|NZ_CP040515\|CRT	1826477-1826503	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1202-1228	7	0.741
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	7	0.741
NZ_CP040515_2	2.23\|1826612\|27\|NZ_CP040515\|CRT	1826612-1826638	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MH892385	Streptococcus phage SW33, complete genome	19419-19445	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MH892384	Streptococcus phage SW32, complete genome	19419-19445	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NC_028672	Cronobacter phage PBES 02, complete genome	65748-65774	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MH892383	Streptococcus phage SW31, complete genome	19419-19445	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	KY705280	Streptococcus phage P7954, complete genome	19056-19082	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	NC_017974	Cronobacter phage CR3, complete genome	11569-11595	7	0.741
NZ_CP040515_2	2.24\|1826657\|27\|NZ_CP040515\|CRT	1826657-1826683	27	MH892362	Streptococcus phage SW13, complete genome	19436-19462	7	0.741
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MH892385	Streptococcus phage SW33, complete genome	19419-19445	7	0.741
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MH892384	Streptococcus phage SW32, complete genome	19419-19445	7	0.741
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MH892383	Streptococcus phage SW31, complete genome	19419-19445	7	0.741
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	KY705280	Streptococcus phage P7954, complete genome	19056-19082	7	0.741
NZ_CP040515_2	2.25\|1826702\|27\|NZ_CP040515\|CRT	1826702-1826728	27	MH892362	Streptococcus phage SW13, complete genome	19436-19462	7	0.741
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	KY705251	Streptococcus phage P0091, complete genome	17100-17126	7	0.741
NZ_CP040515_2	2.28\|1826837\|27\|NZ_CP040515\|CRT	1826837-1826863	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20003-20029	7	0.741
NZ_CP040515_2	2.3\|1825703\|27\|NZ_CP040515\|CRT	1825703-1825729	27	NC_012527	Deinococcus deserti VCD115 plasmid 1, complete sequence	166148-166174	8	0.704
NZ_CP040515_2	2.9\|1825973\|27\|NZ_CP040515\|CRT	1825973-1825999	27	NC_012527	Deinococcus deserti VCD115 plasmid 1, complete sequence	166148-166174	8	0.704
NZ_CP040515_2	2.12\|1826108\|27\|NZ_CP040515\|CRT	1826108-1826134	27	NC_012527	Deinococcus deserti VCD115 plasmid 1, complete sequence	166148-166174	8	0.704
NZ_CP040515_2	2.15\|1826243\|27\|NZ_CP040515\|CRT	1826243-1826269	27	NC_012527	Deinococcus deserti VCD115 plasmid 1, complete sequence	166148-166174	8	0.704
NZ_CP040515_2	2.18\|1826378\|36\|NZ_CP040515\|CRT	1826378-1826413	36	NC_024210	Escherichia phage e4/1c, complete genome	7543-7578	8	0.778
NZ_CP040515_2	2.18\|1826378\|36\|NZ_CP040515\|CRT	1826378-1826413	36	MT354570	Pseudomonas phage phiB1_1, complete genome	30772-30807	8	0.778

1. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 3, identity: 0.889

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 ************.************

2. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MF403008 (Agrobacterium phage Atu_ph07, complete genome) position: , mismatch: 3, identity: 0.889

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacgccttgcgggccag	Protospacer
.****************** ** ****

3. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to AP013980 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S31-C4, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgtatgccttgaggtccag	Protospacer
*.******** *.**************

4. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

5. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

6. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

7. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

8. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 3, identity: 0.889

ccggtccttggacgccttgaggtccag	CRISPR spacer
gcggtccttgtacaccttgaggtccag	Protospacer
 ********* **.*************

9. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 3, identity: 0.889

ccggtccttggacgccttgaggtccag	CRISPR spacer
ccggtccttggccgccttgaggtactg	Protospacer
*********** *********** * *

10. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 3, identity: 0.889

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcggtccttgtacaccttgaggtccag	Protospacer
 ********* **.*************

11. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 3, identity: 0.889

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcggtccttgtacaccttgaggtccag	Protospacer
 ********* **.*************

12. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to AP013980 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S31-C4, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgtatgccttgaggtccag	Protospacer
*.******** *.**************

13. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

14. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

15. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

16. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 3, identity: 0.889

ccggc--ccttgaacgccttgaggtccag	CRISPR spacer
--ggcctccttgaacgccttgatgtccag	Protospacer
  ***  *************** ******

17. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 3, identity: 0.889

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcggtccttgtacaccttgaggtccag	Protospacer
 ********* **.*************

18. spacer 2.5|1825793|27|NZ_CP040515|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 4, identity: 0.852

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tcccaccagtattaccttgaacgcctt	Protospacer
*  **** **.****************

19. spacer 2.8|1825928|27|NZ_CP040515|CRT matches to MN694528 (Marine virus AFVG_250M165, complete genome) position: , mismatch: 4, identity: 0.852

tagcacccgtgttaccttgaacgcctt	CRISPR spacer
tcccaccagtattaccttgaacgcctt	Protospacer
*  **** **.****************

20. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaggcccttgaggccctt	CRISPR spacer
ggggcccttgaggcccttgaggccctt	Protospacer
 *   **********************

21. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaggcccttgaggccctt	CRISPR spacer
ggggcccttgaggcccttgaggccctt	Protospacer
 *   **********************

22. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
 . ********** *************

23. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
 . ********** *************

24. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
 . ********** *************

25. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
 . ********** *************

26. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
.* * *************** ******

27. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

28. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

29. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 4, identity: 0.852

tgtta-ccttgaacgccttgaggtccag	CRISPR spacer
-gtaatccttgaacaccttgaggtccac	Protospacer
 ** * ********.************

30. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

31. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

32. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

33. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 4, identity: 0.852

tgtta-ccttgaacgccttgaggtccag	CRISPR spacer
-gtaatccttgaacaccttgaggtccac	Protospacer
 ** * ********.************

34. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 4, identity: 0.852

-tgttaccttgaacgccttgaggtccag	CRISPR spacer
gtggt-ccttgaacaccttgaggtccac	Protospacer
 ** * ********.************

35. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .********** *************

36. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
************..***********

37. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . **************** ******

38. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
************..***********

39. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
************..***********

40. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
************..***********

41. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

42. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

43. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

44. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

45. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

46. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

47. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

48. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

49. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

50. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

51. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

52. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

53. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

54. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

55. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

56. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

57. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

58. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

59. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

60. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

61. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

62. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

63. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

64. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

65. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

66. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

67. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

68. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

69. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

70. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

71. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

72. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gcggtccttgtacaccttgaggtccag	Protospacer
 .******** **.*************

73. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

74. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

75. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

76. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

77. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

78. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

79. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

80. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

81. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

82. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

83. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

84. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

85. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

86. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

87. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

88. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

89. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

90. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

91. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

92. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

93. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtccct	Protospacer
************..***********

94. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

95. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

96. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

97. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

98. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

99. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

100. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

101. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

102. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

103. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

104. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 4, identity: 0.852

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
********* *** ***********

105. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.852

--ctggtccttgaacgccttgaggtccag	CRISPR spacer
gcctg--ccatgaacgccttgaggtccat	Protospacer
  ***  ** ******************

106. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
 . ********** *************

107. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
 . ********** *************

108. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
 . ********** *************

109. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
 . ********** *************

110. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
.* * *************** ******

111. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

112. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

113. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 4, identity: 0.852

tgtta-ccttgaacgccttgaggtccag	CRISPR spacer
-gtaatccttgaacaccttgaggtccac	Protospacer
 ** * ********.************

114. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

115. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

116. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

tgttaccttgaacgcctt---gaggtccag	CRISPR spacer
ggttaccttgaacgccttgaagaggtc---	Protospacer
 *****************   ******

117. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 4, identity: 0.852

tgtta-ccttgaacgccttgaggtccag	CRISPR spacer
-gtaatccttgaacaccttgaggtccac	Protospacer
 ** * ********.************

118. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 4, identity: 0.852

-tgttaccttgaacgccttgaggtccag	CRISPR spacer
gtggt-ccttgaacaccttgaggtccac	Protospacer
 ** * ********.************

119. spacer 2.22|1826567|27|NZ_CP040515|CRT matches to MH576968 (Streptomyces phage Wofford, complete genome) position: , mismatch: 4, identity: 0.852

ctggtccctggacgccttgaggtccag	CRISPR spacer
gagggccctggacaccttgaggtccag	Protospacer
  ** ********.*************

120. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 4, identity: 0.852

ctggtccttggacgccttgaggtccag	CRISPR spacer
gcggtccttgtacaccttgaggtccag	Protospacer
 .******** **.*************

121. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 4, identity: 0.852

ctggtccttggacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 *********.**.************

122. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 4, identity: 0.852

ctggtccttggacgccttgaggtccag	CRISPR spacer
ccggtccttggccgccttgaggtactg	Protospacer
*.********* *********** * *

123. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .********** *************

124. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 .***********.************

125. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MF403008 (Agrobacterium phage Atu_ph07, complete genome) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacgccttgcgggccag	Protospacer
..***************** ** ****

126. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . **************** ******

127. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_009426 (Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

128. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_002033 (Novosphingobium aromaticivorans plasmid pNL1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

129. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP033228 (Sphingobium yanoikuyae strain SJTF8 plasmid pF2, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

130. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttggccgccttgaggtactg	Protospacer
**********. *********** * *

131. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .********** *************

132. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 .***********.************

133. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MF403008 (Agrobacterium phage Atu_ph07, complete genome) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacgccttgcgggccag	Protospacer
..***************** ** ****

134. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . **************** ******

135. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_009426 (Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

136. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_002033 (Novosphingobium aromaticivorans plasmid pNL1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

137. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP033228 (Sphingobium yanoikuyae strain SJTF8 plasmid pF2, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

138. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttggccgccttgaggtactg	Protospacer
**********. *********** * *

139. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .********** *************

140. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 .***********.************

141. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MF403008 (Agrobacterium phage Atu_ph07, complete genome) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacgccttgcgggccag	Protospacer
..***************** ** ****

142. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . **************** ******

143. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_009426 (Novosphingobium aromaticivorans DSM 12444 plasmid pNL1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

144. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_002033 (Novosphingobium aromaticivorans plasmid pNL1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

145. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP033228 (Sphingobium yanoikuyae strain SJTF8 plasmid pF2, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttgatggccttgaggtcgat	Protospacer
***********  *********** *

146. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 4, identity: 0.852

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ccggtccttggccgccttgaggtactg	Protospacer
**********. *********** * *

147. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to NC_048106 (Synechococcus phage S-CBWM1, complete genome) position: , mismatch: 5, identity: 0.815

tagcacctgctggtccttgaacgcctt	CRISPR spacer
cagcaccggctggtccttgaactcccg	Protospacer
.****** ************** **.

148. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tagcacctgctggtccttgaacgcctt	CRISPR spacer
gcgcacctgcaggtccttgagcgccat	Protospacer
  ******** *********.**** *

149. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 5, identity: 0.815

tagcacctgctggtccttgaacgcctt	CRISPR spacer
ccgcacctgcgggtccttgaacgggtt	Protospacer
. ******** ************  **

150. spacer 2.2|1825658|27|NZ_CP040515|CRT matches to MF403008 (Agrobacterium phage Atu_ph07, complete genome) position: , mismatch: 5, identity: 0.815

tagcacctgctggtccttgaacgcctt	CRISPR spacer
ctggacctattggtccttgaacgcctt	Protospacer
. * ****..*****************

151. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
ggggcccttgaggcccttgaggacctt	Protospacer
 *   ***************** ****

152. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctt	Protospacer
 . **********.********.****

153. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
tagtcccttgaggcccttaaggccctc	Protospacer
*. * *************.*******.

154. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NZ_CP048419 (Sphingomonas insulae strain KCTC 12872 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
tcggaccttgacgcccttgaggcgctt	Protospacer
*   ******* *********** ***

155. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to LT598654 (Phage NCTB genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gttcaccctgaggcccttgaggtcctt	Protospacer
  *.***.**************.****

156. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MH976516 (Corynebacterium phage PeteyPab, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

157. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MH926057 (Corynebacterium phage Kimchi1738, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

158. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MG198778 (Corynebacterium phage PotatoChip, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

159. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MG198780 (Corynebacterium phage Zion, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

160. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MH926056 (Corynebacterium phage Cruella, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

161. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MG198776 (Corynebacterium phage C3PO, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

162. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to MK977700 (Corynebacterium phage Stickynote, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

163. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_042086 (Corynebacterium phage Darwin, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

164. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
ggggcccttgaggcccttgaggacctt	Protospacer
 *   ***************** ****

165. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctt	Protospacer
 . **********.********.****

166. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
tagtcccttgaggcccttaaggccctc	Protospacer
*. * *************.*******.

167. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NZ_CP048419 (Sphingomonas insulae strain KCTC 12872 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
tcggaccttgacgcccttgaggcgctt	Protospacer
*   ******* *********** ***

168. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to LT598654 (Phage NCTB genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gttcaccctgaggcccttgaggtcctt	Protospacer
  *.***.**************.****

169. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MH976516 (Corynebacterium phage PeteyPab, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

170. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MH926057 (Corynebacterium phage Kimchi1738, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

171. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MG198778 (Corynebacterium phage PotatoChip, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

172. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MG198780 (Corynebacterium phage Zion, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

173. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MH926056 (Corynebacterium phage Cruella, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

174. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MG198776 (Corynebacterium phage C3PO, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

175. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to MK977700 (Corynebacterium phage Stickynote, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

176. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_042086 (Corynebacterium phage Darwin, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaggcccttgaggccctt	CRISPR spacer
cgagaccttgaggctcttgaggcactt	Protospacer
.*  **********.******** ***

177. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttggggtccag	Protospacer
 . ********** *****.*******

178. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtcctg	Protospacer
 . ********** *********** *

179. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttggggtccag	Protospacer
 . ********** *****.*******

180. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

181. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

182. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

183. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

184. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to MN830258 (Lactobacillus phage JNU_P9, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gggtaccctgaacgccttgaggtccct	Protospacer
 * ****.*****************

185. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaactccttggggtccag	Protospacer
  .********** *****.*******

186. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

187. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

188. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

189. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

190. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgatcgccttgaggtcgcc	Protospacer
****.****** ************

191. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 *..*********.************

192. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
.************ ******* ***

193. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
.************.********.**

194. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 *..*********.************

195. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
.************ ******* ***

196. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
.************.********.**

197. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttggggtccag	Protospacer
 . ********** *****.*******

198. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtcctg	Protospacer
 . ********** *********** *

199. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttggggtccag	Protospacer
 . ********** *****.*******

200. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

201. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

202. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

203. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
 *.. *************** ******

204. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to MN830258 (Lactobacillus phage JNU_P9, complete genome) position: , mismatch: 5, identity: 0.815

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gggtaccctgaacgccttgaggtccct	Protospacer
 * ****.*****************

205. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgatcgccttgaggtcgcc	Protospacer
*.********* ************

206. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaggcccttgaattccttgaggtccgg	Protospacer
  **********. ***********.*

207. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . .*************** ******

208. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .*.******** *************

209. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaggcccttgaattccttgaggtcctg	Protospacer
  **********. *********** *

210. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 .**.********.************

211. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttggacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .*******.** *************

212. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.815

ctggtccttggacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . ******.********* ******

213. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MT776810 (Gordonia phage BigChungus, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtcccg	Protospacer
. **********.***.******** *

214. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MN284906 (Gordonia phage CherryonLim, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtcccg	Protospacer
. **********.***.******** *

215. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MK967385 (Gordonia phage SheckWes, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtccgg	Protospacer
. **********.***.********.*

216. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MT776808 (Gordonia phage Feastonyeet, complete genome) position: , mismatch: 5, identity: 0.815

ctggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtcccg	Protospacer
. **********.***.******** *

217. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .*******.** *************

218. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to KC954774 (Cronobacter phage CR8, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
gcgctccttggacaccttgaggtcctt	Protospacer
 ** *********.***********

219. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 .********.**.************

220. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . ******.********* ******

221. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MT776810 (Gordonia phage BigChungus, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtcccg	Protospacer
. **********.***.******** *

222. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MN284906 (Gordonia phage CherryonLim, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtcccg	Protospacer
. **********.***.******** *

223. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MK967385 (Gordonia phage SheckWes, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtccgg	Protospacer
. **********.***.********.*

224. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MT776808 (Gordonia phage Feastonyeet, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttggacgccttgaggtccag	CRISPR spacer
tgggtccttggatgccctgaggtcccg	Protospacer
. **********.***.******** *

225. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaactccttggggtccag	Protospacer
  .********** *****.*******

226. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

227. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

228. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

229. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

230. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

231. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

232. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

233. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

234. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

235. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

236. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

237. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

238. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

239. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

240. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

241. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

242. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

243. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

244. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

245. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

246. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

247. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

248. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

249. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

250. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

251. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

252. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

253. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

254. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

255. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

256. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

257. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

258. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

259. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

260. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

261. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

262. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

263. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

264. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

265. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

266. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

267. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

268. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

269. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

270. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

271. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

272. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

273. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

274. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

275. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

276. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

277. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

278. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

279. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

280. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

281. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

282. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

283. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

284. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

285. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtccct	Protospacer
*.**********..***********

286. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

287. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

288. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

289. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

290. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

291. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

292. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

293. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

294. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

295. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

296. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

297. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaactccttggggtccag	Protospacer
  .********** *****.*******

298. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

299. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

300. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

301. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

302. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

303. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

304. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

305. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

306. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

307. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

308. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

309. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

310. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

311. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

312. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

313. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

314. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

315. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

316. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

317. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

318. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

319. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

320. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

321. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

322. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

323. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

324. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

325. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

326. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

327. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

328. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

329. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

330. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

331. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

332. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

333. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

334. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

335. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

336. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

337. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

338. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

339. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

340. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

341. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

342. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

343. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

344. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

345. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

346. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

347. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

348. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

349. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

350. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

351. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

352. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

353. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

354. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

355. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

356. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

357. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtccct	Protospacer
*.**********..***********

358. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

359. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

360. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

361. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

362. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

363. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

364. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

365. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

366. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

367. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

368. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

369. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ctggcccttgatcgccttgaggtcgcc	Protospacer
*.********* ************

370. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaggcccttgaattccttgaggtccgg	Protospacer
  **********. ***********.*

371. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
cgattccttgaacgccttgatgtccag	Protospacer
* . .*************** ******

372. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
  .*.******** *************

373. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaggcccttgaattccttgaggtcctg	Protospacer
  **********. *********** *

374. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gtggtccttgaacaccttgaggtccac	Protospacer
 .**.********.************

375. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaactccttggggtccag	Protospacer
  .********** *****.*******

376. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

377. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

378. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

379. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    **************** ******

380. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

381. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497119 (Flavobacterium phage vB_Fsp_elemo8-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

382. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497112 (Flavobacterium phage vB_Fsp_elemo6-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

383. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497105 (Flavobacterium phage vB_Fsp_elemo3-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

384. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497091 (Flavobacterium phage vB_Fsp_elemo13-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

385. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497092 (Flavobacterium phage vB_Fsp_elemo13-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

386. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

387. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

388. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtcctt	Protospacer
*.**********..***********

389. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497078 (Flavobacterium phage vB_Fsp_elemo10-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

390. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497108 (Flavobacterium phage vB_Fsp_elemo4-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

391. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497121 (Flavobacterium phage vB_Fsp_elemo8-1D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

392. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497101 (Flavobacterium phage vB_Fsp_elemo2-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

393. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497069 (Flavobacterium phage vB_Fsp_elemo15-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

394. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497123 (Flavobacterium phage vB_Fsp_elemo8-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

395. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497079 (Flavobacterium phage vB_Fsp_elemo10-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

396. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497094 (Flavobacterium phage vB_Fsp_elemo14-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

397. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497076 (Flavobacterium phage vB_Fsp_elemo1-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

398. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497115 (Flavobacterium phage vB_Fsp_elemo7-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

399. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497082 (Flavobacterium phage vB_Fsp_elemo11-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

400. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497088 (Flavobacterium phage vB_Fsp_elemo13-1E, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

401. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497085 (Flavobacterium phage vB_Fsp_elemo12-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

402. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497095 (Flavobacterium phage vB_Fsp_elemo14-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

403. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497110 (Flavobacterium phage vB_Fsp_elemo5-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

404. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497096 (Flavobacterium phage vB_Fsp_elemo15-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

405. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497114 (Flavobacterium phage vB_Fsp_elemo7-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

406. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497120 (Flavobacterium phage vB_Fsp_elemo8-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

407. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497087 (Flavobacterium phage vB_Fsp_elemo13-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

408. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497117 (Flavobacterium phage vB_Fsp_elemo7-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

409. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497099 (Flavobacterium phage vB_Fsp_elemo15-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

410. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497097 (Flavobacterium phage vB_Fsp_elemo15-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

411. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497089 (Flavobacterium phage vB_Fsp_elemo13-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

412. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497070 (Flavobacterium phage vB_Fsp_elemo2-5C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

413. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497017 (Flavobacterium phage vB_Fsp_elemo7-9A, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

414. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497109 (Flavobacterium phage vB_Fsp_elemo5-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

415. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497104 (Flavobacterium phage vB_Fsp_elemo2-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

416. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497125 (Flavobacterium phage vB_Fsp_elemo9-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

417. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497118 (Flavobacterium phage vB_Fsp_elemo7-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

418. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497072 (Flavobacterium phage vB_Fsp_elemo6-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

419. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497077 (Flavobacterium phage vB_Fsp_elemo1-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

420. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

421. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497107 (Flavobacterium phage vB_Fsp_elemo3-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

422. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497113 (Flavobacterium phage vB_Fsp_elemo6-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

423. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497116 (Flavobacterium phage vB_Fsp_elemo7-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

424. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497065 (Flavobacterium phage vB_Fsp_elemo13-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

425. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497122 (Flavobacterium phage vB_Fsp_elemo8-3A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

426. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497106 (Flavobacterium phage vB_Fsp_elemo3-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

427. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497102 (Flavobacterium phage vB_Fsp_elemo2-5F, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

428. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497074 (Flavobacterium phage vB_Fsp_elemo1-5B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

429. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497098 (Flavobacterium phage vB_Fsp_elemo15-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

430. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497081 (Flavobacterium phage vB_Fsp_elemo11-5C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

431. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497103 (Flavobacterium phage vB_Fsp_elemo2-5G, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

432. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497124 (Flavobacterium phage vB_Fsp_elemo8-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

433. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497093 (Flavobacterium phage vB_Fsp_elemo14-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

434. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497083 (Flavobacterium phage vB_Fsp_elemo11-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

435. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaataccttgaggtccct	Protospacer
*.**********..***********

436. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497084 (Flavobacterium phage vB_Fsp_elemo12-1B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

437. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497086 (Flavobacterium phage vB_Fsp_elemo12-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

438. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497067 (Flavobacterium phage vB_Fsp_elemo14-1A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

439. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497066 (Flavobacterium phage vB_Fsp_elemo13-1C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

440. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497100 (Flavobacterium phage vB_Fsp_elemo2-5A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

441. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497071 (Flavobacterium phage vB_Fsp_elemo6-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

442. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497080 (Flavobacterium phage vB_Fsp_elemo10-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

443. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497111 (Flavobacterium phage vB_Fsp_elemo5-9B, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

444. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497075 (Flavobacterium phage vB_Fsp_elemo1-9A, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

445. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497073 (Flavobacterium phage vB_Fsp_elemo8-9C, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

446. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MT497090 (Flavobacterium phage vB_Fsp_elemo13-3D, partial genome) position: , mismatch: 5, identity: 0.815

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttcaactccttgaggtcctt	Protospacer
*.******* *** ***********

447. spacer 2.6|1825838|27|NZ_CP040515|CRT matches to NZ_CP012918 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence) position: , mismatch: 6, identity: 0.778

tagcgcccgccggcccttgagcacctt	CRISPR spacer
cggcgcccgccgtcccttgcgcacccc	Protospacer
..********** ****** *****..

448. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaggcccttgaggcccttgaggacctt	Protospacer
 .   ***************** ****

449. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaggtccttgaggcccttgaggcccct	Protospacer
 .   ********************.*

450. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

451. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

452. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

453. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
caggaccttgaggcccctgaggcccct	Protospacer
..  ************.********.*

454. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

455. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to EU246945 (Lactobacillus phage Lrm1, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggacctt	Protospacer
    *************** ** ****

456. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_011104 (Lactobacillus phage Lrm1, complete genome) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggacctt	Protospacer
    *************** ** ****

457. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_018687 (Bacillus thuringiensis MC28 plasmid pMC189, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaggcccttgaggcccttgaggacctt	Protospacer
 .   ***************** ****

458. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaggtccttgaggcccttgaggcccct	Protospacer
 .   ********************.*

459. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

460. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

461. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

462. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
caggaccttgaggcccctgaggcccct	Protospacer
..  ************.********.*

463. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gaataccttgaggtccttgaggtcctg	Protospacer
 . **********.********.***

464. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to EU246945 (Lactobacillus phage Lrm1, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggacctt	Protospacer
    *************** ** ****

465. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_011104 (Lactobacillus phage Lrm1, complete genome) position: , mismatch: 6, identity: 0.778

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggacctt	Protospacer
    *************** ** ****

466. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
 .   ******** *************

467. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
  .*.** ******************

468. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to NC_024385 (Leuconostoc phage phiLN12, complete genome) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaatgccttgtggtccaa	Protospacer
 . *********.****** ******.

469. spacer 2.19|1826432|27|NZ_CP040515|CRT matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
cgttccattgaacgccttgaggtcttc	Protospacer
.*** * *****************.

470. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

471. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

472. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
  .  ******** *************

473. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

474. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

475. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

476. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

477. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgtacgccttgcggtccag	Protospacer
  . ****** ******** *******

478. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

479. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ctggtccttgaacgccttgctggcatc	Protospacer
*******************  * *

480. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
ggattccttgaacgccttgatatccag	Protospacer
  . **************** .*****

481. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

482. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

483. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

484. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

485. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaagtccttgaaccccttgaggtccag	Protospacer
 .   ******** *************

486. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
  .*.** ******************

487. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to NC_024385 (Leuconostoc phage phiLN12, complete genome) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaatgccttgtggtccaa	Protospacer
 . *********.****** ******.

488. spacer 2.21|1826522|27|NZ_CP040515|CRT matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 6, identity: 0.778

tgttaccttgaacgccttgaggtccag	CRISPR spacer
cgttccattgaacgccttgaggtcttc	Protospacer
.*** * *****************.

489. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

490. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
  .  ******** *************

491. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

492. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

493. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP032924 (Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ccggcccttgaacgccttgaatacatc	Protospacer
********************.  *

494. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaatcccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

495. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaatcccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

496. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaagcccttcaacgccttgatgtccac	Protospacer
  .****** ********** *****

497. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
 *   ** ******************

498. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

499. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
gaattccttgtacgccttgcggtccag	Protospacer
  . ****** ******** *******

500. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

501. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

502. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

503. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to KC954774 (Cronobacter phage CR8, complete genome) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
gcgctccttggacaccttgaggtcctt	Protospacer
 .* *********.***********

504. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MN369758 (Gordonia phage NHagos, complete genome) position: , mismatch: 6, identity: 0.778

ctggtccttggacgccttgaggtccag	CRISPR spacer
caggtccttggacgccttgagcttgcc	Protospacer
* ******************* *.

505. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

506. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
gaattccttgtacgccttgcggtccag	Protospacer
  . ****** ******** *******

507. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

508. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

509. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MN369758 (Gordonia phage NHagos, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
caggtccttggacgccttgagcttgcc	Protospacer
* ******************* *.

510. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggcctccttgaacgccttgatgtccag	Protospacer
    ******.********* ******

511. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
gcggtcctcggacgccttgagttcggt	Protospacer
 *******.************ ** .

512. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NC_028672 (Cronobacter phage PBES 02, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
gctctccttggacaccttgaggtcctt	Protospacer
 *  *********.***********

513. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to NC_017974 (Cronobacter phage CR3, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttggacgccttgaggtccag	CRISPR spacer
gctctccttggacaccttgaggtcctt	Protospacer
 *  *********.***********

514. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

515. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ...*********.************

516. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

517. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
  .  ******** *************

518. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

519. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

520. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

521. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

522. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ...*********.************

523. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgtacgccttgcggtccag	Protospacer
  . ****** ******** *******

524. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

525. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
 *   ** ******************

526. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcattccttgaatgccttgaggtcctc	Protospacer
 *. ********.************

527. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
..*********** ******* ***

528. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
..***********.********.**

529. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
..*********** ******* ***

530. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
..***********.********.**

531. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggattccttgaacgccttgatatccag	Protospacer
  . **************** .*****

532. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

533. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

534. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

535. spacer 2.26|1826747|27|NZ_CP040515|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

536. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

537. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ...*********.************

538. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

539. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
  .  ******** *************

540. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

541. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

542. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

543. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

544. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ...*********.************

545. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgtacgccttgcggtccag	Protospacer
  . ****** ******** *******

546. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

547. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
 *   ** ******************

548. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcattccttgaatgccttgaggtcctc	Protospacer
 *. ********.************

549. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
..*********** ******* ***

550. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
..***********.********.**

551. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
..*********** ******* ***

552. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
..***********.********.**

553. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggattccttgaacgccttgatatccag	Protospacer
  . **************** .*****

554. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

555. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

556. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

557. spacer 2.27|1826792|27|NZ_CP040515|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

558. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

559. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
  .  ******** *************

560. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

561. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

562. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP032924 (Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108b, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
ccggcccttgaacgccttgaatacatc	Protospacer
********************.  *

563. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaatcccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

564. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaatcccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

565. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gaagcccttcaacgccttgatgtccac	Protospacer
  .****** ********** *****

566. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
 *   ** ******************

567. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

568. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ...*********.************

569. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

570. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaaccccttgaggtccag	Protospacer
  .  ******** *************

571. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaataccttgaactccttgaggtccag	Protospacer
  .  ******** *************

572. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

573. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

574. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttggggtccag	Protospacer
  . ********* *****.*******

575. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ...*********.************

576. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgtacgccttgcggtccag	Protospacer
  . ****** ******** *******

577. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaactccttgaggtcctg	Protospacer
  . ********* *********** *

578. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcctgccatgaacgccttgaggtccat	Protospacer
 *   ** ******************

579. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gcattccttgaatgccttgaggtcctc	Protospacer
 *. ********.************

580. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
..*********** ******* ***

581. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
..***********.********.**

582. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaactccttgagctcctt	Protospacer
..*********** ******* ***

583. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ttggtccttgaacaccttgaggccctc	Protospacer
..***********.********.**

584. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
ggattccttgaacgccttgatatccag	Protospacer
  . **************** .*****

585. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

586. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

587. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

588. spacer 2.29|1826882|27|NZ_CP040515|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.778

ccggtccttgaacgccttgaggtccag	CRISPR spacer
gaattccttgaattccttgaggtccag	Protospacer
  . ********. *************

589. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to EU246945 (Lactobacillus phage Lrm1, complete sequence) position: , mismatch: 7, identity: 0.741

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggcccca	Protospacer
    *************** *****.

590. spacer 2.11|1826063|27|NZ_CP040515|CRT matches to NC_011104 (Lactobacillus phage Lrm1, complete genome) position: , mismatch: 7, identity: 0.741

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggcccca	Protospacer
    *************** *****.

591. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to EU246945 (Lactobacillus phage Lrm1, complete sequence) position: , mismatch: 7, identity: 0.741

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggcccca	Protospacer
    *************** *****.

592. spacer 2.14|1826198|27|NZ_CP040515|CRT matches to NC_011104 (Lactobacillus phage Lrm1, complete genome) position: , mismatch: 7, identity: 0.741

tgttaccttgaggcccttgaggccctt	CRISPR spacer
gcaaaccttgaggcccttgcggcccca	Protospacer
    *************** *****.

593. spacer 2.20|1826477|27|NZ_CP040515|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.741

ctggtccttgaacgccttgaggtccag	CRISPR spacer
gcattccttgaatgccttgaggtcctc	Protospacer
 .. ********.************

594. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ....********.************

595. spacer 2.23|1826612|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ....********.************

596. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MH892385 (Streptococcus phage SW33, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

597. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MH892384 (Streptococcus phage SW32, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

598. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NC_028672 (Cronobacter phage PBES 02, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
gctctccttggacaccttgaggtcctt	Protospacer
 .  *********.***********

599. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MH892383 (Streptococcus phage SW31, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

600. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to KY705280 (Streptococcus phage P7954, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

601. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to NC_017974 (Cronobacter phage CR3, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
gctctccttggacaccttgaggtcctt	Protospacer
 .  *********.***********

602. spacer 2.24|1826657|27|NZ_CP040515|CRT matches to MH892362 (Streptococcus phage SW13, complete genome) position: , mismatch: 7, identity: 0.741

ctggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

603. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MH892385 (Streptococcus phage SW33, complete genome) position: , mismatch: 7, identity: 0.741

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

604. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MH892384 (Streptococcus phage SW32, complete genome) position: , mismatch: 7, identity: 0.741

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

605. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MH892383 (Streptococcus phage SW31, complete genome) position: , mismatch: 7, identity: 0.741

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

606. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to KY705280 (Streptococcus phage P7954, complete genome) position: , mismatch: 7, identity: 0.741

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

607. spacer 2.25|1826702|27|NZ_CP040515|CRT matches to MH892362 (Streptococcus phage SW13, complete genome) position: , mismatch: 7, identity: 0.741

ccggtccttggacgccttgaggtccag	CRISPR spacer
ggattccttggtcgccttgaggtccct	Protospacer
  . ******* *************

608. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ....********.************

609. spacer 2.28|1826837|27|NZ_CP040515|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ccggcccttgaacgccttgaggtccag	CRISPR spacer
gtaatccttgaacaccttgaggtccac	Protospacer
 ....********.************

610. spacer 2.3|1825703|27|NZ_CP040515|CRT matches to NC_012527 (Deinococcus deserti VCD115 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.704

tagcacctgctggtccctggacgcctt	CRISPR spacer
ggcggtgcgctggtccctggacgcctt	Protospacer
 .  .. .*******************

611. spacer 2.9|1825973|27|NZ_CP040515|CRT matches to NC_012527 (Deinococcus deserti VCD115 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.704

tagcacctgctggtccctggacgcctt	CRISPR spacer
ggcggtgcgctggtccctggacgcctt	Protospacer
 .  .. .*******************

612. spacer 2.12|1826108|27|NZ_CP040515|CRT matches to NC_012527 (Deinococcus deserti VCD115 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.704

tagcacctgctggtccctggacgcctt	CRISPR spacer
ggcggtgcgctggtccctggacgcctt	Protospacer
 .  .. .*******************

613. spacer 2.15|1826243|27|NZ_CP040515|CRT matches to NC_012527 (Deinococcus deserti VCD115 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.704

tagcacctgctggtccctggacgcctt	CRISPR spacer
ggcggtgcgctggtccctggacgcctt	Protospacer
 .  .. .*******************

614. spacer 2.18|1826378|36|NZ_CP040515|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 8, identity: 0.778

tagcacccgccggtccttgaataccttgaggtccag	CRISPR spacer
tcaatccggctggtccttgaataccttgaggtccct	Protospacer
* .  ** **.***********************

615. spacer 2.18|1826378|36|NZ_CP040515|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 8, identity: 0.778

tagcacccgccggtccttgaataccttgaggtccag	CRISPR spacer
cagcccgttgcggtccttgtacaccttgaggtccag	Protospacer
.*** * .  ********* *.**************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

558064 : 598513

Streptococcus_phage(12.5%)

transposase,protease,coat

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138320802.1\|558064_558778_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001180555.1\|558924_559110_+	hypothetical protein	NA	NA	NA	NA
WP_001002987.1\|559123_559372_+\|coat	spore coat protein	NA	NA	NA	NA
WP_138320804.1\|559368_560568_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_000666170.1\|560590_561604_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_000713766.1\|561660_562308_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_044791041.1\|562451_562979_+	hypothetical protein	NA	NA	NA	NA
WP_070807095.1\|563353_563743_-	hypothetical protein	NA	NA	NA	NA
WP_138320808.1\|563866_564253_+	hypothetical protein	NA	NA	NA	NA
WP_000218967.1\|564976_565342_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.7e-21	48.6
WP_000026900.1\|565383_565767_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000640869.1\|566023_566368_+	DNA primase	NA	NA	NA	NA
WP_000568169.1\|566380_566680_+	thioredoxin family protein	NA	NA	NA	NA
WP_000424933.1\|566832_567177_+	hypothetical protein	NA	NA	NA	NA
WP_138320810.1\|567709_568735_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-29	37.6
WP_000359556.1\|568727_569393_+	ABC transporter permease	NA	NA	NA	NA
WP_044791042.1\|569416_570229_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000722401.1\|570301_571108_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000929157.1\|571346_572132_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	7.5e-09	25.8
WP_000152165.1\|572147_573440_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_001020761.1\|573439_574660_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	3.6e-119	48.1
WP_000009523.1\|574649_575081_+	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001118823.1\|575129_576527_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_138320813.1\|577207_578599_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_000248463.1\|578664_578967_+	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_138320815.1\|579021_579753_+	sporulation protein YunB	NA	NA	NA	NA
WP_000944673.1\|579790_580774_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_000166370.1\|580963_581860_+	lipoyl synthase	NA	NA	NA	NA
WP_000272743.1\|581880_582360_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_138320817.1\|582434_582989_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_138320819.1\|583241_583685_+	hypothetical protein	NA	NA	NA	NA
WP_002163480.1\|583707_584523_-\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_138320821.1\|584608_585340_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000744209.1\|585377_585953_-	hypothetical protein	NA	NA	NA	NA
WP_138320823.1\|586071_586374_+	DUF1027 domain-containing protein	NA	NA	NA	NA
WP_138320825.1\|586410_586911_-	cytoplasmic protein	NA	NA	NA	NA
WP_000392606.1\|587283_587550_-	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_000439090.1\|587567_588539_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_000274015.1\|588686_589127_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000503352.1\|589198_589831_+	transcriptional regulator	NA	NA	NA	NA
WP_000276467.1\|589940_590705_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_044790599.1\|590995_592186_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	8.1e-31	37.9
WP_000683455.1\|592359_592941_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_044791002.1\|593551_594031_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000665103.1\|594054_594546_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_000581272.1\|594666_595668_+\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_138320827.1\|595729_595945_-	carbonic anhydrase	NA	NA	NA	NA
WP_000431159.1\|596139_596376_-	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_000248594.1\|596582_596891_+	YuzD family protein	NA	NA	NA	NA
WP_014481777.1\|596942_597737_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000379274.1\|597835_598513_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

1547259 : 1622361

Bacillus_phage(66.04%)

terminase,head,tRNA,integrase,portal,protease,tail

attL 1545397:1545412|attR 1577298:1577313

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1545397:1545412	attL	NA	NA	NA	NA
WP_044821769.1\|1547259_1548390_-\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	8.1e-65	38.8
WP_098756208.1\|1548728_1549538_+	hypothetical protein	NA	NA	NA	NA
WP_042512228.1\|1549538_1550402_+	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_042512229.1\|1550489_1550834_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	7.2e-17	38.4
WP_074544099.1\|1551271_1552369_+	hypothetical protein	NA	NA	NA	NA
WP_074544100.1\|1552381_1552531_+	hypothetical protein	NA	NA	NA	NA
WP_000153814.1\|1552793_1553162_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
WP_000516834.1\|1553380_1553608_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000284333.1\|1553659_1553860_+	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_042512231.1\|1553916_1554081_+	hypothetical protein	A0A0U3B230	Bacillus_phage	3.9e-21	90.7
WP_042512232.1\|1554110_1554287_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	1.1e-24	93.1
WP_138321198.1\|1554293_1555181_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	5.4e-48	96.0
WP_098756210.1\|1555149_1555953_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	2.5e-145	99.2
WP_098756211.1\|1555967_1556162_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	5.5e-22	81.2
WP_098756212.1\|1556178_1556457_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	6.0e-14	51.2
WP_087997019.1\|1556449_1556809_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	1.4e-31	53.3
WP_000717826.1\|1556828_1556996_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_074565272.1\|1557021_1557273_+	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	3.4e-16	50.0
WP_098756213.1\|1557292_1557802_+	dUTPase	A0A1L2JY27	Aeribacillus_phage	7.9e-28	45.4
WP_167495097.1\|1557840_1557987_+	hypothetical protein	NA	NA	NA	NA
WP_001037529.1\|1558025_1558211_+	hypothetical protein	NA	NA	NA	NA
WP_061131574.1\|1558407_1558632_+	hypothetical protein	NA	NA	NA	NA
WP_167495098.1\|1559571_1559745_+	hypothetical protein	Q2I8C4	Bacillus_phage	2.9e-06	49.1
WP_138321200.1\|1559777_1560062_+	hypothetical protein	NA	NA	NA	NA
WP_098756215.1\|1560095_1560359_+	hypothetical protein	A0A0U3K3K8	Bacillus_phage	5.1e-39	98.9
WP_000033083.1\|1560580_1560829_+	helix-turn-helix transcriptional regulator	A0A0U3J7D7	Bacillus_phage	8.8e-41	100.0
WP_098756216.1\|1561053_1561383_+	permease	NA	NA	NA	NA
WP_000645582.1\|1561400_1561523_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_098486940.1\|1561638_1561800_+	hypothetical protein	NA	NA	NA	NA
WP_061185055.1\|1561827_1562310_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.8e-72	82.5
WP_001012162.1\|1562309_1562852_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	92.2
WP_080444475.1\|1563188_1563371_+	hypothetical protein	D2XR59	Bacillus_phage	5.1e-22	88.3
WP_061185054.1\|1563583_1563838_+	hypothetical protein	H0USV8	Bacillus_phage	3.6e-13	67.7
WP_061185053.1\|1563861_1564074_+	hypothetical protein	H0USV9	Bacillus_phage	1.2e-27	87.1
WP_061185052.1\|1564206_1564431_+	hypothetical protein	A0A2H4J6K4	uncultured_Caudovirales_phage	1.3e-30	94.6
WP_001139457.1\|1564688_1565066_+	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	5.8e-68	97.6
WP_000242929.1\|1565195_1565699_+\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	2.3e-88	100.0
WP_048519764.1\|1565700_1567395_+\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	0.0e+00	99.6
WP_138321201.1\|1567583_1568837_+\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	2.4e-235	96.9
WP_001259163.1\|1568823_1569534_+\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	8.2e-124	94.9
WP_138321203.1\|1570764_1571052_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	1.4e-42	95.8
WP_138321205.1\|1571038_1571362_+\|head	phage head closure protein	A0A2H4J374	uncultured_Caudovirales_phage	4.1e-54	96.3
WP_016718563.1\|1571354_1571792_+\|head,tail	head-tail joining protein	A0A2H4J368	uncultured_Caudovirales_phage	2.3e-76	100.0
WP_138321207.1\|1571788_1572148_+	DUF3168 domain-containing protein	W8CYY6	Bacillus_phage	1.8e-58	92.4
WP_098756342.1\|1572148_1572757_+\|tail	phage tail protein	W8CYT6	Bacillus_phage	4.2e-100	92.6
WP_138321209.1\|1572807_1573125_+	hypothetical protein	A0A288WFU2	Bacillus_phage	2.3e-49	92.4
WP_000344046.1\|1573154_1573331_+	hypothetical protein	I3WTY5	Bacillus_phage	7.2e-21	86.2
WP_138321211.1\|1573346_1577198_+\|tail	phage tail tape measure protein	A0A2H4J380	uncultured_Caudovirales_phage	0.0e+00	95.2
WP_138321213.1\|1577212_1578694_+\|tail	phage tail family protein	H0USX4	Bacillus_phage	4.8e-275	91.5
1577298:1577313	attR	NA	NA	NA	NA
WP_138321215.1\|1578690_1582770_+	hypothetical protein	H0USX5	Bacillus_phage	0.0e+00	82.0
WP_138321217.1\|1582792_1583242_+	hypothetical protein	A0A2H4J6F8	uncultured_Caudovirales_phage	1.5e-78	96.0
WP_000398738.1\|1583412_1583649_+	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	100.0
WP_000253959.1\|1583648_1583888_+	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	1.0e-33	100.0
WP_098756270.1\|1583884_1584949_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	6.9e-199	96.0
WP_138321219.1\|1584987_1585512_-	hypothetical protein	NA	NA	NA	NA
WP_074543752.1\|1585894_1586743_+	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	2.7e-20	38.6
WP_138321221.1\|1586866_1587358_-	hypothetical protein	Q3HL01	Bacillus_phage	5.2e-69	85.3
WP_001237240.1\|1587350_1587563_-	helix-turn-helix domain-containing protein	Q2I8E4	Bacillus_phage	2.3e-29	95.7
WP_001267634.1\|1587746_1588049_+	hypothetical protein	Q2I8E3	Bacillus_phage	1.0e-46	90.0
WP_098756267.1\|1588052_1588235_+	hypothetical protein	Q2I8E2	Bacillus_phage	1.7e-20	88.3
WP_074543749.1\|1588352_1589534_+	cell division protein FtsK	A0A288WFS1	Bacillus_phage	8.4e-198	85.5
WP_002163540.1\|1589475_1590093_+	hypothetical protein	Q2LIA9	Bacillus_phage	2.5e-100	88.6
WP_000872145.1\|1590377_1590878_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_001984764.1\|1590939_1591113_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_000246478.1\|1591241_1591748_+	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	1.0e-11	35.5
WP_000506707.1\|1591783_1592257_-	N-acetyltransferase	NA	NA	NA	NA
WP_052587750.1\|1592550_1593441_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000403051.1\|1593520_1595137_+	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000481789.1\|1595505_1596438_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_000067081.1\|1596453_1596816_+	cell division protein FtsL	NA	NA	NA	NA
WP_044791553.1\|1596888_1598988_+	penicillin-binding protein	NA	NA	NA	NA
WP_001266227.1\|1599069_1600986_+	stage V sporulation protein D	NA	NA	NA	NA
WP_000766299.1\|1601194_1602670_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_000893058.1\|1602692_1603667_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_138321223.1\|1603667_1605020_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000753511.1\|1605110_1606202_+	stage V sporulation protein E	NA	NA	NA	NA
WP_001265415.1\|1606307_1607402_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000437033.1\|1607463_1608369_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_138321225.1\|1608467_1609238_+	cell division protein DivIB	NA	NA	NA	NA
WP_001087553.1\|1609639_1610947_+	cell division protein FtsA	NA	NA	NA	NA
WP_000888991.1\|1610986_1612141_+	cell division protein FtsZ	NA	NA	NA	NA
WP_000261994.1\|1612456_1613374_+	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000976948.1\|1613393_1614113_+	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000197753.1\|1614270_1615050_+	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_001998116.1\|1615217_1615502_+	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_001209002.1\|1615619_1616438_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_000218033.1\|1616434_1617109_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_000119138.1\|1617128_1617599_+	cell division protein SepF	NA	NA	NA	NA
WP_000450919.1\|1617605_1617869_+	YggT family protein	NA	NA	NA	NA
WP_000029726.1\|1617884_1618652_+	RNA-binding protein	NA	NA	NA	NA
WP_001131612.1\|1618741_1619248_+	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000455926.1\|1619595_1622361_+\|tRNA	isoleucine--tRNA ligase	A0A2P1ELB8	Moumouvirus	4.1e-86	27.3

DBSCAN-SWA_3

4983571 : 4991944

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088582.1\|4983571_4984159_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	5.9e-27	37.1
WP_001262432.1\|4984155_4985196_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	7.2e-68	45.9
WP_000879024.1\|4985298_4986714_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_000055576.1\|4986698_4988918_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000666779.1\|4988901_4989585_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278826.1\|4989581_4989836_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170542.1\|4989828_4990548_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000625677.1\|4990636_4991944_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040515

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection