CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP035652	Enterococcus faecium strain UAMSEF_08 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0
NZ_CP035651	Enterococcus faecium strain UAMSEF_08 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
NZ_CP035654	Enterococcus faecium strain UAMSEF_08 chromosome, complete genome	1 crisprs	DEDDh,cas2,DinG,cas3,csa3,cas14j,RT	0	9
NZ_CP035653	Enterococcus faecium strain UAMSEF_08 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	1 crisprs	RT,DEDDh	2	1
NZ_CP035650	Enterococcus faecium strain UAMSEF_08 plasmid unnamed2, complete sequence	0 crisprs	csa3,RT	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP035654_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP035654_1

2352813-2352922

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP035654_1

>merge|NZ_CP035654|1|2352813-2352922|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP035654|1|1|2352813-2352922|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP035654.1\|WP_002294577.1\|2359661_2360306_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP035654.1\|WP_002294578.1\|2359347_2359500_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP035654.1\|WP_002296327.1\|2351020_2351710_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP035654.1\|WP_002294580.1\|2358507_2359053_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP035654.1\|WP_002294579.1\|2359153_2359324_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP035654.1\|WP_002294587.1\|2353149_2353839_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP035654.1\|WP_002287788.1\|2345062_2345776_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP035654.1\|WP_002287791.1\|2343614_2344754_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP035654.1\|WP_002294585.1\|2354707_2355376_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP035654.1\|WP_002294584.1\|2355388_2356261_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP035654.1\|WP_002287793.1\|2338961_2341121_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP035654.1\|WP_002295743.1\|2348886_2349796_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP035654.1\|WP_002294583.1\|2356351_2357371_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP035654.1\|WP_002291638.1\|2353942_2354365_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP035654.1\|WP_002287787.1\|2346029_2346731_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP035654.1\|WP_002290558.1\|2346964_2348497_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP035654.1\|WP_002291634.1\|2352236_2352740_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP035654.1\|WP_002294588.1\|2351815_2352184_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP035654.1\|WP_002287792.1\|2341170_2342136_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP035654.1\|WP_002294581.1\|2357543_2358431_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645

Protein	Function_ID	Function_description	E-value
NZ_CP035654.1\|WP_002294577.1\|2359661_2360306_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP035654.1\|WP_002294578.1\|2359347_2359500_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP035654.1\|WP_002296327.1\|2351020_2351710_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP035654.1\|WP_002294580.1\|2358507_2359053_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP035654.1\|WP_002294579.1\|2359153_2359324_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP035654.1\|WP_002294587.1\|2353149_2353839_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP035654.1\|WP_002287788.1\|2345062_2345776_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP035654.1\|WP_002287791.1\|2343614_2344754_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP035654.1\|WP_002294585.1\|2354707_2355376_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP035654.1\|WP_002294584.1\|2355388_2356261_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP035654.1\|WP_002287793.1\|2338961_2341121_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP035654.1\|WP_002295743.1\|2348886_2349796_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP035654.1\|WP_002294583.1\|2356351_2357371_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP035654.1\|WP_002291638.1\|2353942_2354365_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP035654.1\|WP_002287787.1\|2346029_2346731_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP035654.1\|WP_002290558.1\|2346964_2348497_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP035654.1\|WP_002291634.1\|2352236_2352740_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP035654.1\|WP_002294588.1\|2351815_2352184_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP035654.1\|WP_002287792.1\|2341170_2342136_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP035654.1\|WP_002294581.1\|2357543_2358431_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80

>NZ_CP035654.1|WP_002291634.1|2352236_2352740_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP035654.1|WP_002294588.1|2351815_2352184_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP035654.1|WP_002296327.1|2351020_2351710_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP035654.1|WP_002295743.1|2348886_2349796_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP035654.1|WP_002290558.1|2346964_2348497_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP035654.1|WP_002287787.1|2346029_2346731_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP035654.1|WP_002287788.1|2345062_2345776_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP035654.1|WP_002287791.1|2343614_2344754_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP035654.1|WP_002287792.1|2341170_2342136_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP035654.1|WP_002287793.1|2338961_2341121_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>NZ_CP035654.1|WP_002294587.1|2353149_2353839_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP035654.1|WP_002291638.1|2353942_2354365_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP035654.1|WP_002294585.1|2354707_2355376_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP035654.1|WP_002294584.1|2355388_2356261_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP035654.1|WP_002294583.1|2356351_2357371_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP035654.1|WP_002294581.1|2357543_2358431_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP035654.1|WP_002294580.1|2358507_2359053_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP035654.1|WP_002294579.1|2359153_2359324_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP035654.1|WP_002294578.1|2359347_2359500_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP035654.1|WP_002294577.1|2359661_2360306_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

42923 : 58796

Streptococcus_phage(83.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130587603.1\|42923_44180_+	ATP-dependent helicase	A7KV33	Bacillus_phage	9.1e-17	28.4
WP_002301399.1\|44166_45126_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_000421279.1\|45981_46296_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.2e-42	77.7
WP_001234191.1\|46316_46694_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	9.6e-47	76.4
WP_000185761.1\|46703_47477_+	hypothetical protein	NA	NA	NA	NA
WP_001130244.1\|47498_48902_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	2.2e-176	66.5
WP_000426689.1\|49083_50268_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	6.3e-161	68.1
WP_000055376.1\|50264_50555_+	hypothetical protein	NA	NA	NA	NA
WP_001009054.1\|50551_50773_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	3.1e-29	93.2
WP_000675717.1\|50814_51594_+	abortive infection family protein	NA	NA	NA	NA
WP_000425404.1\|51654_52155_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-54	63.0
WP_000248477.1\|52210_52849_+	hypothetical protein	NA	NA	NA	NA
WP_000723887.1\|52920_53316_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	5.9e-47	72.6
WP_000331165.1\|53299_55753_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	78.9
WP_000192393.1\|55749_57777_+	membrane protein	A0A1S5SF30	Streptococcus_phage	5.1e-195	65.3
WP_000768373.1\|57773_58796_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	2.4e-132	75.5

DBSCAN-SWA_2

63426 : 70754

Streptococcus_phage(57.14%)

integrase

attL 59790:59803|attR 74132:74145

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
59790:59803	attL	NA	NA	NA	NA
WP_000868795.1\|63426_63924_-	trimethoprim-resistant dihydrofolate reductase DfrG	G3MBI7	Bacillus_virus	4.0e-40	49.1
WP_001803271.1\|65444_65612_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	2.3e-13	62.0
WP_001227350.1\|65669_66023_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	2.2e-53	89.7
WP_010924747.1\|66254_66365_+	hypothetical protein	NA	NA	NA	NA
WP_000675479.1\|66493_66976_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	8.5e-48	68.6
WP_000845143.1\|66972_67203_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	1.0e-27	78.9
WP_000633907.1\|67700_67901_+	DUF3173 family protein	NA	NA	NA	NA
WP_000237797.1\|67927_69121_+\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	8.3e-44	34.2
WP_002298578.1\|69188_70754_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.5e-18	30.6
74132:74145	attR	NA	NA	NA	NA

DBSCAN-SWA_3

285563 : 295721

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032509114.1\|285563_285788_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.5e-27	97.1
WP_002345010.1\|285904_286402_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.3e-88	97.6
WP_002345009.1\|286488_286881_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	4.6e-68	99.2
WP_050288986.1\|286864_289312_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	98.3
WP_002345008.1\|289314_291498_+	membrane protein	A0A1S5SF30	Streptococcus_phage	2.9e-305	82.3
WP_002345007.1\|291494_292496_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	1.3e-183	95.5
WP_074400123.1\|292492_293425_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	5.1e-158	91.6
WP_012386611.1\|293699_293786_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_002345005.1\|293801_295721_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	96.6

DBSCAN-SWA_4

768771 : 777243

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|768771_769416_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|769430_769760_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|769773_770712_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|770747_771572_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|771564_771912_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|771980_772853_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|772961_774083_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|774136_774739_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|775053_777243_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_5

831776 : 909216

Enterococcus_phage(29.27%)

protease,transposase,portal,head,holin,capsid,tail,terminase,tRNA,integrase

attL 889351:889366|attR 892704:892719

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|831776_834575_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|834623_836150_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|836164_836812_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|836995_837325_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|837501_838230_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|838245_839259_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|839258_840536_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|840598_843301_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|843452_843770_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|843799_844120_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|844227_845688_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|845755_845977_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|846007_846190_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|846189_846603_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|846725_847907_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286587.1\|848437_849577_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|849875_850511_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|850623_851259_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|851292_851754_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002348715.1\|851883_852315_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|852332_852653_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_074394507.1\|853088_853274_-	hypothetical protein	NA	NA	NA	NA
WP_077495106.1\|853204_853393_+	hypothetical protein	NA	NA	NA	NA
WP_002286679.1\|853389_853647_+	phosphomannomutase	NA	NA	NA	NA
WP_002286674.1\|853617_853926_-	hypothetical protein	NA	NA	NA	NA
WP_085803886.1\|854003_854777_+	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	4.1e-68	52.2
WP_002296611.1\|854791_854995_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_047927434.1\|855010_855331_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002351655.1\|855512_856295_-	hypothetical protein	NA	NA	NA	NA
WP_130587561.1\|856345_857053_+	phage regulatory protein	D2IYT0	Enterococcus_phage	4.3e-40	42.0
WP_060809376.1\|857230_857572_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|857564_858236_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286553.1\|858241_858928_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286552.1\|858930_859680_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286696.1\|859691_859961_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|860122_860425_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|860421_860583_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|860579_860885_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|860884_861241_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|861200_861446_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|861442_861862_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|861858_862416_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|862412_862709_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|862785_863199_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002300143.1\|863656_863932_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|864385_864592_+	hypothetical protein	NA	NA	NA	NA
WP_086968564.1\|864959_866101_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
WP_002296600.1\|866176_866344_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|866369_866714_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|866718_867000_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|867102_867417_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|867394_869089_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|869108_870287_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|870249_870936_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|870935_872096_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|872105_872981_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|872977_873289_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|873278_873632_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|873621_874023_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|874015_874420_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|874431_875040_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|875059_875422_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|875424_875607_+	hypothetical protein	NA	NA	NA	NA
WP_002348716.1\|875623_879055_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002299176.1\|879105_879843_+\|tail	phage tail protein	NA	NA	NA	NA
WP_060806750.1\|879852_882144_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	7.3e-89	29.9
WP_130587587.1\|882167_884366_+	hypothetical protein	A0A0M4RT83	Enterococcus_phage	1.0e-63	39.0
WP_002299182.1\|884443_884686_+\|holin	holin	D2J075	Enterococcus_phage	9.6e-24	68.4
WP_005876842.1\|884701_884899_+\|holin	holin	A0A0S2MYF6	Enterococcus_phage	1.0e-23	84.4
WP_130627722.1\|884909_885929_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	4.1e-60	66.1
WP_087046766.1\|886868_888030_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|888953_889361_+	hypothetical protein	NA	NA	NA	NA
889351:889366	attL	NA	NA	NA	NA
WP_002296902.1\|889374_889776_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|889777_890149_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|890184_890487_-	hypothetical protein	NA	NA	NA	NA
WP_076005172.1\|890735_890936_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002348827.1\|891240_892473_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|892729_893299_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
892704:892719	attR	NA	NA	NA	NA
WP_002297963.1\|893476_893917_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|894074_894839_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|894870_895794_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|895869_897009_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|897001_897802_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|897801_898629_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|898606_899341_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|899440_900307_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|900320_900893_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002294532.1\|900914_901943_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286428.1\|902040_902892_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002348826.1\|902925_904959_+	hypothetical protein	NA	NA	NA	NA
WP_002371302.1\|905002_906283_+	EpaQ family protein	NA	NA	NA	NA
WP_010782578.1\|907941_909216_-\|transposase	ISL3-like element IS1476 family transposase	A0A1S5SBP9	Streptococcus_phage	8.6e-55	36.1

DBSCAN-SWA_6

1540236 : 1597305

Streptococcus_phage(28.57%)

protease,tRNA,transposase,integrase

attL 1536695:1536712|attR 1571388:1571405

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1536695:1536712	attL	NA	NA	NA	NA
WP_002296628.1\|1540236_1541076_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|1541260_1542148_+	rotamase	NA	NA	NA	NA
WP_002311093.1\|1542741_1543437_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|1543420_1543819_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002287107.1\|1544226_1545477_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296760.1\|1545618_1546614_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002289423.1\|1546631_1547186_-	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289422.1\|1547173_1547665_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289421.1\|1547657_1549526_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|1549544_1550345_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289418.1\|1550568_1550784_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002303864.1\|1550922_1551408_+	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|1551863_1552277_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002322258.1\|1552413_1552674_+	hypothetical protein	NA	NA	NA	NA
WP_002303865.1\|1552601_1552841_+	hypothetical protein	NA	NA	NA	NA
WP_002321532.1\|1552791_1553082_+	hypothetical protein	NA	NA	NA	NA
WP_002286097.1\|1554662_1555616_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002288357.1\|1555672_1556800_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_002288355.1\|1556893_1558729_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.4e-20	24.4
WP_002288353.1\|1558875_1560096_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002288352.1\|1560115_1560610_+	nucleoside deoxyribosyltransferase	A0A1W6JK28	Lactococcus_phage	7.2e-42	56.5
WP_002288350.1\|1560602_1561274_+	hypothetical protein	NA	NA	NA	NA
WP_002288348.1\|1561424_1564034_-	ATP-dependent chaperone ClpB	A0A2I7SAX5	Vibrio_phage	1.6e-132	35.0
WP_002288347.1\|1564284_1565331_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_002288344.1\|1565341_1565614_-	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_002288343.1\|1565648_1566557_-	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_002288340.1\|1566688_1567921_-	peptidase T	NA	NA	NA	NA
WP_002288338.1\|1567935_1569057_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_002288335.1\|1569053_1569755_-\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002288333.1\|1571422_1571863_-	lipoprotein	NA	NA	NA	NA
1571388:1571405	attR	NA	NA	NA	NA
WP_002288331.1\|1571991_1572918_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	5.1e-33	41.3
WP_002288329.1\|1572917_1574291_-	Replication initiation and membrane attachment	NA	NA	NA	NA
WP_002288327.1\|1574313_1574805_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_002288325.1\|1575116_1575449_-	hypothetical protein	NA	NA	NA	NA
WP_002288324.1\|1575500_1576130_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_002288323.1\|1576093_1576930_-	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	1.8e-24	30.2
WP_130587590.1\|1576974_1579620_-	DNA polymerase I	F8WQ35	Bacillus_phage	3.0e-54	35.7
WP_002296397.1\|1579745_1580429_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_002296398.1\|1580421_1580907_-	dehydratase	NA	NA	NA	NA
WP_002296400.1\|1581213_1582548_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_002296401.1\|1582678_1583440_-	YdcF family protein	NA	NA	NA	NA
WP_002296402.1\|1583455_1583938_-	SprT family protein	NA	NA	NA	NA
WP_002296403.1\|1583957_1586138_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_002296404.1\|1586281_1587013_-	serine/threonine protein phosphatase	A7KV25	Bacillus_phage	1.7e-15	30.8
WP_002296405.1\|1587081_1588023_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_002296407.1\|1588202_1588571_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_002297404.1\|1588977_1590228_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295194.1\|1590963_1592355_-	L-cystine transporter	NA	NA	NA	NA
WP_002291995.1\|1592567_1592954_-	DUF1149 family protein	NA	NA	NA	NA
WP_002295196.1\|1593009_1593633_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_002295197.1\|1593696_1594365_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_002322028.1\|1594376_1594817_-	hypothetical protein	NA	NA	NA	NA
WP_002295199.1\|1594875_1595547_-	transcriptional regulator	NA	NA	NA	NA
WP_138556882.1\|1596903_1597305_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.5e-50	73.2

DBSCAN-SWA_7

1771286 : 1820956

Streptococcus_phage(42.86%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002347404.1\|1771286_1771772_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002326253.1\|1771794_1772553_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	6.5e-26	36.9
WP_002322842.1\|1772568_1773747_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.1e-102	48.9
WP_002326254.1\|1773976_1776097_+	LTA synthase family protein	W6LM83	Streptococcus_phage	6.3e-220	58.3
WP_000122610.1\|1776339_1777632_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_127817623.1\|1779131_1779362_-	hypothetical protein	NA	NA	NA	NA
WP_002296623.1\|1779247_1780543_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002326255.1\|1780861_1781587_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1781576_1782086_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1782155_1783604_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002293942.1\|1783603_1784320_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|1784300_1784651_-	SdpI family protein	NA	NA	NA	NA
WP_002293945.1\|1784794_1785568_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002293947.1\|1786142_1786325_+	hypothetical protein	NA	NA	NA	NA
WP_085856162.1\|1786409_1787363_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002323892.1\|1787606_1787921_-	hypothetical protein	NA	NA	NA	NA
WP_002321266.1\|1788206_1788446_+	hypothetical protein	NA	NA	NA	NA
WP_060806716.1\|1788807_1789068_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1789252_1789750_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1789879_1790590_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002297645.1\|1790602_1792267_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002293954.1\|1793157_1794027_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002293955.1\|1794037_1794934_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002293956.1\|1794986_1796246_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293957.1\|1796274_1796529_-	hypothetical protein	NA	NA	NA	NA
WP_002376800.1\|1796512_1796671_+	hypothetical protein	NA	NA	NA	NA
WP_002288972.1\|1796678_1796792_+\|protease	CAAX amino protease	NA	NA	NA	NA
WP_138556307.1\|1798269_1798452_+	hypothetical protein	NA	NA	NA	NA
WP_002293958.1\|1799929_1800172_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002286913.1\|1800481_1800829_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293717.1\|1800964_1801726_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002293716.1\|1801715_1802237_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002326259.1\|1802406_1803198_-	hypothetical protein	NA	NA	NA	NA
WP_002290277.1\|1803321_1803573_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|1803584_1803860_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|1804112_1804667_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|1804745_1805267_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|1805270_1805849_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|1805960_1807379_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|1807399_1807738_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|1807697_1808201_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|1808331_1809036_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002322835.1\|1809032_1810769_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	9.3e-28	34.1
WP_002293701.1\|1810871_1813346_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.7e-46	29.2
WP_002289807.1\|1813671_1814562_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002293699.1\|1814758_1815241_-	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|1815448_1815814_+	hypothetical protein	NA	NA	NA	NA
WP_002322761.1\|1815904_1816222_-	hypothetical protein	NA	NA	NA	NA
WP_101699735.1\|1816587_1817749_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	7.8e-79	50.9
WP_002295271.1\|1818321_1819296_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002297404.1\|1819705_1820956_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_8

2068741 : 2074414

uncultured_Caudovirales_phage(50.0%)

portal,capsid,tail,terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296483.1\|2068741_2069077_-\|head	phage head closure protein	V5UQC7	Enterococcus_phage	4.7e-13	35.6
WP_002296484.1\|2069063_2069348_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002296485.1\|2069403_2070927_-\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
WP_002296486.1\|2070919_2072095_-\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002317249.1\|2072098_2072284_-	hypothetical protein	NA	NA	NA	NA
WP_002296487.1\|2072249_2073944_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8
WP_002296488.1\|2073940_2074414_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA

DBSCAN-SWA_9

2669297 : 2725231

Streptococcus_phage(66.67%)

transposase,integrase

attL 2675687:2675701|attR 2724910:2724924

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086956687.1\|2669297_2670460_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002331276.1\|2670500_2670746_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002331275.1\|2670844_2671159_-	hypothetical protein	NA	NA	NA	NA
WP_002331274.1\|2671226_2671721_-	hypothetical protein	NA	NA	NA	NA
WP_002331273.1\|2671713_2672028_-	hypothetical protein	NA	NA	NA	NA
WP_002321376.1\|2672008_2672200_-	hypothetical protein	NA	NA	NA	NA
WP_002321375.1\|2672243_2673635_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_002321374.1\|2673619_2674231_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_002322532.1\|2674234_2674432_-	hypothetical protein	NA	NA	NA	NA
WP_002340550.1\|2674422_2677101_-	hypothetical protein	NA	NA	NA	NA
2675687:2675701	attL	NA	NA	NA	NA
WP_023043245.1\|2677087_2677306_-	hypothetical protein	NA	NA	NA	NA
WP_002340551.1\|2677381_2678434_-	replication initiator protein A	NA	NA	NA	NA
WP_002321715.1\|2678586_2678913_-	hypothetical protein	NA	NA	NA	NA
WP_002319736.1\|2678924_2679125_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002321714.1\|2679199_2679850_+	helix-turn-helix transcriptional regulator	Q20DG0	Lactobacillus_phage	3.2e-05	33.3
WP_002318021.1\|2679904_2681071_+\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	3.3e-45	34.0
WP_070557977.1\|2681487_2684715_+	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002297366.1\|2684827_2685142_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
WP_002297365.1\|2685154_2685529_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002311649.1\|2685529_2685874_+	hypothetical protein	NA	NA	NA	NA
WP_130587595.1\|2685956_2687297_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	1.5e-163	65.0
WP_002321810.1\|2688280_2688715_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
WP_002297356.1\|2688715_2689423_+	DNA methylase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
WP_002297354.1\|2689412_2689703_+	hypothetical protein	NA	NA	NA	NA
WP_002297353.1\|2689961_2691146_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002317225.1\|2691142_2691280_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|2692025_2693936_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033658092.1\|2694039_2694264_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002297350.1\|2694276_2694780_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_002297349.1\|2694839_2695229_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_002297348.1\|2695215_2697663_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.0
WP_002297347.1\|2697667_2699791_+	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_002297346.1\|2699787_2700792_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297345.1\|2700810_2701722_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0
WP_002297343.1\|2702381_2702597_-	hypothetical protein	NA	NA	NA	NA
WP_130587592.1\|2703358_2704798_-	MFS transporter	NA	NA	NA	NA
WP_130587593.1\|2705247_2706018_-	AP2 domain-containing protein	A0A0C5K996	Enterococcus_phage	9.6e-09	34.3
WP_002297338.1\|2706366_2707818_-	peptidoglycan DD-metalloendopeptidase family protein	A0A075BS18	Microcystis_phage	1.9e-18	46.1
WP_002297337.1\|2707929_2709273_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_138556308.1\|2709406_2715838_-	repetitive surface protein Esp	NA	NA	NA	NA
WP_002332818.1\|2716454_2716889_-	hypothetical protein	NA	NA	NA	NA
WP_130587557.1\|2716905_2718111_-	YSIRK-targeted surface antigen transcriptional regulator	NA	NA	NA	NA
WP_002302419.1\|2718804_2719191_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002302418.1\|2719288_2719480_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_130587559.1\|2720029_2720326_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297332.1\|2720235_2720430_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_002348989.1\|2720468_2720615_+	hypothetical protein	NA	NA	NA	NA
WP_130587556.1\|2720586_2720766_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_130587555.1\|2721041_2722382_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.6e-65	35.7
WP_130587554.1\|2722417_2722660_-	hypothetical protein	NA	NA	NA	NA
WP_130587553.1\|2722622_2724239_-	GTP-binding protein	NA	NA	NA	NA
WP_002317220.1\|2724356_2724575_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_130587552.1\|2724595_2725231_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-17	34.2
2724910:2724924	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP035655

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP035655_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP035655_1

430-557

Orphan

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP035655_1

>merge|NZ_CP035655|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP035655|1|1|430-557|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP035655.1\|WP_002350398.1\|9092_9917_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035655.1\|WP_002336710.1\|5627_6299_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP035655.1\|WP_002287107.1\|3393_4644_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP035655.1\|WP_002295674.1\|2815_3157_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP035655.1\|WP_002323647.1\|1864_2197_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035655.1\|WP_010729784.1\|6351_8328_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP035655.1\|WP_002343441.1\|9926_10175_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035655.1\|WP_010729785.1\|8340_9096_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP035655.1\|WP_002295672.1\|5358_5568_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035655.1\|WP_002295673.1\|5052_5292_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP035655.1\|WP_010729784.1\|6351_8328_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	3.93449e-27
NZ_CP035655.1\|WP_002336710.1\|5627_6299_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	5.03937e-44
NZ_CP035655.1\|WP_010729785.1\|8340_9096_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	2.58528e-60
NZ_CP035655.1\|WP_002287107.1\|3393_4644_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.49321e-29
NZ_CP035655.1\|WP_002295674.1\|2815_3157_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.01693e-48

>NZ_CP035655.1|WP_002323647.1|1864_2197_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIG
>NZ_CP035655.1|WP_002295674.1|2815_3157_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSFEIIEFVADKEE
>NZ_CP035655.1|WP_002287107.1|3393_4644_-|IS110-family-transposase
MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNNSYHFDQIVIGMESTSMYSFHPSMFFHEDEKLKKLNTLVTIENPFRVKQFSRMFDENKTDRNDALRIADFLRIQRFTTSPIKEEKYMALQRLTRTRYQLIKQLIRTKQHFLENLTYKCNTLAREMRDESTSLFSATLISLMTEDFTLDELAELPLEAFCDLLQEKGKGRFKQPEKIAKAIQRAITMSYRLGALAQESINVVLSVLVREIRALEKNIKELDKAIEQVIVVIPEYQCLTSIPGVGKVYAAGLIAEIGQIERFEDQTKLAKYAGLSWKVNQSGNYQSQNTPLTKQGNRYFRYYLVEAANSVKNYLPEYKAFYQSKYKEVPKHQHKRALVLTARKFTRLVDTLLRKHQLYTPPRSVIEK
>NZ_CP035655.1|WP_002295673.1|5052_5292_+|hypothetical-protein
MARPVLEAMDMDTLTKGRYVQLLARGYSPKEVFKALSKGTDMEKERLRKEFDYWRTHNGIKDLKPARPVIKRKKKITQD
>NZ_CP035655.1|WP_002295672.1|5358_5568_+|hypothetical-protein
MNYEEIENRKKVSKEMEEKLLKTMKQKHLKRLSVAQYINDMQLTGKEKACLLGSMKNFEQLRRTYRIHF
>NZ_CP035655.1|WP_002336710.1|5627_6299_+|class-A-sortase
MKKWLFGFLGVTLIVFCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPGYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP035655.1|WP_010729784.1|6351_8328_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYQVHAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVQDVEDKGSNSEYVKNATNKITSAVDENGEITFTDQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDKTGSGFLKNIHLYPKNIVSKLSFELTKFGDDGADQSKQTLLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDQEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGKGLSYVAEKADIKVTNNDGSVVLKENTDYKIENSDSGFVIDFIVNNGQVSDTVANLHGQDLKMTYNMFVNDSAEIANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLEGAEFAAKNAEGKYYGGLTDTDKDGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGDYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQSYVLISCLLLGAGGLSAVVYFKKKA
>NZ_CP035655.1|WP_010729785.1|8340_9096_+|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPVVETNVAKFQQQQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFCVPIIFIYKKIRRRSE
>NZ_CP035655.1|WP_002350398.1|9092_9917_+|hypothetical-protein
MNKRKWLFVCVAALFSTVAYSQLSFADSSDSSTTQTIDNSITAPSETDSSENTTEETADSNISFTESTNPTSESSSETSEKPQDVEDTQVIKQAIHIQKIISSNQINNQGSQVAQQEGINGAKFIVYDITNILEEMSQDDNEKNQSVEIIESKLKDRAKKLSYDQLKKVAEGETKTIDDQEGVIEFSIEVPANKKQAYYIVNESSPENISNSEDIVLLTPVSNEKGEFLTDVWLYPKSEKSEPKEEIKKVVSTGVKKNFFENCWEFFAQLFFDN
>NZ_CP035655.1|WP_002343441.1|9926_10175_+|hypothetical-protein
MKIIRILVFNLSFLAATILCCGLIFSQLSIYPRYQRLFIHFLNIQCASMPLEVIKKLLINPIFMVSLVLLTGLVTWVLGKKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.2\|516\|19\|NZ_CP035655\|CRISPRCasFinder	516-534	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP035655_1	1.1\|453\|40\|NZ_CP035655\|CRISPRCasFinder	453-492	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|516|19|NZ_CP035655|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|453|40|NZ_CP035655|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3393 : 177614

159

Streptococcus_phage(26.19%)

transposase,holin,integrase,protease

attL 61808:61867|attR 130259:130397

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287107.1\|3393_4644_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295673.1\|5052_5292_+	hypothetical protein	NA	NA	NA	NA
WP_002295672.1\|5358_5568_+	hypothetical protein	NA	NA	NA	NA
WP_002336710.1\|5627_6299_+	class A sortase	NA	NA	NA	NA
WP_010729784.1\|6351_8328_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_010729785.1\|8340_9096_+	class C sortase	NA	NA	NA	NA
WP_002350398.1\|9092_9917_+	hypothetical protein	NA	NA	NA	NA
WP_002343441.1\|9926_10175_+	hypothetical protein	NA	NA	NA	NA
WP_025481135.1\|10205_12317_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_138556309.1\|12478_13774_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-54	36.9
WP_130587577.1\|13865_15923_-\|protease	serine protease	NA	NA	NA	NA
WP_002296354.1\|16036_16249_-	hypothetical protein	NA	NA	NA	NA
WP_002296355.1\|16435_16903_+	hypothetical protein	NA	NA	NA	NA
WP_002321279.1\|16899_17142_+	DUF5415 family protein	NA	NA	NA	NA
WP_002296358.1\|17159_17462_+	hypothetical protein	NA	NA	NA	NA
WP_010729787.1\|17533_19588_+	hypothetical protein	NA	NA	NA	NA
WP_086322090.1\|19587_22200_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_002302858.1\|22196_24575_+	hypothetical protein	NA	NA	NA	NA
WP_002302857.1\|24635_25178_+	hypothetical protein	NA	NA	NA	NA
WP_002302856.1\|25255_25588_+	hypothetical protein	NA	NA	NA	NA
WP_002302855.1\|25588_26182_+	hypothetical protein	NA	NA	NA	NA
WP_065305674.1\|26203_27898_+	ATPase	NA	NA	NA	NA
WP_002305175.1\|28165_28399_+	hypothetical protein	NA	NA	NA	NA
WP_002305177.1\|28585_30463_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	9.1e-29	26.3
WP_002296365.1\|30970_32176_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	2.5e-32	42.4
WP_002296371.1\|32191_32836_+	hypothetical protein	NA	NA	NA	NA
WP_010729790.1\|32846_33653_+	hypothetical protein	NA	NA	NA	NA
WP_002313120.1\|33674_33905_+	hypothetical protein	NA	NA	NA	NA
WP_002325546.1\|34450_34726_+	hypothetical protein	NA	NA	NA	NA
WP_002330592.1\|34767_35190_+	hypothetical protein	NA	NA	NA	NA
WP_002330591.1\|35208_36801_+	hypothetical protein	NA	NA	NA	NA
WP_002330590.1\|36812_37148_+	hypothetical protein	NA	NA	NA	NA
WP_002330589.1\|37294_37489_+	hypothetical protein	NA	NA	NA	NA
WP_138556918.1\|37520_39893_+	hypothetical protein	B5SP25	Lactococcus_phage	3.0e-13	30.2
WP_002313123.1\|39953_41423_+	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002303486.1\|41433_43443_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002301799.1\|43411_43543_+	hypothetical protein	NA	NA	NA	NA
WP_002299811.1\|43788_44385_+	transcriptional regulator	NA	NA	NA	NA
WP_002301800.1\|44397_45297_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002301801.1\|45299_45431_+	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.3e-11	83.3
WP_002305808.1\|45452_45785_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	6.1e-21	53.2
WP_002295625.1\|45806_46064_+	hypothetical protein	NA	NA	NA	NA
WP_002295624.1\|46222_46345_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_074399798.1\|46534_46759_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	3.6e-09	56.9
WP_002324499.1\|47206_47413_+	hypothetical protein	NA	NA	NA	NA
WP_002287517.1\|47412_47664_+	hypothetical protein	NA	NA	NA	NA
WP_002305049.1\|47679_48117_+	hypothetical protein	NA	NA	NA	NA
WP_002305050.1\|48109_48805_+	hypothetical protein	NA	NA	NA	NA
WP_002324500.1\|48969_49170_+	hypothetical protein	NA	NA	NA	NA
WP_002305052.1\|49644_50076_+	antitoxin HicB	F0PIL2	Enterococcus_phage	4.3e-43	64.9
WP_002325884.1\|50249_51203_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.3e-34	36.1
WP_002323715.1\|51438_52713_+	MFS transporter	NA	NA	NA	NA
WP_002361237.1\|52766_54194_+	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	3.1e-29	26.8
WP_002322785.1\|54206_55079_+	ROK family protein	NA	NA	NA	NA
WP_002305056.1\|55173_56169_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002305057.1\|56258_56444_+	hypothetical protein	F0PIL2	Enterococcus_phage	6.6e-09	58.8
WP_002323453.1\|56851_57469_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.5e-15	36.7
WP_010729769.1\|57626_58853_-\|integrase	site-specific integrase	A0A097BYJ7	Leuconostoc_phage	3.2e-14	24.2
WP_071870188.1\|58926_59094_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002328876.1\|59640_60549_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002328877.1\|60605_61103_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002328878.1\|61139_61835_-	HisJ family histidinol phosphate phosphatase	NA	NA	NA	NA
61808:61867	attL	NA	NA	NA	NA
WP_000997695.1\|62134_63313_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_000202380.1\|64097_65417_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002328880.1\|65704_66328_-	recombinase family protein	M9Q1K0	Clostridium_phage	1.1e-15	32.5
WP_002328881.1\|66645_66984_+	recombinase family protein	NA	NA	NA	NA
WP_002333400.1\|69049_69808_-	HAD family hydrolase	NA	NA	NA	NA
WP_002290556.1\|69812_70580_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002290555.1\|71068_71494_+	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_002290554.1\|71510_72026_+	galactose-6-phosphate isomerase subunit LacB	A0A222YX14	Synechococcus_phage	3.3e-05	36.0
WP_002290553.1\|72036_72969_+	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_002290551.1\|72971_73952_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002290550.1\|73979_74297_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002290549.1\|74296_76003_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002333401.1\|76144_77551_+	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	1.6e-46	29.4
WP_002333402.1\|77867_78767_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_002295345.1\|80516_81026_+	hypothetical protein	NA	NA	NA	NA
WP_002329899.1\|81476_81884_-	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	4.0e-14	38.9
WP_002290351.1\|81880_82114_-	addiction module antitoxin	NA	NA	NA	NA
WP_002290352.1\|82447_83533_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_002290356.1\|84635_84785_-	hypothetical protein	NA	NA	NA	NA
WP_002290357.1\|84777_84987_-	DUF3173 domain-containing protein	NA	NA	NA	NA
WP_002335326.1\|86491_87952_-	sucrose phosphorylase	NA	NA	NA	NA
WP_002342361.1\|87948_89169_-	hypothetical protein	NA	NA	NA	NA
WP_086322102.1\|89229_91413_-	alpha-galactosidase	NA	NA	NA	NA
WP_002290368.1\|91452_92283_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002290370.1\|92294_93167_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002290371.1\|93176_94436_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002329911.1\|94583_95894_-	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
WP_002350071.1\|95925_96750_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002350067.1\|97744_98854_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002338088.1\|99147_100173_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002290379.1\|100417_101689_-	substrate-binding domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	4.1e-17	45.0
WP_002290380.1\|101972_102344_-	glyoxalase	NA	NA	NA	NA
WP_002342357.1\|102383_102920_-	glyoxalase	NA	NA	NA	NA
WP_002290382.1\|102931_103405_+\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
WP_002290383.1\|103577_104132_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002300314.1\|104604_105774_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002319325.1\|106793_107411_-	hypothetical protein	NA	NA	NA	NA
WP_002311006.1\|108475_108697_-	hypothetical protein	NA	NA	NA	NA
WP_008271463.1\|108794_109040_-	hypothetical protein	NA	NA	NA	NA
WP_002344895.1\|110263_111265_-	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_002344896.1\|111423_111690_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002344897.1\|111679_112036_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_044383156.1\|112327_113008_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.2e-109	83.6
WP_002292681.1\|113637_114186_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|114186_115044_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002300557.1\|115328_115616_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292678.1\|115605_115935_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_010729757.1\|119199_120072_-	ROK family protein	NA	NA	NA	NA
WP_002322556.1\|120088_121561_-	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_002313079.1\|121574_122423_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002322555.1\|122419_123286_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002322554.1\|123328_124687_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010729506.1\|124781_125753_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-05	22.4
WP_002313084.1\|126787_127393_+	recombinase family protein	A0A219YA40	Aeromonas_phage	3.6e-19	32.6
WP_002348862.1\|128511_128721_-	hypothetical protein	NA	NA	NA	NA
WP_002301399.1\|128781_129741_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.0e-31	35.5
WP_010729754.1\|130290_131199_+\|transposase	IS982 family transposase	NA	NA	NA	NA
130259:130397	attR	NA	NA	NA	NA
WP_010729753.1\|131258_133061_-	exonuclease DNA polymerase III epsilon subunit	A0A0A7RWA3	Clostridium_phage	7.6e-33	30.4
WP_002342384.1\|133123_133966_-	hypothetical protein	NA	NA	NA	NA
WP_002331328.1\|133981_134203_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002336713.1\|134698_135377_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_002339142.1\|135435_136656_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.9e-57	58.5
WP_002339141.1\|136675_137287_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.7e-56	53.2
WP_002350224.1\|137329_138262_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_002350223.1\|138682_139543_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002298077.1\|140576_141977_-	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
WP_002288620.1\|143758_145000_-	amidohydrolase family protein	NA	NA	NA	NA
WP_010729750.1\|145035_145746_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002288615.1\|145813_146629_-	fructoselysine 6-kinase	NA	NA	NA	NA
WP_002336724.1\|146639_147608_-	SIS domain-containing protein	NA	NA	NA	NA
WP_010729749.1\|148370_149663_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002287659.1\|149926_150280_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002302440.1\|152161_153463_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002389879.1\|153641_153911_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	8.7e-18	48.8
WP_086322080.1\|153900_154239_-	antitoxin	NA	NA	NA	NA
WP_077974475.1\|154235_154463_-	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_010729807.1\|154667_155300_-	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	3.0e-08	27.9
WP_010729806.1\|155312_158036_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002322451.1\|158172_159138_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002298371.1\|159191_160004_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_010729805.1\|160017_160791_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298375.1\|160804_161275_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002298377.1\|161271_161688_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002311511.1\|162012_162855_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002299197.1\|165437_166049_+	VanZ family protein	NA	NA	NA	NA
WP_002299198.1\|166121_167051_+	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	1.1e-06	23.3
WP_074394709.1\|167208_167946_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_010729801.1\|167993_169172_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.7e-23	27.1
WP_080114943.1\|169398_169800_+	hypothetical protein	A0A0N9S006	Staphylococcus_phage	2.5e-24	49.2
WP_002301682.1\|171762_172572_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002301683.1\|172571_173318_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002301684.1\|173335_173803_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002301685.1\|173802_174213_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002301686.1\|174223_175237_-	SIS domain-containing protein	NA	NA	NA	NA
WP_010729798.1\|175453_176188_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010729797.1\|176171_176882_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010861579.1\|176935_177614_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	98.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP035654

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP035655

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection