CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	0 crisprs	csa3	0
NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	0 crisprs	DEDDh,WYL,csa3	0
NZ_CP054027	Rhizobium sp. JKLM19E chromosome, complete genome	2 crisprs	csa3,DEDDh,cas3,WYL	4
NZ_CP054030	Rhizobium sp. JKLM19E plasmid pPR19E03	0 crisprs	NA	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP054027_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054027_1

3160257-3160355

Orphan

Consensus_repeat	Method
CCCTCTCCCCGCAGGCGGGGAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054027_1

>merge|NZ_CP054027|1|3160257-3160355|CRISPRCasFinder
CCCTCTCCCCGCAGGCGGGGAGAGGGGACGTGCCAAACGCAACGTCGAGGATTGACGAAGCCGGTGCGGCATATCCCCTTCTCCCCGCAGGCGGGGAGA

>NZ_CP054027|1|1|3160257-3160355|CRISPRCasFinder
CCCTCTCCCCGCAGGCGGGGAGA	GGGGACGTGCCAAACGCAACGTCGAGGATTGACGAAGCCGGTGCGGCATATCC
CCTTCTCCCCGCAGGCGGGGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054027.1\|WP_138384734.1\|3152623_3154051_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP054027.1\|WP_138384725.1\|3165397_3166156_+\|phosphoadenylyl-sulfate-reductase	unknown	unknown	gnl\|CDD\|273945
NZ_CP054027.1\|WP_138384732.1\|3155107_3156913_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
NZ_CP054027.1\|WP_138384726.1\|3162664_3163051_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_003569590.1\|3164531_3164978_-\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_CP054027.1\|WP_138384729.1\|3158757_3160221_+\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|183918
NZ_CP054027.1\|WP_173883789.1\|3150301_3150448_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_138384724.1\|3169250_3170204_+\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NZ_CP054027.1\|WP_025415622.1\|3151897_3152521_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
NZ_CP054027.1\|WP_003569593.1\|3167225_3168722_+\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|235349
NZ_CP054027.1\|WP_138384735.1\|3150661_3151873_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341024
NZ_CP054027.1\|WP_003569589.1\|3163187_3164531_+\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238506
NZ_CP054027.1\|WP_138384731.1\|3157069_3157312_-\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	unknown	unknown	gnl\|CDD\|226136
NZ_CP054027.1\|WP_003569592.1\|3166270_3167224_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP054027.1\|WP_025415607.1\|3170260_3171181_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP054027.1\|WP_138384727.1\|3162173_3162647_-\|DUF2214-domain-containing-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_037092283.1\|3158174_3158756_+\|transcriptional-regulator-BetI	unknown	unknown	gnl\|CDD\|179115
NZ_CP054027.1\|WP_138384730.1\|3157419_3158019_-\|HdeD-family-acid-resistance-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP054027.1\|WP_138384728.1\|3160436_3162089_+\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|235000
NZ_CP054027.1\|WP_138384733.1\|3154031_3155030_-\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180

Protein	Function_ID	Function_description	E-value
NZ_CP054027.1\|WP_138384734.1\|3152623_3154051_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	5.79437e-26
NZ_CP054027.1\|WP_138384725.1\|3165397_3166156_+\|phosphoadenylyl-sulfate-reductase	gnl\|CDD\|273945	TIGR02055, Phosphoadenosine_phosphosulfate_reductase, thioredoxin-dependent adenylylsulfate APS reductase. This model describes recently identified adenosine 5'-phosphosulfate (APS) reductase activity found in sulfate-assimilatory prokaryotes, thus separating it from the traditionally described phosphoadenosine 5'-phosphosulfate (PAPS) reductases found in bacteria and fungi. Homologous to PAPS reductase in enterobacteria, cyanobacteria, and yeast, APS reductase here clusters with, and demonstrates greater homology to plant APS reductase. Additionally, the presence of two conserved C-terminal motifs (CCXXRKXXPL & SXGCXXCT) distinguishes APS substrate specificity and serves as a FeS cluster. [Central intermediary metabolism, Sulfur metabolism].	2.00856e-99
NZ_CP054027.1\|WP_138384732.1\|3155107_3156913_-\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	7.29266e-61
NZ_CP054027.1\|WP_025415607.1\|3170260_3171181_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.3418e-60
NZ_CP054027.1\|WP_003569590.1\|3164531_3164978_-\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	3.52115e-44
NZ_CP054027.1\|WP_138384729.1\|3158757_3160221_+\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|183918	PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional.	0
NZ_CP054027.1\|WP_138384735.1\|3150661_3151873_+\|MFS-transporter	gnl\|CDD\|341024	cd17471, MFS_Set, Sugar efflux transporter (Set) family of the Major Facilitator Superfamily of transporters. This family is composed of sugar transporters such as Escherichia coli Sugar efflux transporter SetA, SetB, SetC and other sugar transporters. SetA, SetB, and SetC are involved in the efflux of sugars such as lactose, glucose, IPTG, and substituted glucosides or galactosides. They may be involved in the detoxification of non-metabolizable sugar analogs. The Set family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.25458e-52
NZ_CP054027.1\|WP_138384724.1\|3169250_3170204_+\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.10183e-70
NZ_CP054027.1\|WP_025415622.1\|3151897_3152521_-\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	4.33905e-53
NZ_CP054027.1\|WP_003569593.1\|3167225_3168722_+\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
NZ_CP054027.1\|WP_003569589.1\|3163187_3164531_+\|chloride-channel-protein	gnl\|CDD\|238506	cd01034, EriC_like, ClC chloride channel family. These protein sequences, closely related to the ClC Eric family, are putative halogen ion (Cl-, Br- and I-) transport proteins found in eubacteria. They belong to the ClC superfamily of chloride ion channels, which share a unique double-barreled architecture and voltage-dependent gating mechanism. This superfamily lacks any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. The voltage-dependent gating is conferred by the permeating anion itself, acting as the gating charge.	3.32119e-139
NZ_CP054027.1\|WP_138384731.1\|3157069_3157312_-\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	gnl\|CDD\|226136	COG3609, COG3609, Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain [Transcription].	8.46706e-10
NZ_CP054027.1\|WP_003569592.1\|3166270_3167224_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP054027.1\|WP_037092283.1\|3158174_3158756_+\|transcriptional-regulator-BetI	gnl\|CDD\|179115	PRK00767, PRK00767, transcriptional regulator BetI; Validated.	2.40111e-96
NZ_CP054027.1\|WP_138384730.1\|3157419_3158019_-\|HdeD-family-acid-resistance-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	3.25324e-33
NZ_CP054027.1\|WP_138384728.1\|3160436_3162089_+\|choline-dehydrogenase	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_CP054027.1\|WP_138384733.1\|3154031_3155030_-\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0

>NZ_CP054027.1|WP_138384729.1|3158757_3160221_+|betaine-aldehyde-dehydrogenase
MKAQPKASHFIDGEYVEDTDGTVIESLYPATGEVIARLHAATPAIIEKAIAAAKRAQPEWAAMSPMARGRILKRAAEIMRERNRSLSELETLDTGKPIQETIVADPTSGADAFEFFGGVAPAGLNGAHIPLGQDFAYTKRVPLGVCVGIGAWNYPQQIACWKAAPALVCGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQGDRDTGPLLVNHADVAKVSLTGSVPTGRRVAAAAAGNLKHVTMELGGKSPLIVFDDADLDSAVGGAMLGNFYSTGQVCSNGTRVFVQKGIKTEFLKRLKARTEAMLIGDPMDEATQIGPMVSWAQREKVIAYIEKGKSEGATLVAGGGIPNNVAGEGYYVQPTVFADVTDEMTIAREEIFGPVMSVLDFDDEDEVIARANASEFGLSGGVFTADLTRAHRVVDRLEAGTLWINTYNLCPVEIPFGGSKQSGFGRENSLAALEHYSELKTVYVGMGPVAAPY
>NZ_CP054027.1|WP_037092283.1|3158174_3158756_+|transcriptional-regulator-BetI
MEPVRRKALVDAALRVIGDHGSLAVTMSDIARQAGVSPALAHHYFGSKEQLLIETIRSLLRQLRHDTVAALAVARTPRERLSAIIRVNFHADQFAPETIAAWLAFYAEAQRSEETRRFLVIYASRLRSNLLADLKALLPAEAAERIAEGAAAMIDGLYIRQSLKSAPIGIEASIALTEDYLNALLSTTSPKDK
>NZ_CP054027.1|WP_138384730.1|3157419_3158019_-|HdeD-family-acid-resistance-protein
MADVFNAEPTTSSLQSKWIWFVGLGVLLLVCGLIALGNLMLATVVSVYYVGMLMLFGGVVYLVHAFQVRGWDHVLFWALSGLLYVLAGICAFVNPILTSAALTLFLSLALVIAGVFRTWVGVRMKPTKGWRWVVASGVITALAGFVIALGWPVNSLWILGLFLAADLIVQGWTMIAFGLGIRSGPAESDAPAPLSDRSF
>NZ_CP054027.1|WP_138384731.1|3157069_3157312_-|type-II-toxin-antitoxin-system-ParD-family-antitoxin
MPMVTVSISPQQAAGIRAAVDTGGYASSSEVVREALRLWDTARKLNEFRDDVLDDEGAPSGGRCVADMFADHEAERRRTA
>NZ_CP054027.1|WP_138384732.1|3155107_3156913_-|EAL-domain-containing-protein
MSLAATVEPGVLRRYASDQIVTLAKLVVENAFQPIVEAGTGTVFGYESLMRGQERIGYDTPVDILDEAHQAGQLLQFEQMLASRALAKFATLSNFSTATLFLNLDVRLIPHGERLIESLLQHLRKANIPPSSVCFEFSERFDNTSVPEFAGLVSKLRKAGFKLAIDDFGVGHGEMKLLCDHAVDYLKIDRHFVAEIDRSPRKRHLLKSIVNIAHVLGTRVIAEGIETEAEFIACREYGVDLVQGWFISRPTTHMSELAPSFPHLQELGKTKRGSQSLDEILIRKQIELLPTVYENDSIDSVFELFRRNPRQAFFPVLNANDEPRGIIHEQHLKEYIYQPFGRDLLKNKMYERSISHFVEMAPIVGLDSDAEQLMAIFANMEGSNCLILTDNMRYAGVVSAASLIKVINEKQLKTAQDQNPLTGLPGNRAIRDFMRQSGRDGDEVRHFCYCDFDNFKPFNDAYGFHLGDHAISLFAALMRRYFFAERHFLGHVGGDDFFIGVVGWTKEELTEILDRLIGDFHDDVLDLYSDEHRAAGRILGHDRAGAEALFPLMRCSIGVIELPEGLVIDDINRVSAEIAVIKSAAKESDDGLVFHPLGEAN
>NZ_CP054027.1|WP_138384733.1|3154031_3155030_-|NAD(P)H-quinone-oxidoreductase
MPLPQEMRFVDLPSFGGPEVMTIGRGPLPEPGEGQVLVRAEAVGVNRPDVAQRQGSYPAPKDASPILGLELAGEIVAIGPGVSGYSPGDKVCGLANGGAYAEYCLLPAGQILPVPKGYDAVKAAALPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGAEVYATAGSAQKCEACERLGAKRAINYRSEDFAAVIKAETGQGVDIILDMIGASYFERNLASLAKDGCLSIIAFLGGAVVEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVVEAHRLMEDGSHVGKIMLRVD
>NZ_CP054027.1|WP_138384734.1|3152623_3154051_+|MFS-transporter
MSDIDQTATIANASSLLRLFLPEHLPATLILAGGVTLYAVETYIMATIAPSIVRDIGGLALFSWVTSLFVAAAVLGSIFVAMRPRGIGLRAVYVIAALVFGVGSLIAATAPSMPVVLIGRAVQGLGTGALAALGYAFIRFVFPEPLWTKASTLYAAIWGVATVIGPTLGGFFSGGSNWRYAFVVLVPLGLAMAVLAPRLLPEVEDDRDHAKTPRAQIGLLLGAVLMVSTAGTIETMAAKIALIAASVVAVAGMLFIEGRSPNRLLPSGAVSFSRPIARVYLTMLAMAIVLVSDVFIPYFLQVLHGVTPLVSGYLVALVALGWTFAAFLSGSLTGRQAYFAIIAGALIEAAATASLAAFLANDNPHAQMLFIVPAAIGMFMMGFGVGLGWAHLVAMVLTLVADSEQDKASAAIPTMSSLGGAFGAAFAGLIANGAGLVDPGGIAGALSAAYWLYLLTALPGVLAVGVSLTLNRRAA
>NZ_CP054027.1|WP_025415622.1|3151897_3152521_-|transcriptional-regulator
MRQSPANRILILIKTDGPQLGGAIGDALGISAEAARQQLAKLAEQGLVEPVTIGATGRGRPRQLWHLTAAGNRQFPDGHAELTANLLVTLVEQLGPAALDTVISAREADTLQRYRLELENAGDLAARVEVLAAIRTREGYMADHWQEADGSFTLVENHCPICAAATACAGFCRSELETFRTALGADVERREHILAGARRCAYRITPR
>NZ_CP054027.1|WP_138384735.1|3150661_3151873_+|MFS-transporter
MPSTFSLILGDNRIRIPTVTLIALAFTYASTAPYQSIIGINELGLSNGTYSSLIFFSAIVNVTTSLTLGIWSDRLKERRPLVLGLSVAGMLGFGSIAIFHNPAVFIVSTLLLVPMSNSTYSLLFASLRARTNQMDRGQGAAVTATVRALFSGSWALAPGLIGLYLVNSPSMTPAYGIAAFASLTCFCLYFFFAPGNGTAGRAPDPVGFLASLKRIFMPYVLVRVIVMALLFGLQRLNSMLLPLIITHAAGGTVVDVGFIAGLTALLEMPFMMMWGMAQRRFRTVHVLAFGALIYCAYLLLLGFASAPWHIYALLLLNAGGAAAILSVPITYLQDLIADRPGLGTSLISLNTFIGTGIAAGLFAFGTSVSDYSGTAFVGAAAGLASVGVLLYLESSRRQARQPA
>NZ_CP054027.1|WP_173883789.1|3150301_3150448_-|hypothetical-protein
MTKVGATTCCSAARRLLQTLTPLSVVLGLEPSIHDTSTSGRRPNSGVT
>NZ_CP054027.1|WP_138384728.1|3160436_3162089_+|choline-dehydrogenase
MQQADFVIIGSGSAGSALAYRLSEDGQNSVLVIEAGGSDFGPFIQMPAALAWPMSMKRYNWGYLSEPEPNLNNRRITAPRGKVIGGSSSINGMVYVRGHAEDFNRWEELGASGWAYADVLPYFKRMEHSHGGEDGWRGTDGPLHVQRGGFTNPLFRAFIEAGKQAGFETTEDYNGSKQEGFGLMEQTIFAGRRWSTANAYLKPALKRKNVGIVYAFARKIVIEDGRATGVEIERNGKVEVVRANREVIVSASSFNSPKLLMLSGIGPGEHLKEMGIEVKADRPGVGANLQDHMEFYFQQVSTKPVSLYSWLPWFWQGVAGAQWLLSKGGLGASNQFEACAFLRSAPGLKQPDIQYHFLPVAISYDGKAAAKSHGFQVHVGYNLSKSRGSVSLRSSDPKADPVLRFNYMSHAEDWEKFCHCVRLTRELFGQSAFDDYRGAEIQPGEGVQSDDEIDAFLREHLESAYHPCGTCKMGAKDDPMAVVDPQTRVIGVDGLRVADSSIFPHVTYGNLNGPSIMTGEKAADHILGKQPLARSNQEPWVNPRAAISDR
>NZ_CP054027.1|WP_138384727.1|3162173_3162647_-|DUF2214-domain-containing-protein
MIDILEWLSATTPAVALRRSGTLYMFVNAAHILAIGLLVGAILPLDLRLAGFFRKVPVDIVAPFLSRSAGVGLVLAIATGFCLFSVRAVEYAENPAFLAKLGLIAFGLLNLLTVHVGRGWKTLIATGVIRPSLRVSAALSVAIWIAAVLAGRWIGFL
>NZ_CP054027.1|WP_138384726.1|3162664_3163051_-|hypothetical-protein
MLPISIQRVVAAAMLSMSFATGAIAHHGWSWAEADQIELRGTIEKISMGGPHPTLDVATTDDGLWRVELGNPRQTERSGFVEGVAKPGDQVVALGNRSQDPKEKRMKAVRITIGEKRYDIYPDRIRTN
>NZ_CP054027.1|WP_003569589.1|3163187_3164531_+|chloride-channel-protein
MPVLYRKSRLLRRSRVLWGSFSVWRPRLIFWFGALAIGVISVGFARLADLAQHAFAGVTASGQWSFLLPLIITPLGFMLSAYLAATFFPNAQGSGIPQAIAARHLRDPDDRARLLSLRLVVGKIVLTVLGLASGASIGREGPTVQVGASIMLAVARFGGMAQARGLILAGSAAGIAAAFNTPLAGVVFAIEEMSRTYESRANGLVLTAVILSGLAALGLAGSYSYFGSAAVAPASVRDWELVLVCGIGGGALGAIFSGLALHLGQHVRRWAHPQPLRRMVMLATVCGLAVAVIGILSDGTTFGTGYDQAKAAVEGNPLPLLFFLEKLLAGFLSMISGIPGGIFAPSLAVGAGFGSTVGSLLGSSIALAAILGMAGYFSGVVQAPMTAFVIILEMTGDHQAVIPIMAVSMIGYITSRILSREPLYHGLSRVFIAAAIRARRARETVES
>NZ_CP054027.1|WP_003569590.1|3164531_3164978_-|Rrf2-family-transcriptional-regulator
MITQKAKYALRALTVLADADADEPVMISDIAAQQKIPKKFLEQILLDLKHHGIVVSRRGKQGGYLLLKPAHTITFGEILRIIDGPIAPLPCLSITAYRRCDDCDGEQNCQIRHVFAKVADATRKVLFSTTIADAVGPRHGAEVTRLLA
>NZ_CP054027.1|WP_138384725.1|3165397_3166156_+|phosphoadenylyl-sulfate-reductase
MTVIKSIAEKGPIAEAEALNARLAGLDLAGRLSLVAGLGGRVVFTTSLGIEDQVITAEIGTHRLPIDVATLQTGRLFAETLALIEETESQYDIKIQRYEPEKADIDAYAAQYGLNGFYESVEARHACCGVRKLKPLARALEGAAIWVTGLRRGQSANRAETPFAEYEAERHLLKVNPLADWDLEAIKAFVSANGVPVNPLHARGYPSIGCEPCTRAIKPGEPERAGRWWWEQDETRECGLHVAEEAAAVAAV
>NZ_CP054027.1|WP_003569592.1|3166270_3167224_+|sulfate-adenylyltransferase-subunit-CysD
MPDSRPDTELSNPQSAKAPLDPHLKALENESIHIFREVAAEFERPVMLYSIGKDSSVLLHLARKAFYPGRVPFPLLHVNTGWKFREMIAFRDATAKKYDLDLIEHINPRGAAENITPFTHGSAAFTDIMKTEGLRQALDAGQFDAAFGGARRDEEASRAKERIYSFRTPDHRWDPRNQRPELWNVYNGMIRKGESVRAFPLSNWTEVDIWRYIQAEDIPLVPLYYAKKRPFVERDGMMILAEDPRLELLPGEVRQEGMIRFRTLGDFPLTGAIRSEATTLEEVIAELEIATVSERQGRAIDRDQSGSMEKKKREGYF
>NZ_CP054027.1|WP_003569593.1|3167225_3168722_+|sulfate-adenylyltransferase-subunit-CysN
MTVVQTAVSAATAVSLPAAEPQKAQRDSRPLRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAATLQRDSTGKQNDLGLPDFALLLDGLQAEREQGITIDVAYRYFSTDKRSFIVADTPGHEQYTRNMATGASTADLAILLVDARFGILEQTRRHATIASLLGIKQFVLAVNKIDLTGYDRAGFDKISHEFREFALSLGVKQITAIPMSALKGENVVYSGQAAMPWYSGPTLVETLELATVRSSQTVGFRLSVQRVSRPGESFRGYQGTVAGGSVKPGDSVMILPSGMVANVSKIVTFDLVRNAAVAGDAITLVLDRQVDVARGDMIVSIDAQPQVGLAFDAQIVALQPEGIEPGKRYWLKSGSRRQRVQVQPLSQLELKTGTWNAAQRLYMNAIGKVRLVFDEAAIFDPYEQNRQSGSFILIDPETNNTVAGGMVTGKRTELGGLHNGEGRVILSLPADLAEQIMASELFASRSHEAEVRRMTAAEAADLWSSAASDI
>NZ_CP054027.1|WP_138384724.1|3169250_3170204_+|NmrA/HSCARG-family-protein
MSTDSKPLIAVMGATSKQGRSVVATLLESQRFRVRAFTRRKDSPEALRLEQLGAEIATVPLELGLQKELVAAFKGADGAFLMTPPIAPPETSEAPLGRQLADAAVEAGIGHIVFSTLENVDKIAGGTKYAPHFTDKARVADYIRGLPISHSFIMLAFFYTNLLEYYAPRMEGDTLLLPIYLPEDFAAPFVDPLTATGPVVLEIFSNPERYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLHYFPEFAANEFLVREILGMVEYAVEYGYFGKEHDLEWSRRLNPETLDWEQFLRTTGWRGDKRSFGG
>NZ_CP054027.1|WP_025415607.1|3170260_3171181_-|LysR-family-transcriptional-regulator
MDKAGLSFDRMRTFVRVAERGNLSMVARELGVGQSTVTRHLNELEEAVGVPLLSRTTRRVTLTDEGSRYYTNCLQILRLVEQAAEEARDARQAPAGAVRLSCTAALGVMHVTRMIFDFQDRHPDIRVDLNLTDERIDLVREGVDVALRLGPLADSAMKLHALGESQRLLVGAPAYLSVRGRPQRPADLSRYETVVMSNVAGSNQLLLSSPDGTSLVVPVSGRLRVDHGLAAREALAAGRGIGPTHLWLIHDLLDDGRLEVVLGDYRPSPVPVSLLIVPERAAIARVRLLVDFLAAEISKLPGIRQS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP054027_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP054027_2

3282355-3282503

Orphan

Consensus_repeat	Method
TGCCGCGCCCTATCCCGGCCCTTCGCTTTGGGCTCAGGGCGTTCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP054027_2

>merge|NZ_CP054027|2|3282355-3282503|CRISPRCasFinder
TGCCGCGCCCTATCCCGGCCCTTCGCTTTGGGCTCAGGGCGTTCGCCGCTGCAATCTGGATCGATTGCTGCCGCCTGCGGCGCACCGGTACGCGGGTCGCGTTTGCCGCGCCCTATCCCGGCCCTTCGCTTGGGCTCAGGGCGTTCGCA

>NZ_CP054027|2|2|3282355-3282503|CRISPRCasFinder
TGCCGCGCCCTATCCCGGCCCTTCGCTTTGGGCTCAGGGCGTTCGC	CGCTGCAATCTGGATCGATTGCTGCCGCCTGCGGCGCACCGGTACGCGGGTCGCGTT
TGCCGCGCCCTATCCCGGCCCTTCGCTTGGGCTCAGGGCGTTCGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP054027.1\|WP_138385135.1\|3279977_3281699_+\|DUF4166-domain-containing-protein	unknown	unknown	gnl\|CDD\|379359
NZ_CP054027.1\|WP_138385138.1\|3276644_3278204_-\|SAM-dependent-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223363
NZ_CP054027.1\|WP_003569758.1\|3294075_3295077_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380531
NZ_CP054027.1\|WP_003569745.1\|3284152_3284398_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_138385131.1\|3289270_3292732_-\|chromosome-segregation-protein-SMC	unknown	unknown	gnl\|CDD\|224117
NZ_CP054027.1\|WP_138385140.1\|3274874_3275297_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_138385141.1\|3272745_3274878_-\|DUF262-domain-containing-protein	unknown	unknown	gnl\|CDD\|377008
NZ_CP054027.1\|WP_138385136.1\|3279531_3279981_+\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|225556
NZ_CP054027.1\|WP_138385142.1\|3269537_3272723_-\|type-I-restriction-endonuclease-subunit-R	unknown	unknown	gnl\|CDD\|223683
NZ_CP054027.1\|WP_003569739.1\|3284523_3284721_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_138385133.1\|3282553_3283459_-\|DUF1499-domain-containing-protein	unknown	unknown	gnl\|CDD\|377828
NZ_CP054027.1\|WP_138385134.1\|3281718_3282267_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_138385143.1\|3268983_3269475_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_097537542.1\|3283747_3284137_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP054027.1\|WP_138385139.1\|3275293_3276652_-\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341197
NZ_CP054027.1\|WP_025415534.1\|3292840_3293617_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372611
NZ_CP054027.1\|WP_003569761.1\|3295103_3296036_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP054027.1\|WP_138385137.1\|3278598_3279507_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP054027.1\|WP_138385132.1\|3285574_3288283_-\|pyruvate,-phosphate-dikinase	unknown	unknown	gnl\|CDD\|236446
NZ_CP054027.1\|WP_025415536.1\|3285262_3285538_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP054027.1\|WP_138385135.1\|3279977_3281699_+\|DUF4166-domain-containing-protein	gnl\|CDD\|379359	pfam13761, DUF4166, Domain of unknown function (DUF4166). This domain is often found at the C-terminus of proteins containing pfam03435.	2.04252e-31
NZ_CP054027.1\|WP_138385133.1\|3282553_3283459_-\|DUF1499-domain-containing-protein	gnl\|CDD\|377828	pfam07386, DUF1499, Protein of unknown function (DUF1499). This family consists of several hypothetical bacterial and plant proteins of around 125 residues in length. The function of this family is unknown.	2.12979e-06
NZ_CP054027.1\|WP_003569758.1\|3294075_3295077_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380531	cd06308, PBP1_sensor_kinase-like, periplasmic binding domain of two-component sensor kinase signaling systems. Periplasmic binding domain of two-component sensor kinase signaling systems, some of which are fused with a C-terminal histidine kinase A domain (HisK) and/or a signal receiver domain (REC). Members of this group share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily and are predicted to be involved in sensing of environmental stimuli; their substrate specificities, however, are not known in detail.	1.6188e-101
NZ_CP054027.1\|WP_138385131.1\|3289270_3292732_-\|chromosome-segregation-protein-SMC	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	0
NZ_CP054027.1\|WP_138385137.1\|3278598_3279507_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	7.39405e-85
NZ_CP054027.1\|WP_138385136.1\|3279531_3279981_+\|DUF393-domain-containing-protein	gnl\|CDD\|225556	COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only].	2.24415e-35
NZ_CP054027.1\|WP_138385142.1\|3269537_3272723_-\|type-I-restriction-endonuclease-subunit-R	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	0
NZ_CP054027.1\|WP_138385138.1\|3276644_3278204_-\|SAM-dependent-DNA-methyltransferase	gnl\|CDD\|223363	COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms].	6.30974e-136
NZ_CP054027.1\|WP_138385141.1\|3272745_3274878_-\|DUF262-domain-containing-protein	gnl\|CDD\|377008	pfam03235, DUF262, Protein of unknown function DUF262.	9.09028e-23
NZ_CP054027.1\|WP_138385139.1\|3275293_3276652_-\|restriction-endonuclease-subunit-S	gnl\|CDD\|341197	cd17516, RMtype1_S_HinAWORF1578P-TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.HinAWORF1578P TRD2-CR2. Haemophilus influenzae RdAW S subunit (S.HinAWORF1578P) recognizes 5'... CTANNNNNGTTY ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	3.01604e-93
NZ_CP054027.1\|WP_003569761.1\|3295103_3296036_-\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	2.5061e-81
NZ_CP054027.1\|WP_025415534.1\|3292840_3293617_-\|DsbA-family-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	1.73209e-47
NZ_CP054027.1\|WP_138385132.1\|3285574_3288283_-\|pyruvate,-phosphate-dikinase	gnl\|CDD\|236446	PRK09279, PRK09279, pyruvate phosphate dikinase; Provisional.	0

>NZ_CP054027.1|WP_138385134.1|3281718_3282267_-|hypothetical-protein
MFDPERQRFGVRSYTVIAWSVVSLFAIVTLASLPTCSGRHWTSALPPQFEIGQRLSYGSRQNGAGTCGAVIYQLSYAQTQKVRRRGIEAFPADLKGPDGLQYEQWAETPVPNELHERYILNTAGLPVGLDCSHGTWEKEWRANAEQSGNYYTTNGKALILLQVSDLQVHPNYLAAVGYFYNP
>NZ_CP054027.1|WP_138385135.1|3279977_3281699_+|DUF4166-domain-containing-protein
MSGGTFSLLIIGGYGAFGGRLARLLGEEPRLRLLIAGRSLEKADDFVFDLRSPKGGAGRLGSNDLGAWLQAVTFDRDGDLREQLTRLRPNLVVDASGPFQSFTGDGYKVVRACIELGIDYADLADSSGFVAGIGGLDAEAKAKGTFVLSGLSSLPALSFAALEAMAPQFSRIESVAAGIAPSAHVKIGLNVVRAISSYAGKPVAVLRQGQPAEGRGLIDQMRVTIAPPGVAPLASRTFLLVDAPDLALLPQHIAGLQSTFTGVGTEPQALQRLLGFAAQLVKLRLLPSLKPFSWVLQAASHRLALGAHRGGMFVRAGGLDRDGRRLTADWSLIAEGDDGPFIPVIAVEALVRRLLEGQRPQSGARPAAGELRLADFEAAFQRFSISSGIRLDYQEEAQPLYRRVLGDAWQKLPPALAAIHGGGTRLASGRARIERGGGLIARLIAGLIGFPAAGEDVPVAVRFVTDGDREIWTRSFGGKTFRSWQAADKGGDQPLLAEVFGPFRVLLALVPEGQKLRLAVRGWRFCGIPLPLFLAPGGDTYEEERDGRFHFNVEIGGRLTGLVVRYSGWLVVE
>NZ_CP054027.1|WP_138385136.1|3279531_3279981_+|DUF393-domain-containing-protein
MGRADYSYRTDPAVPAFADDRPLIVFDGECVFCSGWVKFALKHDRQRRYRFLAAQTPLGEALYRHYGLDTRDYETNMLIEGGRAFFKSDGTIRMVASLGFPYSLAKLFRLLPRRAADALYEFIARNRLKIAGRQSCMVPTPEQRSRFIA
>NZ_CP054027.1|WP_138385137.1|3278598_3279507_+|MBL-fold-metallo-hydrolase
MESPVFDLAFEPAYGRAVPVAPDVERITAENPGPFTFFGTNSYLVGSSSLGVIDPGPEDEAHYLALMAAIGGREVTHIFVSHTHRDHSPLARRLQAATGAVTVGQGPHRPARRLREGEVNPFAESADMDFVPDIALGDGEMITGDGWALTAVLTPGHTANHAAFALEGREILFSGDHVMAWSTSIVAPPDGAMADYMASLDKLIAREDGLLLPGHGGPVNEPKTFLPALKAHRLRREQAVLARVAAGDHAIAEMVKAIYRDTDPKLHGAAALSVLAHIEHLMERGAIAADGPPSLAARYRPA
>NZ_CP054027.1|WP_138385138.1|3276644_3278204_-|SAM-dependent-DNA-methyltransferase
MAKENNGYLGFTAELFKAADKLRGNLEPSEYKHVALGLIFLKYISDAFDGLHAKLEADEYADAEDPEEYLAENVFWVPKEARWGHLQASAKRPEIGKLIDEAMEAIERFPSNEGLKGVLPKNYARPTLNKTMLGELIDLFSNIGLHDSSDTAKDLLGRVYEYFLSGFASSEGKRGGEFFTPRSVVRTLVEMLEPYKGRVYDPCCGSGGMFVQSEKFIEEHGGRRNDIAVYGQEINHTTWRLAKMNLAVQGIDADIRWNNEGSFHRDELPDLKADFILANPPFNISDWGGERLAEDARWKFGIPPKGNANFGWLQHIIHHLAPRGTAGVVLANGSMSSQQSGEGEIRKEMIEADQVDCMVALPGQLFYSTQIPACLWILARDKSANGHRDRRGEILFIDARKLGFMVDRVRREFTAEDVEKIAGVYHRWRSKPEKRAAHGWADYTDEPGFCKSASLAEVRGHGHVLTPGRYVGAVDAEDDGISFAEKFEGLRETLGAQFAEGRALEDIVERALAMVSTYE
>NZ_CP054027.1|WP_138385139.1|3275293_3276652_-|restriction-endonuclease-subunit-S
MNDWQTVTLADLGPITTGKTPPSGTDGYFGGQIPFVTPSDMNGQRYIDVTGRSLTNEGLKAVSRRMLPPGSILVSCIGSDMGKTHIARHGCYTNQQINTIEVVSPNANPLFVYYNLSARKDELQRLASGSSAQPILNKSNFSRIAIALPSLRDQDAIANLLGSLDDKIELNRRINETLEAMAQAIFRDWFVNFGPTRRKLEGAADPLTIMGGLVQDAQRAQALADLFPDVLMDDGLPEGWRETSLGAVAKAIGGIVQTGPFGSQLHQSDYVSAGLPVVMPANLTYSGFRQGNFSYVSPETTERLNKHRLKTGDIIYGRRGDIGRKALIGKYNEGWLCGTGCLKISFPAKPIPAEYLFYSLDHQNTVDWIRARAIGATMPNLNTSTLADMPLLYPSDASLAAFEQMVQPTLALREENDQQNGTLSATRDLLLPKLISGEIRLSEAEDLMEAAQ
>NZ_CP054027.1|WP_138385140.1|3274874_3275297_-|hypothetical-protein
MSLDINFKKQVERLLDQAGREHRSKHQGVYANRYVIQVTGGVPFDLMFEKGAKTPPNIWCLAKVAEHVEDVECEIDRADRLRQVPGQYGRHSALEHMPQLANADLAKFVPKTLTDVRAIIDAIKALSENPETSTSVRAPS
>NZ_CP054027.1|WP_138385141.1|3272745_3274878_-|DUF262-domain-containing-protein
MKISSILEKIDERQLFVPAFQREYVWKKKDAKLLIDSMIKGYPTGTILTWDTNQPPELKGAHIYDPLQGAIKILLDGQQRVTTLYMLIRGELPPYYTLEEISEDTRGLHVHVQTREVEYRQKRMENDPRWINLTDIFKKKVRAKDIDKALGEAGRQLTDEEYDRIDDTFAAVQGILDRDFPEQNIPIKASLREAIDIFYIVNAGGVALTDAELALAQISGYWPQAREAFKKKLDTLKTNGFIFKLDFIVYALLAILHQGGSDMRKLHSVDNNDAIRDVWKALDGKVLDYVANLLRGHAFVDHTDEINSIYAVIPIVAYCHRMNCNLSHNDIQKVVKWFYYSQVRRRYVSQLPQKLDHDLKIVATSETPFDRLLDVIREDRGGNIAITPDEFVGSAVQNPLFGLLRWHLKSRGAKCLTTGVSIHLPMGEKYKLEYDHIFAFANLKAAGYGQENRLRYQLAQELTNRAILTQTANRSKGAKETEAYLYGVAQNQPNALGLQLIPEDKELWQLDNYELFLKTRRKMLADSLNAWLEGLAETHAVAEKVSLEDMIAEGENEEVEFKQTLRWDIKLGTVNKELEGVIMKTIAAFANAHGGTLLIGVADNGEIAGLDNDYKSLNGGNRDKFELHLKTLIINTFGEAFAATKLKLAFPEVDEKEICRVEILQANKPIYIKLADKGGAAQDRFYVRNGNSSREMTGDQAITYIKERFV
>NZ_CP054027.1|WP_138385142.1|3269537_3272723_-|type-I-restriction-endonuclease-subunit-R
MEDIVYQQAAPSPSGFSEGLVEDVVLSTFQELGYLYQPSQVISPDGSAPGRLAYGDVLLTDVLAAAVERLNPNIPPEAREQAIRQLSISETPSLVEENRRIHRLLTEGVDVEFNIGDGEVKGDKLWLIDFEHPESNDFWVTNQFTVAESKYTRRPDVIVFVNGLPLGIIELKNAASENATIHEAYNQLQTYREQIPSLFRTNAVMVASDGMLARIGSLTADEERFMPWRSVTGAEGDFTPHGPYEMDTLLRGVFDKERFLALIRDFTVFGDRGEGPFKILGGYHQFHGARKAITSAIEAVKPDGDRRIGVIWHTQGSGKSLLMAFLGGLIVRSRALENPTLIVLTDRNDLDDQLFGTFSLCKDLIRQTPEQADSRDDLRKLLNRASGGVIFTTVQKFTPERGEEVFPVLTERHNVIVMADEAHRSQYGFDAKLNRETGERRYGYAHYIRQALPNASFMGFTGTPIEAADVNTPAIFGKYIDIYDISRAVEDGATIPIYYESRLARIELNEDEKPKIDAEIEAMLEDEGLTEQEKQKAQWTTVERLVGSKKRLAQVAADLVAHLEKRIEGLPGKAMAVCMSRRICVDLYNEIVALRPEWHSDDDDKGAIKIVMTGSASDPLDWQPHIGNKRRRDDLAKRARKLDDPLKLVIVRDMWLTGFDAPCMHTMYIDKPMRGHGLMQAIARVNRVFKEKPGGLVVDYIGIATNLKKALAQYSQSDRDKTGIDEEEAVALLLEKYDVVRGMFAGHDYSLGVTGKPVERLKALADGIDWILKWQQAEAAKVESAEAKKQAHRRYQDAVLELSKAYALASASDAAGEIRDEVGFFQAVRAALVKTTATGKMSDKAKSLAVEQLLNQAVANAEIVDILKAAGLQSPDISVLSDQFLMDVQKMEKKNLALEALKKLLNGEIKSRSKTNVVQAKTFSRRLEEAVARYHANAISTVEMIQELIGLAKEMQAAAARGDELGLSPEEIAFYDALAGNETAVQVMGSEQLRVIAHELVEQMRGSVTVDWQHKASARAKMRVLVKRILKKFGYPPDLEQEAVQTVLAQAEVLLREMTAA
>NZ_CP054027.1|WP_138385143.1|3268983_3269475_-|hypothetical-protein
MQRGAAKYDRSPPDKTPDYSEVKPQLRKEDMAHLGLTEDRFDQLALRLREKVIGYAKAGFKKPAQVSHLLNKEKIRTGAGSEWNPRLVYFLLAKIYSREAERAVARIVSPSMPKSMEGSITRSKNEHRNSRPKAAIAPVMSAPLTTEEMGRRLEALRAHFNER
>NZ_CP054027.1|WP_138385133.1|3282553_3283459_-|DUF1499-domain-containing-protein
MAIRFDRPVSSAARFSRLLGAFSLVLALAVLIAHRFGGLATPYLVLLLIAAAGFALLSAMLAAVGLRSLWVSGAEGGLAALAALIYAAFPLGIGAMATERYMTLPDIYDVSTDPVSAPDWLSAPKADQIWLKRNLVTPEDREQQMAAYPELTGRRYEGALDRVLEAVRKVAKQSGFTIVRTTGTTEPDRDLEDKPAKPAPGDDAVADAPGLIPVPTPRPYDDDVAKLIRGANGVTLQATNRTLILGLRFDILIRLREEAETTFVDIRVASRYGQHDLGFSAEVAGDYLKALDAELLGIAGG
>NZ_CP054027.1|WP_097537542.1|3283747_3284137_+|hypothetical-protein
MISPEIAARPQASALGGIDHTEPMLPMELVELELSLEGYAGGDAGFCEAVRQAASRSGGELLFDLPAGGLIEDCRRIAVLRIPDHGSGTRVVLALLDYAGTEIRIQSPDEETAHLKRFAEAFIEVLERI
>NZ_CP054027.1|WP_003569745.1|3284152_3284398_-|hypothetical-protein
MAIRDRFSKKLNCPQCGNEGFAEASEIDDPKRKHPDFKVDQLPRGFGVQRPSNHQENFMIKCECGRKFPFRSLAEAAADRR
>NZ_CP054027.1|WP_003569739.1|3284523_3284721_+|hypothetical-protein
MPNRDPIPTPNADTPRGPTPSPGIPDPIQQKPPLTPAQDPADTKNPQDPPLDPALLPIGDPAGAA
>NZ_CP054027.1|WP_025415536.1|3285262_3285538_+|hypothetical-protein
MRIPILVTLLATLAGLSACQTMTPEERRAADEQRCLSYGFRRGTDGFATCLQRIDLDRRAESRANSAEMMDRMAWDLNGPYIYHDHWRHHH
>NZ_CP054027.1|WP_138385132.1|3285574_3288283_-|pyruvate,-phosphate-dikinase
MTKWVYTFGDGQAEGRARDHEILGGKGANLAEMCALGLPVPPGLTIVGDACHTYYKNGRHIEDGLKAEVRAGISGIEAITGRRFGSTSQPLLLSVRSGARVSMPGMMDTVLNLGLNDETVQALGHDAGDARFAWDSYRRFIQMYADVVMGLGNDAFEEILEDEKAKLGHEFDTELSASEWQHIVSLYKRLIEEELEQEFPQDPEVQLWGAVGAVFSSWMSARAVTYRQLHNIPEAWGTAVNIQAMVFGNLGNSSATGVAFTRNPSTGERALYGEFLVNAQGEDVVAGIRTPQSITEEGRISSGSEKPSMEKLMPEAFRELCRICTELEIHYRDMQDIEFTIERGRLWMLQTRSGKRSTRAAMKIAVDMVDEKVITEEEAVLRIEPSSLDQLLHPTIDPRVTRQVIGTGLPASPGAATGAIVFTAEEAVEAEAEGRKVILLRVETSPEDIHGMHAAEGILTTRGGMTSHAAVVARGMGIPCVVGAGTMRIDQRNERLLGVGVTMKKGDIITIDGSAGQVLKGEVPMIQPELSGDFGRIMGWADRARRMTVRTNADTPADARAARSFGAEGIGLCRTEHMFFEGERIHVMREMILAEDEKGRRLALDKLLPMQRLDFTGLFTVMHGLPVTIRLLDPPLHEFLPKTDDEVAEVAFAMGMEPLALRQRVDALHEFNPMLGHRGCRLAISYPEIVEMQARAIFEAAVAAAKETGAAVVPEIMVPLVGLRTELDYVKACIDAIAGNVMAEAGMKIDYLVGTMIELPRAALRAHVIAEAAEFFSFGTNDLTQTTFGISRDDASAFIPTYQRKGIIEHDPFISLDFDGVGELISIAAERGRRTRNDMKLGICGEHGGDPASIRFCETIGLDYVSCSPFRVPIARLAAAQAVISSGLDEIRRSPKDLRASS
>NZ_CP054027.1|WP_138385131.1|3289270_3292732_-|chromosome-segregation-protein-SMC
MKFNKLRLVGFKSFVEPTEFIIERGLTGVVGPNGCGKSNLVEALRWVMGENSYKNMRASGMDDVIFSGSGNRPARNTAEVALYLDNSTRTAPAGFNDSDEIQVTRRIEREQGSLYRINGKESRAKDVQLLFADASTGARSPSMVGQGRIGELIQAKPQARRQLLEEAAGISGLHSRRHEAELRLRAAEGNLERLDDVTSQLESQIESLKRQARQANRFKTLSADIRAREAMLLHIRWVQAKEAEAEADSALNQATSVVAEKAQMQMEAAKNQAIASLKLPELREGEARAAAALQRLQIARSQLEEDAGRILRRRDELTRRLAQLAEDISREERLVADNAVILAKLDAEEAEISEVLADSGRYAEETREAFEGAAAKLADSERIFTQLTAERAEAAAGRNQLERAIRDLTDRRMRLGRQMDEANHELSAIGEKISGLPDPDEKRAIVEAGEIALADAEAAVQAVEQALAGARQAEALSRAPVDQARSSLNALETEARTISRMLAAGAAAGKFPPVAEELKVDRGFETALGAALGDDLESPLDAEAPAHWSDNGDGAGDPALPPGVTPLLTHISAPAALTRRLRQIGLVGEGEAGRLMAALKPGQRLVTKDGAVYRWDGHVTGADAPSAAALRLAQKNRLAELESEAALARDVLAEAEERQAEAAEAIRGQEARLAEARDMSRLSARHLTEAREALAAAERASGDLIRRRDVVSEAVSQLQSQLEEIAVQEENARIELEDAPDLTTIDERLRFQQAEVATDRGALAESRARHESLARENEARQRRIMAIGQERETWRQRAASGEDHVATLREREEEARDEAAELELAPDEFDDKRRALLNELQKAEEARRNSGDLLAEAERIQREADHKATTALSELAECRERRGRAEERLVSAREKRQESEGRIREVLNVAPHEALQLTGRPTMQALPDLREVERELERLKIERERLGAVNLRADEEQKELSEKLEALIKERDDVIDAIRKLRGAIQSLNREGRERLIAAFDVVNAQFQRLFTHLFGGGTAELQLIESDDPLEAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDHNVERYCNLMDEMAASTETRFVIITHNPITMARMNRLFGVTMAEQGVSTLVSVDLQTAERLREIA
>NZ_CP054027.1|WP_025415534.1|3292840_3293617_-|DsbA-family-protein
MQMSEMQLTKRRLLSGIAIAAAAVALVACNDSKDAADASSSGKTMADGTNVDTMQTAATSATEMPQSDGDVDMAEVLKPGVLPEMALGKADAPVKIVEYMSMTCPHCAHFHNTTFDAIKQKYVDAGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLSTPEQYFPMVSMLFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFLINGKRYSGDMPVDTLSALIDSLI
>NZ_CP054027.1|WP_003569758.1|3294075_3295077_-|substrate-binding-domain-containing-protein
MLNITRRMLIISAGLATVLTAAPAFSADKIVIGFSQASSNSAHRNTMTKRNQAYAAEHFKDVDLIVTNAEGKSAKQISDVESLMVQGMKVLMISAQDGAAIAPTVKQVLAAGIPVITLERSLDIPVTLHVGPHNKPIGTLAGKYIAEALKGKGNVVEIKGDPAVAPAVERHEGFAEAIAGTEIKVIAETHADWDQEKALKFMEDTLQRFPAGQIQAVYAHNDNMAFGALRAIQAAGRDKEGILIIGIDGENAAIRAVAKGDLTATFTYSTVAPEGVIAAHALATNDTAALEKLGTLTKKDDGSMEIEIASKMITKENAAEFFCKGFGDDPECK
>NZ_CP054027.1|WP_003569761.1|3295103_3296036_-|ABC-transporter-permease
MKNLPRGTGLAGALIGLIIAASLISPHFLNPINILNVLRQVALYGILGIGMTFVILTKGIDLSVGSIVALVGVTGAVLMEQGMSIPLMVLICLSIGALVGCVNGFGISHFRIPAFIMTLGCMVMVRGFALMIADGGTVNPGKLADSFFVLGGGYILGVPTPIYVFAIVCIIAAIVLSFTSFGRAIYAVGSNEEAARLSGINVPLVIFSVYIICGVLAALSGLIFLSRLSVGDPNSGLGLELEAITIAVIGGTSLFGGEGTVLGTMGGAMVLAIIANILNLAGVSPFSQQVVKGGIIVLAVLLEAGRKPRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

495729 : 502888

Mycobacterium_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025417128.1\|495729_495951_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	6.1e-17	52.1
WP_003566904.1\|495963_496380_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	2.9e-12	34.1
WP_025417126.1\|496358_498557_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	6.1e-210	51.5
WP_138386439.1\|498787_499762_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	2.5e-139	74.8
WP_025417124.1\|499866_501090_+	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	3.2e-14	27.5
WP_138386438.1\|501096_501825_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	3.1e-41	38.7
WP_003566894.1\|501821_502178_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_025417122.1\|502177_502888_-	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	1.3e-47	47.3

DBSCAN-SWA_2

2258313 : 2268518

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003573154.1\|2258313_2258823_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.2e-45	59.4
WP_003573156.1\|2258851_2259424_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	7.5e-43	53.2
WP_128397483.1\|2259497_2259992_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.7e-24	36.5
WP_003573160.1\|2260523_2260679_+	hypothetical protein	NA	NA	NA	NA
WP_138384294.1\|2261009_2263832_-	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	4.3e-75	42.2
WP_138384295.1\|2264068_2264716_+	MarC family protein	NA	NA	NA	NA
WP_025416164.1\|2264803_2265313_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	9.3e-45	56.8
WP_138384296.1\|2265596_2268518_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1

DBSCAN-SWA_3

2471170 : 2484270

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138384347.1\|2471170_2473711_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.9e-56	47.4
WP_003573534.1\|2473756_2474104_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	3.2e-12	38.0
WP_003573536.1\|2474306_2475179_+	ATP-binding protein	NA	NA	NA	NA
WP_003573538.1\|2475233_2476826_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	8.6e-12	29.2
WP_003573541.1\|2476965_2477619_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.6e-17	35.9
WP_003573544.1\|2477615_2478389_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.1e-23	30.2
WP_003573546.1\|2478393_2479677_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.7e-98	45.3
WP_003573547.1\|2479776_2480604_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.2e-52	46.1
WP_138384348.1\|2480600_2481212_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003538990.1\|2481262_2481454_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_003573552.1\|2481637_2482354_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.1e-38	47.5
WP_003573554.1\|2482350_2483208_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.2e-33	37.2
WP_003573557.1\|2483256_2484270_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	2.8e-24	42.6

DBSCAN-SWA_4

2799200 : 2808419

Organic_Lake_phycodnavirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025415838.1\|2799200_2801177_+	glycosyltransferase family 1 protein	F2Y0P4	Organic_Lake_phycodnavirus	8.7e-06	36.4
WP_138384834.1\|2801201_2801780_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	3.2e-33	41.8
WP_025415836.1\|2801786_2802842_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.3e-96	51.8
WP_138384833.1\|2802845_2803733_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_003574061.1\|2803742_2804612_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.4e-95	59.5
WP_003574063.1\|2804709_2805321_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.2e-17	35.6
WP_138384832.1\|2805320_2806631_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	5.0e-34	40.8
WP_003547190.1\|2806634_2807111_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_025415833.1\|2807120_2808419_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	4.9e-98	51.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP054030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

128144 : 136441

Virus_Rctr85(25.0%)

transposase,integrase

attL 127995:128009|attR 138977:138991

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
127995:128009	attL	NA	NA	NA	NA
WP_173883907.1\|128144_128495_+\|transposase	transposase	NA	NA	NA	NA
WP_138386312.1\|128618_129632_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	2.1e-11	29.3
WP_138386311.1\|129628_130546_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_138386310.1\|130539_131784_-\|integrase	tyrosine-type recombinase/integrase	A0A1I9SC88	Mycobacterium_phage	3.9e-12	29.6
WP_173883908.1\|131992_132256_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_138386365.1\|132330_133929_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	7.7e-53	32.2
WP_138386577.1\|135690_136038_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.5e-38	64.5
WP_173883909.1\|136132_136441_-\|transposase	transposase	NA	NA	NA	NA
138977:138991	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP054027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP054030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection