CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP042180	Pseudomonas sp. KBS0802 chromosome, complete genome	2 crisprs	DEDDh,RT,csa3,cas3,DinG,PD-DExK,WYL	0	0	13	0
NZ_CP042181	Pseudomonas sp. KBS0802 plasmid unnamed, complete sequence	0 crisprs	csa3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042180_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042180_1

4761466-4761586

Orphan

Consensus_repeat	Method
CCCATCGATCTCAGTTATGGCCACAAAGGCCATGACCACTTCACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042180_1

>merge|NZ_CP042180|1|4761466-4761586|CRISPRCasFinder
CCCATCGATCTCAGTTATGGCCACAAAGGCCATGACCACTTCACCCCCAAGGCTCTTCAGCAGCTACCCGTGGCCCCCATCGATCTCAGTTATGGCCACAAAGGCCATGGCCACTTCACCC

>NZ_CP042180|1|1|4761466-4761586|CRISPRCasFinder
CCCATCGATCTCAGTTATGGCCACAAAGGCCATGACCACTTCACCC	CCAAGGCTCTTCAGCAGCTACCCGTGGCC
CCCATCGATCTCAGTTATGGCCACAAAGGCCATGGCCACTTCACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042180.1\|WP_010952753.1\|4777767_4778085_+\|quaternary-ammonium-compound-efflux-SMR-transporter-SugE	unknown	unknown	gnl\|CDD\|171110
NZ_CP042180.1\|WP_010952771.1\|4751597_4752587_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP042180.1\|WP_004577645.1\|4758089_4758428_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP042180.1\|WP_164721827.1\|4754417_4756499_+\|carboxy-terminal-processing-peptidase	unknown	unknown	gnl\|CDD\|236873
NZ_CP042180.1\|WP_010952766.1\|4758542_4758980_-\|DUF1232-domain-containing-protein	unknown	unknown	gnl\|CDD\|225876
NZ_CP042180.1\|WP_010952760.1\|4765590_4766301_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP042180.1\|WP_003252510.1\|4776629_4777550_+\|recombination-associated-protein-RdgC	unknown	unknown	gnl\|CDD\|234726
NZ_CP042180.1\|WP_049587252.1\|4756616_4757699_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP042180.1\|WP_010952762.1\|4762804_4763734_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP042180.1\|WP_010952769.1\|4753315_4754278_-\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP042180.1\|WP_003252539.1\|4757724_4758093_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_010952761.1\|4764029_4765370_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|273326
NZ_CP042180.1\|WP_010952765.1\|4759268_4760021_-\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|223619
NZ_CP042180.1\|WP_049587242.1\|4771365_4775391_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239155
NZ_CP042180.1\|WP_010952759.1\|4766319_4767078_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP042180.1\|WP_010952770.1\|4752601_4753255_+\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP042180.1\|WP_010952756.1\|4768542_4771095_-\|nitrite-reductase-large-subunit	unknown	unknown	gnl\|CDD\|184951
NZ_CP042180.1\|WP_010952764.1\|4760274_4761207_-\|pca-operon-transcription-factor-PcaQ	unknown	unknown	gnl\|CDD\|274127
NZ_CP042180.1\|WP_010952758.1\|4767102_4768053_+\|2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240633
NZ_CP042180.1\|WP_010952757.1\|4768180_4768543_-\|nitrite-reductase-small-subunit-NirD	unknown	unknown	gnl\|CDD\|239605

Protein	Function_ID	Function_description	E-value
NZ_CP042180.1\|WP_010952753.1\|4777767_4778085_+\|quaternary-ammonium-compound-efflux-SMR-transporter-SugE	gnl\|CDD\|171110	PRK11431, PRK11431, quaternary ammonium compound efflux SMR transporter SugE.	7.82255e-35
NZ_CP042180.1\|WP_010952771.1\|4751597_4752587_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	9.78557e-147
NZ_CP042180.1\|WP_004577645.1\|4758089_4758428_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	4.5425e-09
NZ_CP042180.1\|WP_164721827.1\|4754417_4756499_+\|carboxy-terminal-processing-peptidase	gnl\|CDD\|236873	PRK11186, PRK11186, carboxy terminal-processing peptidase.	0
NZ_CP042180.1\|WP_010952766.1\|4758542_4758980_-\|DUF1232-domain-containing-protein	gnl\|CDD\|225876	COG3339, COG3339, Uncharacterized conserved protein [Function unknown].	7.65621e-13
NZ_CP042180.1\|WP_010952760.1\|4765590_4766301_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	5.33796e-65
NZ_CP042180.1\|WP_003252510.1\|4776629_4777550_+\|recombination-associated-protein-RdgC	gnl\|CDD\|234726	PRK00321, rdgC, recombination associated protein; Reviewed.	3.06772e-162
NZ_CP042180.1\|WP_049587252.1\|4756616_4757699_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.09607e-70
NZ_CP042180.1\|WP_010952762.1\|4762804_4763734_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.29624e-25
NZ_CP042180.1\|WP_010952769.1\|4753315_4754278_-\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	2.07634e-153
NZ_CP042180.1\|WP_010952761.1\|4764029_4765370_+\|MFS-transporter	gnl\|CDD\|273326	TIGR00893, Probable_glucarate_transporter, D-galactonate transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	3.83802e-111
NZ_CP042180.1\|WP_010952765.1\|4759268_4760021_-\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|223619	COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones].	2.7914e-80
NZ_CP042180.1\|WP_049587242.1\|4771365_4775391_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239155	cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite. Monomeric Nas is located in the cytoplasm and participates in nitrogen assimilation. Dimeric Nap is located in the periplasm and is coupled to quinol oxidation via a membrane-anchored tetraheme cytochrome. Members of the MopB_Nitrate-R-NapA CD belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_CP042180.1\|WP_010952759.1\|4766319_4767078_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.0493e-59
NZ_CP042180.1\|WP_010952770.1\|4752601_4753255_+\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.38001e-60
NZ_CP042180.1\|WP_010952756.1\|4768542_4771095_-\|nitrite-reductase-large-subunit	gnl\|CDD\|184951	PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional.	0
NZ_CP042180.1\|WP_010952764.1\|4760274_4761207_-\|pca-operon-transcription-factor-PcaQ	gnl\|CDD\|274127	TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria. [Energy metabolism, Other, Regulatory functions, DNA interactions].	1.89644e-121
NZ_CP042180.1\|WP_010952758.1\|4767102_4768053_+\|2-hydroxyacid-dehydrogenase	gnl\|CDD\|240633	cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase. Hydroxy(phenyl)pyruvate reductase (HPPR) catalyzes the NADP-dependent reduction of hydroxyphenylpyruvates, hydroxypyruvate, or pyruvate to its respective lactate. HPPR acts as a dimer and is related to D-isomer-specific 2-hydroxyacid dehydrogenases, a superfamily that includes groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-Adenosylhomocysteine Hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	1.88816e-149
NZ_CP042180.1\|WP_010952757.1\|4768180_4768543_-\|nitrite-reductase-small-subunit-NirD	gnl\|CDD\|239605	cd03529, Rieske_NirD, Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium. Members include bacterial and fungal proteins. The bacterial NirD contains a single Rieske domain while fungal proteins have a C-terminal Rieske domain in addition to several other domains. The fungal NirD is involved in nutrient acquisition, functioning at the soil/fungus interface to control nutrient exchange between the fungus and the host plant. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. The Rieske [2Fe-2S] cluster is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In this family, only a few members contain these residues. Other members may have lost the ability to bind the Rieske [2Fe-2S] cluster.	1.45099e-49

>NZ_CP042180.1|WP_010952764.1|4760274_4761207_-|pca-operon-transcription-factor-PcaQ
MNLDTRIKYRHLLCFLEIARQGSLARAADILSISQPAISKTLKELEDLLEARLFERSRQGVELTPAGTRFMRYAGPSVQALRDGVSSLRGEARAPSQVRIGVLSTVEGLLMPEVLCRLHQRHEALVISVVTGVSAQLLGQLHLGELELVVGRMTDSPQIQGLSFEHLYSESMSLVVRPGHPLLASTPVERGQVGRYPLVLPPAGTTIRQHADSLFVQCGIQMPAQRLETLSLALSRRYLLGSDGLWVAPRDAVLLDLRRGELVELDLGVREPGGSVGICRNAALPLSLPGQWVGEVLREVAGEYREGRYP
>NZ_CP042180.1|WP_010952765.1|4759268_4760021_-|FKBP-type-peptidyl-prolyl-cis-trans-isomerase
MKQHRLAAAVALVGLVLAGCDQQASSPELKTPAQKASYGIGLNMGKSLAQEGMEDLDSKAVALGIEDAVSKKEQRIKDEELVEAFTALQKRAEERLAKASEEAASAGKKFLEENAKKPGVVTTASGLQYEVVKKADGPQPKPTDVVTVHYEGKLIDGKVFDSSVERGSPIDLPVSGVIPGWVEGLQLMHVGEKYKLFIPAELAYGAQSPSPLIPANSVLVFDLELIAIKDPAQLQGAEPQAEAPEEAPAK
>NZ_CP042180.1|WP_010952766.1|4758542_4758980_-|DUF1232-domain-containing-protein
MSAPWNFARFLPLAERLLSRGRLPALLFAVARKGPRLGQLREDVKLLQSLCLAWWRGEYRAISPKALVTVVAGLLYFVSPIDAIPDWLLGVGFLDDIAVLGWVLKTVADELARFKAWRDSQAPERLRVVERLPATPEALRLERNK
>NZ_CP042180.1|WP_004577645.1|4758089_4758428_-|helix-turn-helix-transcriptional-regulator
MGIQVISRDGQPEYAVVPWEQYQALLSAAGQAPAEAVSSEAQGVAASAPLPAFSEVAQIRQAKGIAPEQLARNVGVSPAYLAMIESGERQPDAAIRRALAWHLGVAGWSEPS
>NZ_CP042180.1|WP_003252539.1|4757724_4758093_-|hypothetical-protein
MSQVRISRQHWDNLLGELDLARRQRHLLTYRALIERLQLPSPAMQTLTAALEYLAVLDARAEQPLRSSLVISQGASRLPRTGFFECVERLGRFTGPVDGMEAASWHASEVVRVFEYSYPETA
>NZ_CP042180.1|WP_049587252.1|4756616_4757699_+|EAL-domain-containing-protein
MTVAEQLSALSAILAQRSIHSLFQPIMCLSEHRVFGHEALSRGPSNSPLHAPLNLFTIARQAGRLTELEAACRESACRRFSEQQLQGKLFLNISPESLLEPHYPSGLTLKLLEQVGLPPSRVVIELTEHTPTDDFQLLSNALHHYRDMGFSIAIDDLGAGYSSLRLWSELRPEYVKIDRHFIDGIHRDPLKREFVGSILQIARASKAQVIAEGIELAEELAVLVEMGVDLVQGYLLGRPQEMGVRDSGLLPALTQVPLAEQPTVHLNATIGQLLELFGRYQHLEALEVVDADGRGCGLIHRDALPVPAYSRVNPLLRGPVPNHQSGVGAGLPANTVAAATENDGWKLASRPCLFAQGHHL
>NZ_CP042180.1|WP_164721827.1|4754417_4756499_+|carboxy-terminal-processing-peptidase
MKHFLPSTALAVMIGLGSLTLGGNAAAANKWDSLQPDRDEIVASLNVVELLKRHHYSKPPLDDARSVIIYDSYIKLLDPARSYFTAADIAEFDKWKTQFDDFLKSGNLDPGFTIYKRYLDRVKQRLDFALAELNKGVDKIDFTTKETLLIDRKDAPWMKNQAELDDLWRKRVKDEVLRQKIAGKEPKQIQETLIKRYKNQLTRLDQTRAEDIFQAYINTFAQSYDPHTNYLSPDNAENFDINMSLSLEGIGAVLQSDNDQVKIVRLVPAGPAAKTKQVAPADKIIGVAQGNKEMVDVVGWRLDEVVKLIRGPKGSVVRLEIIPASNAPSDQTSKIVSITREAVKLEEQAAKKSVLKLKQDGRDYKLGIIEIPAFYLDFKAYRAGDPEYKSTTRDVKKLLTELQKEKVDGVVIDLRNNGGGSLQEATELTSLFIEKGPTVLVRNSDGRVDVLEDENPGAFYKGPLALLVNRLSASASEIFAGAMQDYHRALIIGGQTFGKGTVQTIQPLNHGELKLTLAKFYRVSGQSTQHQGVLPDIDYPSIIDTKEIGESALPEAMPWDTIRPVVKPAADPFRPFLAQLKAQHEARSDKDAEFTYIRDRLALTQKLMNEKTVSLNEQERRARHDSIESKQLALENTRRKAKGEEPLKELKKEDEDALPVEDENTKPEDDAYLAETGRILIDYLSASTKVAKK
>NZ_CP042180.1|WP_010952769.1|4753315_4754278_-|NAD(P)H-quinone-oxidoreductase
MKALQGVDGHVEWVEAERPTCDAGQVRIRVAAAGLNRADLLQMKGLYPPPPGASPYMGLECSGVVEEVGAGAAWRVGDRVCALLASGAMAEEVVVDARHVLPVPEGLGLHEAAALPEVYATAWLNIFQLGAVKAGEKVLVHAGASGVGSAAIQLCKAFGSPVWVSVGSQDRLAYCQALGAAGGVVRNENLDALEGFGPFDVILDPVGASYGELNLKLLARDGRWVIIGLMGGRKFELDLAQVLGKRLEITGSTLRNRDDGFKAELLRELQQQVWPLFAEGRLSPQLVDTYPVEFAQAAYAELETNQVSGKLVMVIDPSLV
>NZ_CP042180.1|WP_010952770.1|4752601_4753255_+|HAD-IB-family-hydrolase
MALAIFDLDETLIHGDCASLWSEQMARLGWVDGKDFLRRDHELMEAYGRGHLQMEDYMAFSLEPIAGRTLEEVEHLVAPWVEEVIEPIIYGDACRCIAEHRKRGDRILIISASGTHLVGPIAARLGVDEYLAIELEAVNGVYTGKTHGVLTYREGKITRLLEWLDQEQENLEGASFYSDSRNDLPLLLRVDHPHVVNPDAVLREHAEINGWPTLSWS
>NZ_CP042180.1|WP_010952771.1|4751597_4752587_+|ABC-transporter-ATP-binding-protein
MSFVSVQKLQKSYAGSPVFERIDCHIERGEFVTLLGPSGCGKSTLLRCIAGLTSVDSGQILLDGHDIVPLSPQKRGIGMVFQSYALFPNMTVEQNVAFGLRMQKVKADESQLRVREVLELVELGKFAGRYPHQLSGGQCQRVALARSLVTRPRLLLLDEPLSALDARIRKHLREQIRAIQRELGLTTIFVTHDQEEALTMSDRIFLMNQGRIVQSGDAETLYTAPVDLFAAGFIGNYNLLDADSASRLLQRPVASRLAIRPESITLGEHGELDAEVRSHSLLGNVIRYRVRVREVELVVDVLNRSPADLHADGKRVSVSIDPTALREVA
>NZ_CP042180.1|WP_010952762.1|4762804_4763734_-|AraC-family-transcriptional-regulator
MPPKREVPTYVMQQRSELMDFYIRDQRGRPAETAPHRHEYFQIQVNLGGDTVQHIGSVQRPFRRNTLAFILPHRVHVIPHPADSDFVVINFSQTFLLPHLACDPMDLEEVSILQAPELSPFRFQEHLDFHLSDPDFAEVRQTLERMRALDANRRFGTREILKGLLLQLIGQVCGLYAEPLRELADSNAAQLSRRAALGRMSDYLRRHIDDPDLNLQKVAAATYLSPTYLTHWLRKEIGKTFSELVLERRMHAARNYLLNGSRPVGEVARLCGFADEAYFSRRFRQIHGLPPGQFRRQQRDPDTPQAAML
>NZ_CP042180.1|WP_010952761.1|4764029_4765370_+|MFS-transporter
MSSTPTPRAASSYTLDAAPAQRLPTRRRWFMLSLLLVATIINYVDRVNISIAAPFMAKDLGLDKVEMGLIFSAFAWTYALALVPAGFIADRFGSRLTYGVSLISWSAVTVAQGLASGFASLFGLRLAVGAMEAPAFPANSRAVTVWFPARERGMASSIYVCGQYLGTALFTGALLWLATTYDWRHVFYSTGLVGILFGVVWLVLYRDPLNCKKVSKEELAYIENGGGLVKSSQERTRFDWRQVAELFRYRQVWAICLGKFASTSALYFFLTWFPTYLIEERQLTLIKVGIFAVMPFIGATVGILLAGIVSDLLIRKGYSLSFARKLPLVVGSMLGMSIVLVNFTDSNVLCIAVLTLAFFAQGIASSSWAAVSEVAPKELIGLTGGITSLAANIGGIVTPIVIGAIVHASGSFAMAFWFIGGVALMGTLSYSLLLGKLYRIELKTAG
>NZ_CP042180.1|WP_010952760.1|4765590_4766301_+|fumarylacetoacetate-hydrolase-family-protein
MTYLFNPPAIVSLPIRGSDARFPVGRVFCLGRNYPWPESYGAAPQEPVFFMKPASNVVEALGELPFPPQTDEFCHEIELVAAIAKGGANIAREHALEHVFGFAAGLDMTRRDHQRKAKAEGLPWEAAKVFEASAPMTAIVPASECDWPLDTSLWLQVNGQERQRAHLSQQTWALAEVISRLSRQLPLRPGDLIMTGSPPGVAPLNPGDTLHAGIDGIGELHLHVGPRPVGHTANAA
>NZ_CP042180.1|WP_010952759.1|4766319_4767078_+|SDR-family-oxidoreductase
MSQNKKVALVTGAGSGIGRAVALALLEDNFSLVLAGRRAEPLQAVVEQALAAGGEALAVPTDVRDEQSVAHLFATIEEVHGRLDVMFNNAGINAPAVPVDELPLENWRNVIATNVDGVFLCARAAFGLMRRQQPQGGRIINNGSISAHTPRPFTAPYTASKHAVLGLTKALALDGRPYHIVCSQVDIGNALTELSERMTRGVRQANGEIAAEPMLDVRHVADAVRYIAALPLDANVLNMTVMASNMPFVGRG
>NZ_CP042180.1|WP_010952758.1|4767102_4768053_+|2-hydroxyacid-dehydrogenase
MKPEVLQLSPILIPQIRERLEQLFTVHRYYEQADKEAYVSQHAGNIRGVITGGHTGISQALMARLPNLEVIAVNGVGTDAVDLAYARDRGIQVTATIGALTEDVADLAIGLLIGLCRGICTGDRFVRAGRWATSTTPLAPLPLARQVSGMRVGIVGMGRVGRAVAQRAAAFGCPIRYTDLQALDVPYGFEADLLQLAKDSDALILAAAADKGEALINRDVLQALGSEGYLINIARGKLVDEPALIAALQAGEIGGAALDVFADEPRAPEALFEREDVVLQPHRASATVQTRTRMGEMVVASLVDVFAGRTPQGLVI
>NZ_CP042180.1|WP_010952757.1|4768180_4768543_-|nitrite-reductase-small-subunit-NirD
MNLANAAVNTQENWQTVCQAQDLVADSGVVVWLDGAQVALFYLPGQAQPLYAVDNRDPRSGANIIGRGLVGSVQGELVVAAPLYKQHFSLLSGECLEDAGQRLRVWPVRLKGEAVELAVA
>NZ_CP042180.1|WP_010952756.1|4768542_4771095_-|nitrite-reductase-large-subunit
MKATASSGQRERLVIVGNGMVGHHCVEQLVSRGALQRFEVRVFGEERQRAYDRVHLSEYFGGSCAETLALCEHDFYEANGVHLHLGEAVLEIDRERREVVTAAGRYGYDQLVLATGSYPFVPPIEGSSGNARLVYRTLDDLDGIRAAAAGARRGVVVGGGLLGLEAANALKSLGLEAHVVEFAPRLMPVQLDGEGGAALKAQIEALGVGVHLSRATQSVSAGETYRYRMNFDGGEHLETDLIVFSAGIRPQDALGRGCGLDIAARGGVVIDNHCRSSDPRIFAIGECASWNGSVFGLVAPGYSMARNLAGLLMGEAAVAFTGADMSTKLKLLGVDVGSIGDAHGATPGARSYRFIDEANSAYRRLVVDASGKHVLGAVLVGDNSYYDTLLQYAQNGIALPADPAALILPQGGGAPALGADALPDSATICSCHNVSKGAVCAAIDSGCSDLAAVKGCTKAATGCGGCAALLKQVFEHELTARGVAVDKSLCEHFAYTRQELYGLVRVEGIRTFSELLERHGKGHLGCDICKPAVGNILASCWNQPIMDPALVPLQDTNDTFMANMQKNGTYSVVPRIPGGEITPDKLIVIGQVAKKYDLYTKITGGQRIDLFGAQLHELPLIWGELIEAGFETGHAYGKSTRTVKSCVGSTWCRYGVQDSVAMALRLEDRYKGLRSPHKLKFAVSGCTRECAEAQSKDIGVIATDKGWNLYVCGNGGMRPRHAELFATDLDDEALVRLIDRVLMFYIRTADKLQRTSVWRENLEGGLDYLKQVIIDDSLGLASELESQMQHVVDQYECEWANALNDPEKLKRFRTFVNDRRADPDVHFVREREQRRPAAPLHLIPTVEEAV
>NZ_CP042180.1|WP_049587242.1|4771365_4775391_-|molybdopterin-dependent-oxidoreductase
MANSEVRSVCPYCGVGCGIVMSVADGKVGKISGDKLHPSNFGRLCTKGLTAHQPLSASGRMADAYLRQQRSQPPVRTSMDQAIAATAERLRGIIDQHGPDAVALYVSGQMSLEAQYLANKLAKGFIRTRHIESNSRLCMASASSGYKLSLGADGPPGSYQDFEHADVFLVIGANMADCHPILFLRLLDRVKAGAKLIVVDPRRSATADKADLFLQVRPGSDMALLNGLLHLLHRNGHTNPDFIARHTEGWDEMPAFLDDYTPERVAAITGLAEADIIKAAEWIGSANNWMSCWTMGLNQSIHGTWHSNAICNLHLATGAICRPGSGPFSLTGQPNAMGGRDMGYMGPGLPGQRSALVEDDRAFVERQWQLPPGSLRSEGGEGTVALFGQMKAGEVKACWVICSNPVASVANRQQVIDGLRKAELVITQDAFLDTETNRYADILLPAALWAEGEGVMINSERNLTLMPRAVEPPGQSLPDWQIIARVACAMGYADAFDYPNAEAVYEEIRRFHNPSTGYDLRGIGYAELRTQPRQWPCAPGSEQHRSPLRYLNDGSSQALLLDARGRRPALAFPTASGKAHFFARPWLPAAEVPDDDYPMVLNTGRVQHQWHTLTKTGKVPALNKLEPGPYLEIHPEDAARLGVAEKDQVAVRSRRGQAVLPARISDRVMPGNCFAPFHWNDLIGEQLAINAATCDAVDPLSLQPAFKHCAVALERVAGERIDALDLNTATVEPVRMPTATLSRLLGLHTLPVPVLAEEERHYLQGFLLGLDQARAEGVPRLPASAPLAASRRLFVDGLLAGLFAQPATAPIAAQAAPWHQVLWASQTGNGEQLAERCAARLRGAGLNVQLSCLEAVSPSQLQGAASVVLIASTFGDGDAPDSGAAFWQALQGEEGAHCAGLPYAVLALGDSSYDQFCGFGRKLDQRLAELGGHRLLARVDCEPDFDEAFAGWLEALLPALGTAAAPSPASEPAPVSAFSKQQPWMATVLENRLLNGPGASKETRQLVFDLGGSGFSYAAGDALGVWPRNCPALVEELLTLMQLDGQAMVELKGHSTMPLAEALRAHLEIAKVTAQQLQAFASNAPDLQRLLQPECKAELQDWLWGRQLVDVLRAFPQQLPLASWLELLKPLQPRLYSISSSPLAHPGQVHLTVSTVRYGERKGVCSSFLADRAQVQKVAIFPQVSKHFRLPEDDSVPVIMVGPGTGIAPFRAFLEEREARGAKGDNWLFFGEQYAATDFYYQEQLQAWQAAGHLRLDTAFSRDQVEKIYVQQRMLEQGALLWQWLEAGAYFYVCGDAQRMARDVDAALRVIVAEHGRMDAAAAAAYVEGLSKARRYRRDVY
>NZ_CP042180.1|WP_003252510.1|4776629_4777550_+|recombination-associated-protein-RdgC
MWFKNLLTYRLTQEVPFEPEALEAALASKPARPCASQELTTYGFVAPFGKGEDAPLVHVSGEYLLIAARKEERILPSSVVNDAVKEKVEEIETEQMRKVYKKERDQIKDEIIQAFLPRAFIRRSMIFAAIAPRLGVILVNSASAKRAEDLLSTLREVMGSLPVRPATVKIAPVATMTDWVKSQQAAEGFYVLDECELRDTAEDGGIVRCKRQDLTGEEIQLHLSTGKVVTQLALAWQDKLSFILDDKMVIKRLKFEELLQEQAEQDGGDEAAQQFDASFQLMMMTFAEFLPVLFEALGGEEIPQGV
>NZ_CP042180.1|WP_010952753.1|4777767_4778085_+|quaternary-ammonium-compound-efflux-SMR-transporter-SugE
MSWIILFFAGLFEVGWAVGLKYTDGFTRPLPTVLTVGAMVISLGLLGLAMKELPLGTAYAIWTGVGAVGTVIAGIILFGESMALVRLVSVALIVCGLVGLKVSAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP042180_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042180_2

4923805-4923883

Orphan

Consensus_repeat	Method
GAGTCGGCGGTTTTGGTCTGTTTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042180_2

>merge|NZ_CP042180|2|4923805-4923883|CRISPRCasFinder
GAGTCGGCGGTTTTGGTCTGTTTCGACTCTGAGCCGATTCGGACCACTTCAGCCGAGTCGGCTGTTTTGGTCTGTTTCG

>NZ_CP042180|2|2|4923805-4923883|CRISPRCasFinder
GAGTCGGCGGTTTTGGTCTGTTTCG	ACTCTGAGCCGATTCGGACCACTTCAGCC
GAGTCGGCTGTTTTGGTCTGTTTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042180.1\|WP_126404382.1\|4928721_4928955_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_049587420.1\|4919907_4920225_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_010952637.1\|4922243_4922540_-\|DUF1364-domain-containing-protein	unknown	unknown	gnl\|CDD\|377777
NZ_CP042180.1\|WP_049587412.1\|4925521_4925815_-\|DUF1654-domain-containing-protein	unknown	unknown	gnl\|CDD\|311699
NZ_CP042180.1\|WP_010952643.1\|4919032_4919356_-\|phage-holin,-lambda-family	unknown	unknown	gnl\|CDD\|368287
NZ_CP042180.1\|WP_010952638.1\|4921824_4922247_-\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|370112
NZ_CP042180.1\|WP_010952644.1\|4918789_4918972_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372856
NZ_CP042180.1\|WP_010952645.1\|4918430_4918799_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|366837
NZ_CP042180.1\|WP_049587410.1\|4926607_4926802_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_049587408.1\|4927167_4927551_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP042180.1\|WP_010952634.1\|4924340_4924517_-\|Cro/Cl-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|373126
NZ_CP042180.1\|WP_049587416.1\|4922542_4923355_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236153
NZ_CP042180.1\|WP_010952640.1\|4920221_4920542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_010952630.1\|4927569_4927839_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_010952633.1\|4924605_4925457_+\|Cro/Cl-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|119397
NZ_CP042180.1\|WP_049587419.1\|4920538_4921828_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP042180.1\|WP_010952629.1\|4927835_4928294_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042180.1\|WP_010952632.1\|4926173_4926611_+\|tellurite-resistance-protein	unknown	unknown	gnl\|CDD\|143580
NZ_CP042180.1\|WP_010952642.1\|4919555_4919897_-\|antitermination-protein-Q	unknown	unknown	gnl\|CDD\|368957
NZ_CP042180.1\|WP_010952628.1\|4928375_4928762_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223100

Protein	Function_ID	Function_description	E-value
NZ_CP042180.1\|WP_010952637.1\|4922243_4922540_-\|DUF1364-domain-containing-protein	gnl\|CDD\|377777	pfam07102, DUF1364, Protein of unknown function (DUF1364). This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.	5.7178e-50
NZ_CP042180.1\|WP_049587412.1\|4925521_4925815_-\|DUF1654-domain-containing-protein	gnl\|CDD\|311699	pfam07867, DUF1654, Protein of unknown function (DUF1654). This family consists of proteins from the Pseudomonadaceae.	4.89146e-17
NZ_CP042180.1\|WP_010952643.1\|4919032_4919356_-\|phage-holin,-lambda-family	gnl\|CDD\|368287	pfam05106, Phage_holin_3_1, Phage holin family (Lysis protein S). This family represents one of a large number of mutually dissimilar families of phage holins. Holins act against the host cell membrane to allow lytic enzymes of the phage to reach the bacterial cell wall. This family includes the product of the S gene of phage lambda.	7.69023e-41
NZ_CP042180.1\|WP_010952638.1\|4921824_4922247_-\|VRR-NUC-domain-containing-protein	gnl\|CDD\|370112	pfam08774, VRR_NUC, VRR-NUC domain.	5.21937e-18
NZ_CP042180.1\|WP_010952644.1\|4918789_4918972_-\|hypothetical-protein	gnl\|CDD\|372856	pfam13974, YebO, YebO-like protein. This short protein is uncharacterized. It seems likely to be of phage origin as it is found in Enterobacteria phage HK022 Gp20 and Enterobacteria phage HK97 Gp15. The protein is also found in a variety of enteric bacteria.	0.00238291
NZ_CP042180.1\|WP_010952645.1\|4918430_4918799_-\|HNH-endonuclease	gnl\|CDD\|366837	pfam01844, HNH, HNH endonuclease. His-Asn-His (HNH) proteins are a very common family of small nucleic acid-binding proteins that are generally associated with endonuclease activity.	3.53734e-11
NZ_CP042180.1\|WP_049587408.1\|4927167_4927551_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	1.30916e-12
NZ_CP042180.1\|WP_010952634.1\|4924340_4924517_-\|Cro/Cl-family-transcriptional-regulator	gnl\|CDD\|373126	pfam14549, P22_Cro, DNA-binding transcriptional regulator Cro. Bacteriophage P22 Cro protein represses genes normally expressed in early phage development and is necessary for the late stage of lytic growth. It does this by binding to the OL and OR operator-regions normally used by the repressor protein for lysogenic maintenance.	2.09903e-21
NZ_CP042180.1\|WP_049587416.1\|4922542_4923355_-\|ATP-binding-protein	gnl\|CDD\|236153	PRK08116, PRK08116, hypothetical protein; Validated.	8.94062e-44
NZ_CP042180.1\|WP_010952633.1\|4924605_4925457_+\|Cro/Cl-family-transcriptional-regulator	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	9.0537e-17
NZ_CP042180.1\|WP_010952642.1\|4919555_4919897_-\|antitermination-protein-Q	gnl\|CDD\|368957	pfam06530, Phage_antitermQ, Phage antitermination protein Q. This family consists of several phage antitermination protein Q and related bacterial sequences. Antiterminator proteins control gene expression by recognising control signals near the promoter and preventing transcriptional termination which would otherwise occur at sites that may be a long way downstream.	1.32138e-08
NZ_CP042180.1\|WP_010952632.1\|4926173_4926611_+\|tellurite-resistance-protein	gnl\|CDD\|143580	cd07176, terB, tellurite resistance protein terB. This family contains uncharacterized bacterial proteins involved in tellurium resistance. The prototype of this CD is the Kp-terB protein from Klebsiella pneumoniae, whose 3D structure was recently determined. The biological function of terB and the mechanism responsible for tellurium resistance are unknown.	3.77619e-18
NZ_CP042180.1\|WP_049587419.1\|4920538_4921828_-\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.81964e-49
NZ_CP042180.1\|WP_010952628.1\|4928375_4928762_+\|hypothetical-protein	gnl\|CDD\|223100	COG0021, TktA, Transketolase [Carbohydrate transport and metabolism].	0.00950354

>NZ_CP042180.1|WP_049587416.1|4922542_4923355_-|ATP-binding-protein
MRSESVITMSDVRNAAGFRVQPAHCEHHGDFEQRVTMLMGREIVGRCPECEKAAIAERQAKQQAEETRLKREAMTRKLGSALIPKRFAERTLANYRVEHEGQRKALAYCTRYVAAFEEIERTGRCLMLLGRVGTGKTHLGAGMANELMRNTSATAVYRTVGAVLQSIRATYDRHSEQSEADILSSLIEPSLLVLDEVGVSKEQPSEFELTTLFSIINGRYEQMRPTVVISNLEASQLRHAMGERCYDRLREGGGVVVPFEWESHRGKEEF
>NZ_CP042180.1|WP_010952637.1|4922243_4922540_-|DUF1364-domain-containing-protein
MRQTKLTKAARGRECQVRIPGVCNGNPETTVLAHYRLAGTCGVGKKPHDMQGAWCCSACHDACDGRSRAVGRETARQYHAEGVMRTQALLLNEGVLVE
>NZ_CP042180.1|WP_010952638.1|4921824_4922247_-|VRR-NUC-domain-containing-protein
MTNQRPPFRNPARAKPVDREGQEQAALLEEIQLRYPDVYELICHVPNGGHRHKGVALKLKAQGVKAGIPDLVLTMARGGYFGLYIEFKATVDPAPVSSSQQACIRRLNDQGYLAVVCQGHFDAMACLRAYLALPKTEVAA
>NZ_CP042180.1|WP_049587419.1|4920538_4921828_-|site-specific-integrase
MTNTAAVKISDAEIRRQAAGQVRDLRALGNHGLYFRFHRSRERGSWYLIHKGKWNLIGSYPELSAAKVAAALPDIRLRLEAGEGSSLSSWVLTGELLDWFAERMSRDRSLSAKRKRTAASAIKQHLAPRLGETPLAQIDKALLDRELMWPLQESLSIDYVRLVFQLLALAFRQAAKLGLISTNPMAGIRFRDFSKAKVTVKPSRLRGVHLEDLMARMKSTLAHNPQHGLLALMMLCHGTRLGETRMARWSHISLAEREWFIPAEHTKTGVQHRLPLTDQVRFLLMACREIQLKQGYEGEFLFPGRQGKPMSESKASAVFSVMGQGEWTSHDLRKLARTGWADLGVDHLVGELLINHAMGHNVKVYIQSDVMARKREALEKWHAHLDQKGFASVHGLTGDRSTDSWILCEVAGRAGFDGLPVSTISEDSK
>NZ_CP042180.1|WP_010952640.1|4920221_4920542_-|hypothetical-protein
MTQNLKAGDLALITGAFSVTENIGRSVQLVEFVPPFGSVFYQDGYFDADAPGLWIVTAKGLMRNAEGGKVVSNLAGCDPQHLRPLRGDEAPKLDVEEICHLFQVPA
>NZ_CP042180.1|WP_049587420.1|4919907_4920225_-|hypothetical-protein
MRKSHGPSFKKAVIELDVCPLCRGRAVTQGLFHELPCDHCNASGWVVAATGEALALDELVTQLSLKLQAATRQIEQLKNPQASGPEATYQGSNRRGAGGTNHTGD
>NZ_CP042180.1|WP_010952642.1|4919555_4919897_-|antitermination-protein-Q
MSNVEKSAEYLLEHWGRWVVLGSGVSCCASRENTILDPMITDDDALFIDRLVGRLSKRYPECGQVIIKYYTSRDTSLRDVGKKLGFGEEKTRQLWKAGVAWIDGAIDIRREAA
>NZ_CP042180.1|WP_010952643.1|4919032_4919356_-|phage-holin,-lambda-family
MPNMPEKDPGLWAAVLTWVLAHQPQLYAAGLSVAIAVLRVVYGGGTRRQMFLEGALCGLITLALVPLLEWMGLPQGMATFAGGMVGFMGVEKLRGYSDLFLSRKAQG
>NZ_CP042180.1|WP_010952644.1|4918789_4918972_-|hypothetical-protein
MNEQAISLLQQILDQQQKQTSLLEQIATQNLALIEALADDTAIDSDELPRTHYLDGSPCR
>NZ_CP042180.1|WP_010952645.1|4918430_4918799_-|HNH-endonuclease
MPLRPQRPCRAQGCRSLHRNANGYCDGHADLAAEQAKAWATRKGSGRGGRPWRRKRERILKRDQYLCRCDDCAQLGRIREAHEVDHIVALAHGGTDDDDNLRAINRDCHKAKTQRESKTIKK
>NZ_CP042180.1|WP_010952634.1|4924340_4924517_-|Cro/Cl-family-transcriptional-regulator
MTKSQAIQHFGSISALAKALGVTYEAVRQWADVPELRQYQIERLTKGALKAGKRDAAA
>NZ_CP042180.1|WP_010952633.1|4924605_4925457_+|Cro/Cl-family-transcriptional-regulator
MKTTDRITKLVLTRRPQLGVRNVKRDIANTCGISYEAVRQWFAGDTENIKNENLVALAEGYDTTVDWLLSGKGEPPRKGAAKQEQTKEVSTPSSAADAVRKMLEKHGKGLTAEARQRIVSAVEHDPQGEKESGFLIAANPATRGDISIPQYDIRAAMGHGQVPAEYSEIIRNVVISEDLLRDKGVNYTAPQSLAIITGWGQSMEGTINDKDPVIVDRGVNDYAGEGVYVLTWHGDLLIKRLQRKDEDHLWLISDNPHNKDQQARIDDVTIHAKVLLVWNARKV
>NZ_CP042180.1|WP_049587412.1|4925521_4925815_-|DUF1654-domain-containing-protein
MEELTSLERLGLRVSAMINSPLAQHGRRVLVPRLDTDNDQDWGAIMDLLAESDGLEMSFCEDGSVLLQWDAPTDDDRVIESEEDVSLVDSDGEEAPF
>NZ_CP042180.1|WP_010952632.1|4926173_4926611_+|tellurite-resistance-protein
MLGKLFGKKGREARAAMQVVQNRDLMQAIVYGAFYVAAADGDIGEDEIKKTEKLIANTPQLKGFGPELSNTMDRAEKDFHDGGHRILRMNAEKELKDLAHSPEEAAIVINVMLTIAEASGDIDEKEMAVLEKSAKLMGLSLKDYL
>NZ_CP042180.1|WP_049587410.1|4926607_4926802_+|hypothetical-protein
MIRIASFGIMVAAVVWLAMRGIDYGTCAWYGHQTERDTRYAAFVGCMVKTSSGWVPRNELRTQQ
>NZ_CP042180.1|WP_049587408.1|4927167_4927551_+|helix-turn-helix-transcriptional-regulator
MDTITIGAWIGHLGRGLAPRELQCLLEVARGLTTKEIARSFGISESGVEKRLGDAMLKLKVRRRTALVAEAAYQKIITPLCLALVCLVAMHAAINDSDPMRRDRRAPERRTAQVRIVRKAEAFEYHA
>NZ_CP042180.1|WP_010952630.1|4927569_4927839_+|hypothetical-protein
MQTTMHPAFQEKVDTLKALLARTQEARDEAFAKIGQGTPRYQASGKGKIWDVIEIATGAKQGFAYSYQTAMRFVDAMEAGAASKQGGMR
>NZ_CP042180.1|WP_010952629.1|4927835_4928294_+|hypothetical-protein
MSKRKPHNMRSRLERTSRALVTANYAAVVNIDPSGQQVLVNCKNLKQICVRQVVDAVCDIPHRWTIYLSVLCRTELGERYHKSIEVAPQGNYRADHLTDVIESTYTDLRATANPNHLVAAGWIAIPTDITLDEAEAAKIFAAVGAWNQQKAA
>NZ_CP042180.1|WP_010952628.1|4928375_4928762_+|hypothetical-protein
MAEKKTGAAKHSADYRDRQKKAAAKLGIEKVFFNMPEGIKAAMAAEIERHGYDQVQELWQDLALSWIAQDPEERARRLERPDAPAFYISPKLAREFEAASMAELKRDPGCEVINPFTSSVRHTPQVAR
>NZ_CP042180.1|WP_126404382.1|4928721_4928955_-|hypothetical-protein
MAWYHRDSDVKKSTSDAYKREFKPGEKAEWPGIYHCINCGDEIAIAGGHTLPAQNHYQHTSQKPIIWRLAVYAEQKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

345526 : 393849

Bacillus_virus(20.0%)

transposase,protease,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010951660.1\|345526_346705_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-25	36.7
WP_003255725.1\|346701_347547_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_010951661.1\|347631_348579_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010951662.1\|349031_350408_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_010951663.1\|350909_352016_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_003255717.1\|352135_352393_-	hypothetical protein	NA	NA	NA	NA
WP_049588074.1\|352731_354312_+	metallopeptidase	NA	NA	NA	NA
WP_010951666.1\|354411_354882_-	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_010951667.1\|354892_355858_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_010951668.1\|356024_356909_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_049588076.1\|357032_357977_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011953245.1\|358121_359069_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_020193116.1\|359072_359690_-	hypothetical protein	NA	NA	NA	NA
WP_020193117.1\|359763_360456_-	hypothetical protein	NA	NA	NA	NA
WP_049588079.1\|360594_361011_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_003255700.1\|361296_362274_+	membrane dipeptidase	NA	NA	NA	NA
WP_003255698.1\|362349_362880_+	hypothetical protein	NA	NA	NA	NA
WP_003255697.1\|362895_364956_+	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_010951673.1\|365134_367087_+	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_049588082.1\|367086_368319_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_010951675.1\|368329_369100_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_010951676.1\|369701_370433_+	RHS repeat-associated core domain-containing protein	B6SD27	Bacteriophage	1.1e-19	46.6
WP_010951677.1\|370497_371790_-	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_049588084.1\|372085_373186_+	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_010951679.1\|373294_374920_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-70	44.5
WP_003255686.1\|375186_375417_+	hypothetical protein	NA	NA	NA	NA
WP_003255684.1\|375413_375716_+	cell division protein ZapA	NA	NA	NA	NA
WP_010951680.1\|375898_377836_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_010951681.1\|377870_378911_-	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_003255681.1\|379236_380490_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.3e-100	53.0
WP_003255680.1\|380505_381756_+	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_010951682.1\|381770_382106_+	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_010951683.1\|382102_385117_+	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_003255677.1\|385191_385824_+	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_003255675.1\|385835_386693_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_003255673.1\|386994_388194_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	3.8e-12	28.5
WP_110771781.1\|388397_389156_-	RHS repeat-associated core domain-containing protein	NA	NA	NA	NA
WP_049588087.1\|389514_390090_+	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_010951686.1\|390110_390860_-	RHS repeat-associated core domain-containing protein	NA	NA	NA	NA
WP_010951687.1\|391071_391959_-	acyltransferase	NA	NA	NA	NA
WP_010951688.1\|392140_392641_+\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_010951689.1\|392790_393849_+\|transposase	IS110-like element ISPpu11 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1085221 : 1093000

Thermobifida_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010952145.1\|1085221_1086076_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	8.1e-09	32.8
WP_003255137.1\|1086078_1086543_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003255135.1\|1086555_1086864_-	ribosome-associated translation inhibitor RaiA	A0A0K1LP60	Escherichia_phage	4.4e-05	34.1
WP_003255133.1\|1086943_1088437_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_010952146.1\|1088612_1089338_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-23	26.5
WP_003255131.1\|1089338_1089863_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_010952147.1\|1089849_1090422_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_010952148.1\|1090430_1090955_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	5.3e-27	48.1
WP_010952149.1\|1090967_1091942_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	2.1e-37	33.1
WP_010952150.1\|1092190_1093000_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.9e-25	32.5

DBSCAN-SWA_3

1594590 : 1654796

Planktothrix_phage(28.57%)

transposase,integrase

attL 1620387:1620401|attR 1660049:1660063

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004573968.1\|1594590_1595688_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_010955161.1\|1596178_1597759_+	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_079732594.1\|1597783_1598887_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_079732593.1\|1598867_1599164_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_010955159.1\|1599160_1600555_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010955158.1\|1600685_1601627_+	ABC transporter permease	NA	NA	NA	NA
WP_010955157.1\|1601623_1602496_+	ABC transporter permease	NA	NA	NA	NA
WP_010955156.1\|1602561_1604394_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-19	30.2
WP_049587038.1\|1604504_1605578_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_049587039.1\|1605951_1606596_+	MFS transporter	NA	NA	NA	NA
WP_049587040.1\|1606600_1607230_+	hypothetical protein	NA	NA	NA	NA
WP_010955154.1\|1607653_1608739_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_154070662.1\|1609620_1609788_-	hypothetical protein	NA	NA	NA	NA
WP_049587043.1\|1609992_1610229_-	hypothetical protein	NA	NA	NA	NA
WP_010955153.1\|1610342_1610969_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_049587054.1\|1611076_1611286_+	hypothetical protein	NA	NA	NA	NA
WP_010955152.1\|1611378_1611633_+	hypothetical protein	NA	NA	NA	NA
WP_010955151.1\|1612317_1614081_-	ATP-binding protein	NA	NA	NA	NA
WP_010955150.1\|1614077_1615328_-	hypothetical protein	NA	NA	NA	NA
WP_126404334.1\|1615989_1616379_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_010955149.1\|1616508_1617630_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.0e-32	32.6
WP_010955146.1\|1618567_1620103_-\|transposase	IS66-like element ISPpu14 family transposase	A0A218MNE7	uncultured_virus	4.3e-117	46.4
WP_010955145.1\|1620166_1620502_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
1620387:1620401	attL	NA	NA	NA	NA
WP_010955144.1\|1620498_1620819_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_051122591.1\|1620915_1621500_-	amidohydrolase	NA	NA	NA	NA
WP_010954362.1\|1621515_1623051_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.6e-118	46.1
WP_004575513.1\|1623114_1623450_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_010954361.1\|1623446_1623767_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_010955143.1\|1624176_1624530_-	RidA family protein	NA	NA	NA	NA
WP_010955142.1\|1624504_1625803_-	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_010955141.1\|1626297_1627650_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.1e-51	30.5
WP_023048454.1\|1628088_1629279_-	ectoine hydrolase DoeA	NA	NA	NA	NA
WP_010955139.1\|1629328_1630321_-	ectoine utilization protein EutC	NA	NA	NA	NA
WP_010955138.1\|1630332_1631325_-	hydroxyectoine utilization dehydratase EutB	NA	NA	NA	NA
WP_029886623.1\|1631432_1632830_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010955136.1\|1633076_1633931_+	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
WP_010955135.1\|1634001_1634658_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
WP_010955134.1\|1634657_1635314_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
WP_010955133.1\|1635412_1636180_+	ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA	G9BWD6	Planktothrix_phage	4.4e-30	41.7
WP_010955132.1\|1636230_1636698_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_010955131.1\|1636900_1637896_+	N-alpha-acetyl diaminobutyric acid deacetylase DoeB	NA	NA	NA	NA
WP_010955130.1\|1638155_1639628_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010955129.1\|1639649_1641041_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_110771811.1\|1641659_1642822_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.9
WP_010955126.1\|1643123_1643447_-	hypothetical protein	NA	NA	NA	NA
WP_049586749.1\|1643541_1643832_-	hypothetical protein	NA	NA	NA	NA
WP_010955125.1\|1643920_1644061_+	hypothetical protein	NA	NA	NA	NA
WP_049586751.1\|1644373_1644592_+	hypothetical protein	NA	NA	NA	NA
WP_049586753.1\|1644603_1645005_+	hypothetical protein	NA	NA	NA	NA
WP_049586754.1\|1645094_1645319_-	hypothetical protein	NA	NA	NA	NA
WP_010955122.1\|1645420_1646521_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_110771813.1\|1647946_1648450_-	hypothetical protein	NA	NA	NA	NA
WP_049586756.1\|1649393_1649993_-	hypothetical protein	NA	NA	NA	NA
WP_145122544.1\|1650063_1653354_-	hypothetical protein	NA	NA	NA	NA
WP_010955117.1\|1653365_1654796_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1660049:1660063	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1984442 : 2053020

Pseudomonas_virus(22.22%)

transposase,plate,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010954909.1\|1984442_1984790_+\|head	head completion/stabilization protein	NA	NA	NA	NA
WP_010954908.1\|1984782_1985145_+	hypothetical protein	Q9ZXL8	Pseudomonas_virus	4.6e-06	42.2
WP_010954907.1\|1985141_1985519_-	transcriptional regulator	NA	NA	NA	NA
WP_010954906.1\|1985698_1985962_+	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	8.3e-13	48.7
WP_010954905.1\|1986052_1987522_-	NADH-quinone oxidoreductase subunit NuoN	NA	NA	NA	NA
WP_010954904.1\|1987529_1989062_-	NADH-quinone oxidoreductase subunit M	NA	NA	NA	NA
WP_010954903.1\|1989102_1990956_-	NADH-quinone oxidoreductase subunit L	NA	NA	NA	NA
WP_003251446.1\|1990952_1991261_-	NADH-quinone oxidoreductase subunit NuoK	NA	NA	NA	NA
WP_003251444.1\|1991264_1991765_-	NADH-quinone oxidoreductase subunit J	NA	NA	NA	NA
WP_003251442.1\|1991775_1992324_-	NADH-quinone oxidoreductase subunit NuoI	NA	NA	NA	NA
WP_003251440.1\|1992335_1993343_-	NADH-quinone oxidoreductase subunit NuoH	NA	NA	NA	NA
WP_010954902.1\|1993339_1996054_-	NADH-quinone oxidoreductase subunit NuoG	NA	NA	NA	NA
WP_010954901.1\|1996186_1997548_-	NADH-quinone oxidoreductase subunit NuoF	NA	NA	NA	NA
WP_003251433.1\|1997544_1998042_-	NADH-quinone oxidoreductase subunit NuoE	NA	NA	NA	NA
WP_010954900.1\|1998044_1999826_-	NADH-quinone oxidoreductase subunit C/D	NA	NA	NA	NA
WP_003251429.1\|1999905_2000583_-	NADH-quinone oxidoreductase subunit B	NA	NA	NA	NA
WP_003251427.1\|2000592_2001006_-	NADH-quinone oxidoreductase subunit A	NA	NA	NA	NA
WP_010954899.1\|2001389_2002085_-	lysoplasmalogenase	NA	NA	NA	NA
WP_010954897.1\|2002342_2003668_-	isocitrate lyase	NA	NA	NA	NA
WP_049588276.1\|2004158_2004893_-	secretin	NA	NA	NA	NA
WP_010954895.1\|2005048_2006224_+	hypothetical protein	NA	NA	NA	NA
WP_010954894.1\|2006277_2007987_+	S8/S53 family peptidase	NA	NA	NA	NA
WP_049588236.1\|2008070_2009513_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.4e-85	41.1
WP_010954893.1\|2009643_2011755_-	elongation factor G	A0A2K9L6L3	Tupanvirus	7.3e-43	25.5
WP_049588238.1\|2011828_2012254_-	hypothetical protein	NA	NA	NA	NA
WP_010954891.1\|2012500_2012803_+	hypothetical protein	NA	NA	NA	NA
WP_010954890.1\|2012806_2014057_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_003251398.1\|2014236_2015133_-	transcriptional regulator GcvA	NA	NA	NA	NA
WP_010954889.1\|2015388_2016771_+	amino acid permease	NA	NA	NA	NA
WP_003251394.1\|2016828_2017326_+	PaaI family thioesterase	NA	NA	NA	NA
WP_010954888.1\|2017413_2018109_+	glutathione S-transferase	NA	NA	NA	NA
WP_010954887.1\|2018289_2019906_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_010954886.1\|2020034_2020421_+	DUF488 family protein	NA	NA	NA	NA
WP_010954885.1\|2020431_2020875_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010954884.1\|2020982_2021372_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003251380.1\|2021435_2022074_+	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_010954883.1\|2022080_2023904_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_010954882.1\|2023937_2024498_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_049588241.1\|2024795_2025473_-	DsbA family protein	NA	NA	NA	NA
WP_010954880.1\|2025833_2026109_-	hypothetical protein	NA	NA	NA	NA
WP_010954879.1\|2026964_2027450_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_061405686.1\|2027462_2027609_-	protein of unknown function	O64023	Bacillus_phage	4.0e-09	58.7
WP_079732591.1\|2027632_2027812_-	RHS repeat protein	NA	NA	NA	NA
WP_049588243.1\|2027953_2028520_-	hypothetical protein	NA	NA	NA	NA
WP_079732543.1\|2028510_2029233_-	RHS repeat-associated core domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	2.9e-23	51.5
WP_079732590.1\|2029312_2029669_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.6e-17	42.3
WP_010951895.1\|2029687_2031220_+\|transposase	IS66-like element ISPpu15 family transposase	S5VTD3	Leptospira_phage	7.6e-82	34.9
WP_126404339.1\|2032312_2032774_-	hypothetical protein	NA	NA	NA	NA
WP_061405685.1\|2035783_2036200_-	putative phosphotriesterase	NA	NA	NA	NA
WP_164721822.1\|2037580_2038012_-	hypothetical protein	NA	NA	NA	NA
WP_061405684.1\|2038459_2038945_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_010954874.1\|2038968_2043561_-	type IV secretion protein Rhs	O64023	Bacillus_phage	7.2e-35	49.0
WP_010954873.1\|2043614_2044046_-	DUF1795 domain-containing protein	NA	NA	NA	NA
WP_010954872.1\|2046152_2046668_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_051122586.1\|2046801_2047677_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_003251351.1\|2047678_2049016_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_010954870.1\|2049065_2049863_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_010954869.1\|2049859_2050876_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_010954868.1\|2050839_2052606_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_010954867.1\|2052609_2053020_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_5

2118995 : 2163815

uncultured_Caudovirales_phage(33.33%)

transposase,integrase,protease,tRNA

attL 2127342:2127357|attR 2162945:2162960

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010951895.1\|2118995_2120528_-\|transposase	IS66-like element ISPpu15 family transposase	S5VTD3	Leptospira_phage	7.6e-82	34.9
WP_010951896.1\|2120546_2120903_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	9.8e-17	41.2
WP_079732589.1\|2121720_2122452_-	RHS repeat-associated core domain-containing protein	NA	NA	NA	NA
WP_010954823.1\|2122631_2123462_-	alpha/beta hydrolase	A0A249XTE1	Mycobacterium_phage	3.4e-12	29.8
WP_010954822.1\|2123635_2124925_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010954821.1\|2125070_2127032_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.9e-29	30.3
WP_003251237.1\|2127199_2127628_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
2127342:2127357	attL	NA	NA	NA	NA
WP_014590368.1\|2127620_2128787_-	cupin domain-containing protein	NA	NA	NA	NA
WP_010954819.1\|2128868_2130239_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.0e-109	47.1
WP_010954818.1\|2130376_2131003_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_010954817.1\|2130999_2132124_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_010954816.1\|2132183_2132624_-	NUDIX hydrolase	NA	NA	NA	NA
WP_010954815.1\|2132816_2135042_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_010954814.1\|2135456_2136713_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	3.5e-16	79.6
WP_010954813.1\|2136784_2137051_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.7e-13	56.1
WP_003251220.1\|2137281_2137644_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	8.2e-11	43.2
WP_010954812.1\|2137674_2139945_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.7e-167	43.4
WP_002553999.1\|2140030_2140249_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_003251215.1\|2140350_2141058_-	arginyltransferase	NA	NA	NA	NA
WP_003251213.1\|2141114_2141795_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_010954811.1\|2142202_2144707_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	9.8e-87	50.6
WP_003251209.1\|2144769_2145393_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_010954809.1\|2145405_2146731_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	4.0e-79	39.8
WP_003251205.1\|2146727_2147102_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	7.1e-10	45.8
WP_010954808.1\|2147132_2148413_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-96	54.4
WP_010954807.1\|2148413_2149805_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_049587789.1\|2149911_2150871_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_010954805.1\|2150965_2151967_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.6e-157	80.8
WP_010954804.1\|2151963_2152299_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	7.5e-43	75.7
WP_003251193.1\|2152295_2152592_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.0e-23	58.6
WP_010954803.1\|2152591_2152951_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	8.6e-37	66.7
WP_003251188.1\|2152952_2153345_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.1e-53	79.8
WP_010954802.1\|2153442_2154822_-	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.6e-27	51.1
WP_003251184.1\|2154985_2155657_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	2.1e-105	91.0
WP_010954800.1\|2156132_2157179_+	DNA cytosine methyltransferase	Q83VT0	Escherichia_phage	5.1e-21	29.5
WP_010954799.1\|2157190_2159239_+	ATP-binding protein	NA	NA	NA	NA
WP_049587786.1\|2159235_2160492_+	hypothetical protein	NA	NA	NA	NA
WP_010954798.1\|2160543_2161503_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	2.5e-131	74.9
WP_010954797.1\|2161578_2161935_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.7e-16	37.3
WP_010954007.1\|2161953_2163486_+\|transposase	IS66-like element ISPpu13 family transposase	S5VTD3	Leptospira_phage	3.2e-88	37.1
2162945:2162960	attR	NA	NA	NA	NA
WP_010954796.1\|2163554_2163815_+\|transposase	IS66 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2228428 : 2274143

Pseudomonas_phage(53.33%)

holin,capsid,protease,plate,integrase,portal,terminase,tail,head

attL 2237958:2237975|attR 2278467:2278484

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010954747.1\|2228428_2229448_+\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	6.9e-23	26.0
WP_010954746.1\|2229777_2230827_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	1.1e-100	56.1
WP_010954745.1\|2230828_2231074_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_049587747.1\|2231113_2231431_-	hypothetical protein	NA	NA	NA	NA
WP_010954742.1\|2232713_2233106_-	DUF2591 domain-containing protein	A0A1B0VMD7	Pseudomonas_phage	3.2e-13	35.3
WP_010954741.1\|2233102_2233426_-	hypothetical protein	A0A2H4J0N7	uncultured_Caudovirales_phage	5.9e-53	91.6
WP_010954740.1\|2233697_2234081_-	hypothetical protein	Q8W6R0	Burkholderia_virus	3.1e-24	47.1
WP_049587754.1\|2234246_2234546_+	hypothetical protein	NA	NA	NA	NA
WP_049587756.1\|2234595_2235273_-	hypothetical protein	NA	NA	NA	NA
WP_010954738.1\|2235281_2236943_-	DNA cytosine methyltransferase	A0A2I7QRH3	Vibrio_phage	6.5e-103	44.9
WP_010954737.1\|2237010_2237394_-	hypothetical protein	A0A0U4JNY7	Pseudomonas_phage	2.3e-27	47.3
WP_049587760.1\|2237408_2237960_-	hypothetical protein	NA	NA	NA	NA
2237958:2237975	attL	NA	NA	NA	NA
WP_010954735.1\|2238066_2238345_+	hypothetical protein	NA	NA	NA	NA
WP_010954734.1\|2238358_2238709_-	hypothetical protein	NA	NA	NA	NA
WP_010954733.1\|2238790_2239249_-	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	9.0e-47	61.2
WP_010954732.1\|2239245_2239515_-	hypothetical protein	NA	NA	NA	NA
WP_049587761.1\|2239534_2239918_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	9.8e-23	60.0
WP_049587762.1\|2240554_2240764_-	hypothetical protein	A0A0H5ARH3	Pseudomonas_phage	5.4e-15	65.0
WP_010954727.1\|2241135_2241396_-	DUF1654 domain-containing protein	H2BD60	Pseudomonas_phage	1.9e-06	43.1
WP_010954726.1\|2241545_2241794_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_049587764.1\|2241793_2242135_+	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_049587766.1\|2242302_2242869_-	hypothetical protein	S5FXQ0	Shigella_phage	5.4e-17	36.4
WP_049587768.1\|2242871_2243864_-	hypothetical protein	NA	NA	NA	NA
WP_010954724.1\|2244030_2244267_-	hypothetical protein	NA	NA	NA	NA
WP_010954723.1\|2244310_2244724_-	hypothetical protein	A0A127KNU7	Pseudomonas_phage	5.5e-11	45.7
WP_010954722.1\|2244781_2245429_-	helix-turn-helix transcriptional regulator	A0A0H5BBV1	Pseudomonas_phage	2.1e-49	52.3
WP_010954721.1\|2245516_2245729_+	transcriptional regulator	A0A125RNS7	Pseudomonas_phage	1.5e-25	80.6
WP_010954720.1\|2246053_2246884_+	replication protein	W6MYB0	Pseudomonas_phage	1.5e-28	33.6
WP_010954719.1\|2246880_2248278_+	AAA family ATPase	A0A125RNK2	Pseudomonas_phage	2.5e-124	52.8
WP_010954718.1\|2248277_2248484_+	hypothetical protein	NA	NA	NA	NA
WP_010954717.1\|2248465_2248762_+	DUF1364 domain-containing protein	A5VW86	Enterobacteria_phage	9.9e-31	68.1
WP_154070660.1\|2248758_2248929_+	hypothetical protein	NA	NA	NA	NA
WP_049587773.1\|2248925_2249354_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	2.1e-50	76.5
WP_010954715.1\|2249350_2250649_+\|integrase	tyrosine-type recombinase/integrase	A0A2D1GND4	Pseudomonas_phage	9.2e-121	54.8
WP_010954714.1\|2250645_2250966_+	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	2.0e-21	45.6
WP_010954713.1\|2250978_2251650_+	hypothetical protein	J7HXH6	Pseudomonas_phage	4.4e-58	53.5
WP_010954712.1\|2251633_2251894_+	hypothetical protein	NA	NA	NA	NA
WP_061405680.1\|2252042_2252672_-	hypothetical protein	NA	NA	NA	NA
WP_010954710.1\|2252830_2253154_+\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	1.0e-28	64.2
WP_010954709.1\|2253157_2253478_+	HNH endonuclease	K7PM05	Enterobacterial_phage	7.4e-24	48.2
WP_010954708.1\|2253613_2254081_+\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	1.6e-43	59.7
WP_010954707.1\|2254040_2255849_+\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	5.5e-116	41.3
WP_010954706.1\|2255845_2256034_+	hypothetical protein	Q8W6U8	Burkholderia_virus	1.3e-07	63.5
WP_010954705.1\|2256036_2257308_+\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	2.9e-151	64.9
WP_010954704.1\|2257304_2258276_+	S49 family peptidase	A4JX00	Burkholderia_virus	1.8e-92	55.6
WP_049587776.1\|2258337_2259651_+\|capsid	phage major capsid protein	A4JX01	Burkholderia_virus	1.2e-147	61.2
WP_110771832.1\|2259703_2259952_+	hypothetical protein	NA	NA	NA	NA
WP_010954701.1\|2259954_2260506_+	hypothetical protein	A4JX03	Burkholderia_virus	1.7e-28	43.9
WP_010954700.1\|2260508_2260883_+\|head,tail	head-tail adaptor protein	U5P0R0	Shigella_phage	1.3e-16	35.7
WP_010954699.1\|2260875_2261391_+	hypothetical protein	NA	NA	NA	NA
WP_049587778.1\|2261420_2262014_+	hypothetical protein	B5TK65	Pseudomonas_phage	3.2e-52	51.5
WP_010954696.1\|2262019_2262223_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	3.3e-09	59.6
WP_010954695.1\|2262222_2263710_+\|tail	tail sheath protein	B5TK67	Pseudomonas_phage	5.9e-164	59.5
WP_049587292.1\|2264179_2265601_+	group II intron reverse transcriptase/maturase	H7BVN7	unidentified_phage	2.5e-18	28.0
WP_049587942.1\|2265683_2266031_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	3.6e-32	53.0
WP_049587943.1\|2266027_2266324_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	5.4e-29	72.0
WP_010954692.1\|2266453_2268409_+\|tail	phage tail tape measure protein	U5P420	Shigella_phage	3.0e-107	51.2
WP_010954691.1\|2268401_2269664_+	hypothetical protein	B5TK71	Pseudomonas_phage	4.6e-61	36.6
WP_010954690.1\|2269667_2270777_+	hypothetical protein	B5TK72	Pseudomonas_phage	3.6e-102	55.3
WP_010954689.1\|2270785_2271286_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	1.2e-52	64.8
WP_010954688.1\|2271282_2271669_+	hypothetical protein	B5TK74	Pseudomonas_phage	1.0e-27	52.5
WP_110771850.1\|2271670_2272702_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	4.9e-69	42.3
WP_010954686.1\|2272692_2273337_+	YmfQ family protein	NA	NA	NA	NA
WP_010954685.1\|2273339_2274143_+\|tail	tail protein	A0A2H4J9C3	uncultured_Caudovirales_phage	1.8e-21	52.5
2278467:2278484	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2278481 : 2282158

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010954681.1\|2278481_2279021_+	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	1.1e-43	58.4
WP_049587950.1\|2279017_2279548_+	DUF2514 domain-containing protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	2.2e-41	79.5
WP_061405677.1\|2279622_2281110_+	exo-alpha-sialidase	A0A2R3UAY9	Myoviridae_environmental_samples	8.0e-145	61.0
WP_049587957.1\|2281324_2281549_+	hypothetical protein	A0A2H4JG60	uncultured_Caudovirales_phage	1.5e-26	81.1
WP_049587959.1\|2281622_2281916_+	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	3.8e-35	71.1
WP_049587960.1\|2281912_2282158_+	hypothetical protein	A0A2H4J7A7	uncultured_Caudovirales_phage	3.7e-07	44.1

DBSCAN-SWA_8

2885923 : 2961155

uncultured_Caudovirales_phage(64.52%)

holin,capsid,protease,plate,portal,terminase,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010953932.1\|2885923_2886655_-	peptidase S24	A8CGC0	Salmonella_phage	6.5e-31	38.9
WP_010953933.1\|2886733_2886997_+	hypothetical protein	A0A2H4J0V8	uncultured_Caudovirales_phage	5.0e-10	47.1
WP_049586116.1\|2887594_2888113_+	hypothetical protein	NA	NA	NA	NA
WP_010953936.1\|2888105_2888324_+	conjugal transfer protein TraR	NA	NA	NA	NA
WP_010953937.1\|2888313_2890524_+	toprim domain-containing protein	A0A2D1GN57	Marinobacter_phage	1.4e-182	45.9
WP_010953938.1\|2890520_2890883_+	hypothetical protein	NA	NA	NA	NA
WP_010953939.1\|2891394_2891742_+\|holin	holin	B5TK61	Pseudomonas_phage	3.3e-41	71.3
WP_010953940.1\|2891906_2892518_+	hypothetical protein	A0A2H4JG15	uncultured_Caudovirales_phage	5.2e-42	50.5
WP_010953941.1\|2892522_2894559_+\|terminase	phage terminase large subunit family protein	A0A2H4J898	uncultured_Caudovirales_phage	2.1e-297	78.2
WP_010953942.1\|2894560_2894767_+	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	1.6e-19	70.6
WP_010953943.1\|2894763_2896257_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.8e-214	75.5
WP_010953944.1\|2896253_2897417_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	3.4e-135	69.1
WP_010953945.1\|2897419_2897767_+\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	1.7e-29	62.4
WP_010953946.1\|2897828_2898824_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.6e-133	70.3
WP_049586114.1\|2898826_2899141_+	hypothetical protein	A0A2H4J879	uncultured_Caudovirales_phage	2.9e-28	59.6
WP_010953948.1\|2899137_2899800_+	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	2.3e-72	63.0
WP_010953949.1\|2899792_2900323_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	1.9e-32	48.7
WP_010953950.1\|2900319_2900922_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	3.5e-51	66.4
WP_010953951.1\|2900964_2901234_+	hypothetical protein	NA	NA	NA	NA
WP_010953952.1\|2901236_2901563_+	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	8.1e-34	65.7
WP_010953953.1\|2901559_2902540_+\|tail	tail fiber protein	Q37840	Escherichia_phage	2.4e-49	38.9
WP_010953954.1\|2902536_2903349_+\|tail	phage tail protein I	V5YTN0	Pseudomonas_phage	5.3e-18	37.3
WP_010953955.1\|2903345_2904224_+\|tail	tail fiber protein	A2I2X8	Vibrio_virus	6.8e-19	37.6
WP_010953956.1\|2904230_2904971_+	hypothetical protein	NA	NA	NA	NA
WP_010953957.1\|2904993_2905455_+	hypothetical protein	A0A077K9S5	Ralstonia_phage	2.6e-17	47.4
WP_010953958.1\|2905549_2906716_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	2.5e-186	84.2
WP_010953959.1\|2906728_2907238_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	3.4e-63	68.5
WP_010953960.1\|2907283_2907580_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_010953961.1\|2907712_2910982_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.3e-70	34.5
WP_010953962.1\|2910991_2911837_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.9e-79	55.4
WP_010953963.1\|2911811_2912018_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.5e-17	62.7
WP_010953964.1\|2912077_2913121_+	phage late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.1e-144	72.0
WP_010953965.1\|2913157_2913709_+	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	7.4e-64	68.1
WP_049586107.1\|2913705_2914266_+	lysozyme	A0A2H4JBH9	uncultured_Caudovirales_phage	4.2e-30	50.6
WP_049586105.1\|2914345_2915002_-	hypothetical protein	NA	NA	NA	NA
WP_049586103.1\|2915345_2916551_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_049586307.1\|2916691_2916991_-	hypothetical protein	NA	NA	NA	NA
WP_010953968.1\|2917439_2919917_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_010953969.1\|2920029_2920305_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_010953970.1\|2920408_2922361_-	acetoacetate--CoA ligase	NA	NA	NA	NA
WP_010953971.1\|2922453_2922933_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_010953972.1\|2922988_2923759_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_010953973.1\|2923769_2925161_-	GntP family permease	NA	NA	NA	NA
WP_049586101.1\|2925386_2926769_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_010953975.1\|2926828_2927845_-	ABC transporter permease	NA	NA	NA	NA
WP_010953976.1\|2927844_2928903_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_049586302.1\|2928899_2930699_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003248318.1\|2930841_2931123_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_010953978.1\|2931203_2932265_-	3-deoxy-7-phosphoheptulonate synthase	A0A0B6VT43	Edwardsiella_phage	1.5e-84	49.5
WP_049586097.1\|2932819_2933371_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_019438461.1\|2933419_2933728_-	hypothetical protein	NA	NA	NA	NA
WP_020190937.1\|2933809_2935108_-	MFS transporter	NA	NA	NA	NA
WP_010953981.1\|2935534_2936410_+	AEC family transporter	NA	NA	NA	NA
WP_049586093.1\|2936542_2938960_-	TonB-dependent receptor	NA	NA	NA	NA
WP_049586091.1\|2939109_2940072_-	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_010953984.1\|2940071_2940578_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_010953985.1\|2940666_2943183_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-160	35.2
WP_010953986.1\|2943350_2944436_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_049586088.1\|2944531_2945050_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_010953988.1\|2945193_2947689_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_049586086.1\|2947685_2948594_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_010953989.1\|2948590_2952394_-	hypothetical protein	NA	NA	NA	NA
WP_010953990.1\|2952424_2953141_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_010953991.1\|2953137_2954481_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004576638.1\|2954477_2955200_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_049586082.1\|2955224_2957822_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	3.2e-88	30.2
WP_003248350.1\|2957818_2958889_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_010953993.1\|2958852_2960673_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003248355.1\|2960672_2961155_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_9

3564619 : 3571986

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010953639.1\|3564619_3565477_+	glucose 1-dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.7e-70	50.5
WP_010953638.1\|3565645_3566110_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_049586247.1\|3566184_3566520_+	hypothetical protein	NA	NA	NA	NA
WP_154070658.1\|3566697_3566871_-	hypothetical protein	NA	NA	NA	NA
WP_010953634.1\|3567083_3567431_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	8.6e-34	61.1
WP_010953633.1\|3567452_3568736_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	4.9e-175	75.1
WP_010953632.1\|3568764_3569235_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.7e-57	69.2
WP_010953631.1\|3569248_3569950_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.1e-104	79.4
WP_010953630.1\|3569962_3571327_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_010953629.1\|3571323_3571986_-	response regulator	W8CYM9	Bacillus_phage	4.2e-29	37.1

DBSCAN-SWA_10

3977744 : 4014475

Feldmannia_irregularis_virus(33.33%)

coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010953322.1\|3977744_3978716_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_049587582.1\|3978712_3981010_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_049587580.1\|3981118_3981895_-	molecular chaperone	NA	NA	NA	NA
WP_010953319.1\|3981935_3982439_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_010953318.1\|3982442_3982976_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_010953317.1\|3982994_3983531_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_049587577.1\|3983561_3984089_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_049587576.1\|3984357_3986604_+	GAF domain-containing protein	Q6XLU9	Feldmannia_irregularis_virus	1.6e-16	25.1
WP_003250360.1\|3986619_3987081_+	response regulator	NA	NA	NA	NA
WP_010953314.1\|3987094_3989482_+	hybrid sensor histidine kinase/response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	4.9e-11	26.5
WP_020193386.1\|3989933_3990176_+	hypothetical protein	NA	NA	NA	NA
WP_049587571.1\|3990308_3991379_+	cell division protein ZapE	NA	NA	NA	NA
WP_010953311.1\|3991491_3993381_-	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	9.7e-55	29.7
WP_010953310.1\|3993561_3994428_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010953309.1\|3994401_3995556_-	HPP family protein	NA	NA	NA	NA
WP_010953308.1\|3995836_3997156_-	sensor histidine kinase	NA	NA	NA	NA
WP_010953307.1\|3997152_3997821_-	response regulator transcription factor	NA	NA	NA	NA
WP_003250344.1\|3997821_3998136_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_010953306.1\|3998135_3998444_-	peptidase	NA	NA	NA	NA
WP_004573881.1\|3998681_3999761_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_010953305.1\|4000066_4000798_-	AAA family ATPase	NA	NA	NA	NA
WP_003250327.1\|4001243_4001600_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_162490568.1\|4001610_4002093_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_010953302.1\|4002498_4005108_+	bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase	NA	NA	NA	NA
WP_010953301.1\|4005182_4006667_-	2-methylcitrate dehydratase	NA	NA	NA	NA
WP_010953300.1\|4006833_4008024_-	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_010953299.1\|4008089_4010678_-	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_003250313.1\|4010840_4011968_-	2-methylcitrate synthase	NA	NA	NA	NA
WP_010953298.1\|4012028_4012919_-	methylisocitrate lyase	NA	NA	NA	NA
WP_003250308.1\|4012915_4013632_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010953297.1\|4013938_4014475_+\|protease	ATP-dependent zinc protease	NA	NA	NA	NA

DBSCAN-SWA_11

4044443 : 4090176

Ralstonia_phage(64.29%)

capsid,protease,integrase,terminase,tail,head

attL 4048615:4048674|attR 4088855:4088942

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003250242.1\|4044443_4045727_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.7e-138	58.3
WP_003259400.1\|4045835_4046477_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.4e-59	60.6
WP_014753846.1\|4046568_4047882_-	trigger factor	NA	NA	NA	NA
WP_020190960.1\|4048130_4048430_-	hypothetical protein	NA	NA	NA	NA
4048615:4048674	attL	NA	NA	NA	NA
WP_049587561.1\|4048993_4050076_-\|integrase	site-specific integrase	A0A2D2W4Z2	Ralstonia_phage	3.9e-93	51.4
WP_010953267.1\|4050050_4050407_-	hypothetical protein	NA	NA	NA	NA
WP_010953266.1\|4050821_4051406_-	antirestriction protein ArdA	A0A222YZE5	Mycobacterium_phage	5.9e-11	30.1
WP_049587658.1\|4051651_4051960_-	hypothetical protein	NA	NA	NA	NA
WP_126404369.1\|4052004_4052202_-	hypothetical protein	NA	NA	NA	NA
WP_049587560.1\|4052606_4052849_-	hypothetical protein	NA	NA	NA	NA
WP_010953265.1\|4053189_4053630_-	hypothetical protein	NA	NA	NA	NA
WP_010953264.1\|4053666_4055355_-\|terminase	phage terminase large subunit	A0A2D2W5F3	Ralstonia_phage	1.3e-252	74.4
WP_126404371.1\|4055518_4056274_+	hypothetical protein	NA	NA	NA	NA
WP_010953262.1\|4056281_4056569_-	hypothetical protein	A0A2R2ZGB7	Ralstonia_phage	1.1e-29	68.9
WP_009682604.1\|4056555_4056792_-	hypothetical protein	NA	NA	NA	NA
WP_010953261.1\|4056838_4057342_-	hypothetical protein	A0A219YB15	Aeromonas_phage	1.7e-06	49.2
WP_010953260.1\|4057341_4058982_-\|tail	tail protein	L7TLW7	Rhizobium_phage	4.2e-22	37.7
WP_010953259.1\|4059044_4063754_-	transglycosylase SLT domain-containing protein	A0A2R2ZGA5	Ralstonia_phage	0.0e+00	60.8
WP_010953258.1\|4063766_4065956_-	hypothetical protein	A0A2D2W5A9	Ralstonia_phage	4.6e-181	50.7
WP_010953257.1\|4065965_4066526_-	hypothetical protein	NA	NA	NA	NA
WP_049587557.1\|4066510_4066924_-	hypothetical protein	NA	NA	NA	NA
WP_010953256.1\|4066979_4069325_-\|tail	tail protein	A0A2D2W513	Ralstonia_phage	6.3e-245	54.7
WP_010953255.1\|4069328_4069916_-\|tail	tail protein	A0A2R2ZGD2	Ralstonia_phage	4.7e-48	50.8
WP_010953254.1\|4069977_4070946_-\|capsid	phage capsid protein	L7TJ83	Rhizobium_phage	1.1e-91	57.0
WP_049587555.1\|4071107_4071317_-	hypothetical protein	NA	NA	NA	NA
WP_049587553.1\|4071331_4071772_-	DUF1353 domain-containing protein	A0A2K9VHJ4	Pseudomonas_phage	2.4e-25	50.8
WP_010953253.1\|4071799_4072579_-\|capsid	phage capsid assembly protein	A0A2D2W594	Ralstonia_phage	4.7e-48	44.5
WP_010953251.1\|4072717_4074292_-\|head,tail	head-tail joining protein	A0A2R2ZGG8	Ralstonia_phage	9.6e-165	60.3
WP_010953250.1\|4074519_4074714_-	hypothetical protein	NA	NA	NA	NA
WP_010953249.1\|4074768_4076154_-	hypothetical protein	NA	NA	NA	NA
WP_079732513.1\|4076164_4076419_-	DUF3310 domain-containing protein	Q774Z7	Bordetella_phage	4.8e-10	55.2
WP_010953248.1\|4076437_4077037_-	exonuclease	A0A2R2ZGE9	Ralstonia_phage	3.1e-71	62.6
WP_010953247.1\|4077138_4077348_-	hypothetical protein	NA	NA	NA	NA
WP_009682626.1\|4077382_4077598_-	hypothetical protein	A0A2R2ZGG1	Ralstonia_phage	1.6e-17	67.2
WP_049587549.1\|4077611_4079663_-	DNA polymerase	A0A2R2ZGG6	Ralstonia_phage	1.0e-219	58.9
WP_049587548.1\|4079674_4079869_-	hypothetical protein	NA	NA	NA	NA
WP_110771736.1\|4079858_4080461_-	hypothetical protein	A0A2D2W501	Ralstonia_phage	1.1e-44	55.6
WP_154070657.1\|4080479_4080647_-	hypothetical protein	NA	NA	NA	NA
WP_061405616.1\|4080704_4080899_-	hypothetical protein	NA	NA	NA	NA
WP_049587546.1\|4080902_4081313_-	hypothetical protein	NA	NA	NA	NA
WP_028692660.1\|4081316_4081544_-	hypothetical protein	NA	NA	NA	NA
WP_049587543.1\|4081558_4083163_-	toprim domain-containing protein	L7TLT7	Rhizobium_phage	4.5e-178	62.7
WP_010953242.1\|4083281_4083731_-	N-acetylmuramoyl-L-alanine amidase	A0A2R2ZGC0	Ralstonia_phage	6.7e-63	73.6
WP_010953241.1\|4083733_4084159_-	endodeoxyribonuclease	A0A2D2W4Y6	Ralstonia_phage	5.6e-51	71.7
WP_049587541.1\|4084181_4084895_-	single-stranded DNA-binding protein	A0A2R2ZGF7	Ralstonia_phage	3.5e-66	62.7
WP_154070656.1\|4084922_4085099_-	hypothetical protein	A0A2D2W4Y9	Ralstonia_phage	1.8e-08	58.3
WP_110771734.1\|4085621_4088168_-	DNA-dependent RNA polymerase	A0A2R2ZGE5	Ralstonia_phage	0.0e+00	65.0
WP_003250234.1\|4089321_4090176_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.4e-29	34.6
4088855:4088942	attR	NA	NA	NA	NA

DBSCAN-SWA_12

4497911 : 4502972

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049586833.1\|4497911_4498268_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.6e-38	64.9
WP_010952950.1\|4498297_4499581_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.1e-198	85.0
WP_049586835.1\|4499595_4500066_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.0e-66	81.4
WP_049586838.1\|4500089_4500803_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.0e-118	89.9
WP_010952947.1\|4500807_4501311_+	phosphatase	NA	NA	NA	NA
WP_010952946.1\|4501336_4502419_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	1.1e-103	64.7
WP_010952945.1\|4502411_4502972_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.5e-56	68.4

DBSCAN-SWA_13

4849587 : 4940852

105

Pseudomonas_phage(33.9%)

holin,capsid,protease,tRNA,integrase,portal,terminase,tail,head

attL 4894703:4894731|attR 4943645:4943673

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010952693.1\|4849587_4852161_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	9.9e-26	23.3
WP_003252355.1\|4852301_4852625_+	ferredoxin family protein	NA	NA	NA	NA
WP_138868007.1\|4853181_4854603_-	group II intron reverse transcriptase/maturase	H7BVN7	unidentified_phage	2.5e-18	28.0
WP_003252351.1\|4855077_4856085_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
WP_049588177.1\|4856193_4857051_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	1.9e-13	36.2
WP_003252348.1\|4857288_4857927_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.7e-40	51.2
WP_010952690.1\|4857962_4858712_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	7.5e-67	52.6
WP_010952689.1\|4858699_4859758_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_003252342.1\|4859754_4860228_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_003252340.1\|4860340_4861195_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_014592131.1\|4861203_4862316_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.0e-33	28.5
WP_010952687.1\|4862423_4863320_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010952686.1\|4863447_4864155_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_004576849.1\|4864151_4864433_-	cell division protein FtsB	NA	NA	NA	NA
WP_003252333.1\|4864601_4865891_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.9e-139	59.6
WP_010952685.1\|4866045_4866891_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.1e-50	42.0
WP_003252329.1\|4866894_4868523_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.0e-158	53.3
WP_010952684.1\|4868790_4870074_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_003252323.1\|4870245_4871193_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_010952683.1\|4871299_4874824_-	DNA polymerase III subunit alpha	A0A1C9LWZ5	Streptomyces_phage	3.8e-193	35.8
WP_003252319.1\|4875010_4875634_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	8.0e-22	41.5
WP_010952682.1\|4875635_4876763_-	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_010952681.1\|4876764_4877541_-	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_003252314.1\|4877537_4877978_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_003252312.1\|4878092_4879148_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003252311.1\|4879149_4879653_-	OmpH family outer membrane protein	NA	NA	NA	NA
WP_010952679.1\|4879697_4882058_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_049587451.1\|4882131_4883484_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_049587431.1\|4883555_4884746_-	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_010952676.1\|4884742_4885558_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_010952675.1\|4885557_4886313_-	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	3.4e-19	38.8
WP_003252296.1\|4886328_4886886_-	ribosome recycling factor	NA	NA	NA	NA
WP_003252294.1\|4886882_4887626_-	UMP kinase	NA	NA	NA	NA
WP_010952674.1\|4887807_4888671_-	elongation factor Ts	NA	NA	NA	NA
WP_003252287.1\|4888856_4889594_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003252286.1\|4889940_4890723_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_010952673.1\|4890764_4893467_+	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_010952672.1\|4893497_4894694_+	succinyldiaminopimelate transaminase	NA	NA	NA	NA
4894703:4894731	attL	NA	NA	NA	NA
WP_049587427.1\|4894799_4896446_-	Na+/H+ antiporter	NA	NA	NA	NA
WP_010952670.1\|4896696_4896975_+	Killer protein	A0A222YWE2	Escherichia_phage	7.7e-09	49.2
WP_010952669.1\|4896983_4897283_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_049587425.1\|4897574_4897877_-	hypothetical protein	A0A2H4JGS3	uncultured_Caudovirales_phage	6.8e-11	47.9
WP_010952668.1\|4897942_4898443_-	DUF2514 domain-containing protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	2.2e-30	57.3
WP_049587424.1\|4898439_4898883_-	structural protein P5	A0A2R3UAM8	Myoviridae_environmental_samples	6.4e-34	52.4
WP_010952666.1\|4898943_4900020_-	hypothetical protein	NA	NA	NA	NA
WP_010952665.1\|4900031_4902023_-	exo-alpha-sialidase	A0A2R3UAY9	Myoviridae_environmental_samples	3.8e-166	52.0
WP_010952664.1\|4902123_4902579_-	hypothetical protein	B5WZT5	Pseudomonas_phage	4.4e-46	59.1
WP_010952663.1\|4902588_4905588_-	hypothetical protein	A0A286S259	Klebsiella_phage	4.7e-221	41.8
WP_049587423.1\|4905584_4905965_-	hypothetical protein	A0A286S2A6	Klebsiella_phage	6.1e-25	45.6
WP_010952662.1\|4905961_4906441_-	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	4.4e-44	54.7
WP_010952661.1\|4906437_4908879_-\|tail	tail tape measure protein	D4FUM0	Pseudomonas_phage	9.4e-135	42.7
WP_010952660.1\|4908925_4909249_-	superinfection immunity protein	A0A067Y187	Escherichia_phage	3.2e-06	42.0
WP_162490562.1\|4909310_4909466_-	hypothetical protein	NA	NA	NA	NA
WP_010952658.1\|4909534_4910005_-\|tail	phage tail assembly protein	K7PJU9	Enterobacteria_phage	7.6e-33	61.4
WP_010952657.1\|4910013_4910748_-\|tail	tail protein	Q9MCA5	Pseudomonas_phage	1.5e-51	50.2
WP_010952656.1\|4910813_4911182_-	DUF3168 domain-containing protein	Q9MCA6	Pseudomonas_phage	1.8e-37	61.5
WP_010952655.1\|4911178_4911664_-	HK97 gp10 family phage protein	Q9MCA7	Pseudomonas_phage	3.3e-55	76.2
WP_010952654.1\|4911656_4911998_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	4.5e-19	49.1
WP_010952653.1\|4911997_4912474_-\|head,tail	phage gp6-like head-tail connector protein	G3ENA1	Psychrobacter_phage	2.9e-16	35.7
WP_010952652.1\|4912477_4912702_-	hypothetical protein	NA	NA	NA	NA
WP_049587422.1\|4912743_4914000_-\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	3.9e-92	48.8
WP_010952650.1\|4914009_4914711_-\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	3.2e-72	62.4
WP_049587446.1\|4914707_4916006_-\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	5.2e-132	56.1
WP_010952648.1\|4916034_4916199_-	hypothetical protein	NA	NA	NA	NA
WP_079732495.1\|4916210_4917920_-\|terminase	terminase large subunit	A0A0R6PKH7	Moraxella_phage	5.2e-233	68.2
WP_010952646.1\|4917919_4918303_-\|terminase	phage terminase small subunit	Q9XJT7	Pseudomonas_phage	3.9e-19	44.2
WP_010952645.1\|4918430_4918799_-	HNH endonuclease	H2BDK0	Pseudomonas_virus	4.9e-19	59.8
WP_010952644.1\|4918789_4918972_-	hypothetical protein	NA	NA	NA	NA
WP_010952643.1\|4919032_4919356_-\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	7.7e-29	63.2
WP_010952642.1\|4919555_4919897_-	antitermination protein Q	A0A2D1GNB4	Pseudomonas_phage	1.0e-47	80.7
WP_049587420.1\|4919907_4920225_-	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	2.4e-30	61.0
WP_010952640.1\|4920221_4920542_-	hypothetical protein	NA	NA	NA	NA
WP_049587419.1\|4920538_4921828_-\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	6.1e-117	53.4
WP_010952638.1\|4921824_4922247_-	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	2.9e-44	67.9
WP_010952637.1\|4922243_4922540_-	DUF1364 domain-containing protein	A0A220NQY2	Salmonella_phage	2.9e-30	69.7
WP_049587416.1\|4922542_4923355_-	ATP-binding protein	A0A2H4J3E5	uncultured_Caudovirales_phage	2.3e-98	67.9
WP_010952635.1\|4923344_4924199_-	replication protein	W6MYB0	Pseudomonas_phage	5.4e-37	34.1
WP_010952634.1\|4924340_4924517_-	Cro/Cl family transcriptional regulator	A0A0S2SYB8	Pseudomonas_phage	3.2e-13	62.7
WP_010952633.1\|4924605_4925457_+	Cro/Cl family transcriptional regulator	A0A0S2SYF7	Pseudomonas_phage	1.0e-75	52.1
WP_049587412.1\|4925521_4925815_-	DUF1654 domain-containing protein	A0A0S2SYC9	Pseudomonas_phage	8.9e-16	48.5
WP_010952632.1\|4926173_4926611_+	tellurite resistance protein	A0A2H4P7E3	Pseudomonas_phage	2.2e-34	56.9
WP_049587410.1\|4926607_4926802_+	hypothetical protein	NA	NA	NA	NA
WP_049587408.1\|4927167_4927551_+	helix-turn-helix transcriptional regulator	A0A1W6JTA9	Pseudomonas_phage	2.8e-17	50.9
WP_010952630.1\|4927569_4927839_+	hypothetical protein	NA	NA	NA	NA
WP_010952629.1\|4927835_4928294_+	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	5.8e-46	60.5
WP_010952628.1\|4928375_4928762_+	hypothetical protein	NA	NA	NA	NA
WP_126404382.1\|4928721_4928955_-	hypothetical protein	NA	NA	NA	NA
WP_010952627.1\|4929080_4929626_+	hypothetical protein	J9Q748	Salmonella_phage	1.3e-20	36.2
WP_028697923.1\|4929649_4929871_-	hypothetical protein	NA	NA	NA	NA
WP_079732494.1\|4929978_4930563_+	hypothetical protein	NA	NA	NA	NA
WP_010952625.1\|4930629_4931550_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	8.2e-108	59.7
WP_051122524.1\|4931978_4932845_+	hypothetical protein	NA	NA	NA	NA
WP_010952622.1\|4932928_4933681_+	hypothetical protein	W6MWX6	Pseudomonas_phage	2.6e-67	55.5
WP_049587405.1\|4933677_4933935_+	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	1.1e-20	66.3
WP_010952621.1\|4933931_4934159_+	hypothetical protein	NA	NA	NA	NA
WP_010952620.1\|4934155_4934539_+	DUF2591 family protein	A0A125RNP6	Pseudomonas_phage	1.2e-12	37.8
WP_049587403.1\|4934535_4935018_+	class I SAM-dependent methyltransferase	A0A0N7IRF6	Acinetobacter_phage	4.5e-57	63.4
WP_010952618.1\|4935074_4935392_+	hypothetical protein	NA	NA	NA	NA
WP_010952617.1\|4935425_4935668_+	excisionase	NA	NA	NA	NA
WP_010952616.1\|4935648_4936755_+\|integrase	site-specific integrase	A0A0U4JIT5	Pseudomonas_phage	2.1e-142	70.1
WP_003252272.1\|4936822_4937170_+	ArsC family reductase	NA	NA	NA	NA
WP_004574732.1\|4937201_4938236_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_010952615.1\|4938317_4939523_+	cysteine desulfurase	Q2XUY6	environmental_halophage	2.9e-68	36.8
WP_003252266.1\|4939519_4939930_+	SufE family protein	NA	NA	NA	NA
WP_162490563.1\|4940042_4940852_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	A0A291ATS8	Pandoravirus	2.9e-16	33.6
4943645:4943673	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP042181

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3596 : 14337

Morganella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_090315698.1\|3596_4883_-	Y-family DNA polymerase	A0A1W6JNT0	Morganella_phage	9.1e-97	45.8
WP_011005854.1\|4872_5304_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	5.3e-17	40.5
WP_011005855.1\|5441_6392_+	ligase	A0A068CDF3	Rhizobium_phage	7.3e-51	37.7
WP_011005856.1\|6422_6698_+	hypothetical protein	A0A2H4J6R2	uncultured_Caudovirales_phage	7.3e-12	40.5
WP_011005860.1\|8066_8291_-	hypothetical protein	NA	NA	NA	NA
WP_011005861.1\|8331_8634_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	8.0e-12	46.4
WP_011005862.1\|8630_8933_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.2e-20	51.6
WP_011005863.1\|9134_9914_+	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_011005864.1\|10067_10436_+	hypothetical protein	NA	NA	NA	NA
WP_062378618.1\|10468_10786_+	hypothetical protein	I3UM57	Rhodobacter_phage	6.5e-12	39.6
WP_011005866.1\|10841_11060_+	hypothetical protein	A0A2I6PI24	Pseudomonas_phage	6.2e-06	51.0
WP_062378625.1\|11198_12218_+	hypothetical protein	G9BWC3	Planktothrix_phage	7.9e-19	30.0
WP_011005868.1\|12360_12603_+	hypothetical protein	NA	NA	NA	NA
WP_011005869.1\|12654_14337_+	hypothetical protein	Q9ZXI4	Pseudomonas_virus	1.5e-192	69.8

DBSCAN-SWA_2

28912 : 75238

Micromonas_sp._RCC1109_virus(25.0%)

transposase,integrase

attL 24437:24451|attR 33563:33577

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
24437:24451	attL	NA	NA	NA	NA
WP_010953881.1\|28912_29884_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_010953879.1\|30330_30759_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_088171445.1\|31274_32488_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.1e-99	67.0
WP_010953874.1\|32967_34620_-	alkaline phosphatase family protein	NA	NA	NA	NA
33563:33577	attR	NA	NA	NA	NA
WP_031297681.1\|34654_35041_-	diacylglycerol kinase	NA	NA	NA	NA
WP_023082810.1\|35181_36219_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_134637449.1\|37710_38860_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.3e-97	64.1
WP_011005898.1\|39098_39491_+	hypothetical protein	NA	NA	NA	NA
WP_095159416.1\|39708_41409_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011005901.1\|41855_42821_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011005902.1\|43007_43199_-	4-oxalocrotonate tautomerase family protein	NA	NA	NA	NA
WP_095159415.1\|43247_44042_-	2-oxo-3-hexenedioate decarboxylase	NA	NA	NA	NA
WP_011005904.1\|44038_45076_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	8.0e-43	31.1
WP_095159414.1\|45086_46025_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	1.5e-35	36.0
WP_045633702.1\|46039_46825_-	2-oxopent-4-enoate hydratase	NA	NA	NA	NA
WP_045633701.1\|46836_47685_-	alpha/beta fold hydrolase	A0A023W6C9	Mycobacterium_phage	5.0e-11	38.8
WP_064481766.1\|47695_49156_-	2-hydroxymuconic semialdehyde dehydrogenase	NA	NA	NA	NA
WP_011005909.1\|49190_50114_-	catechol 2,3-dioxygenase	NA	NA	NA	NA
WP_052258346.1\|50110_50449_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_045633697.1\|50593_51370_-	1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.3e-09	25.8
WP_138868024.1\|51484_52495_-	ring-hydroxylating dioxygenase ferredoxin reductase family protein	NA	NA	NA	NA
WP_011005913.1\|52504_52993_-	benzoate 1,2-dioxygenase small subunit	NA	NA	NA	NA
WP_138868026.1\|52993_54349_-	benzoate 1,2-dioxygenase large subunit	NA	NA	NA	NA
WP_134637673.1\|54529_55279_-	TIGR03747 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_011005916.1\|55275_57432_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_011005917.1\|57974_59423_-	TIGR03752 family integrating conjugative element protein	NA	NA	NA	NA
WP_011005918.1\|59419_60328_-	TIGR03749 family integrating conjugative element protein	NA	NA	NA	NA
WP_095159412.1\|60324_61017_-	TIGR03746 family integrating conjugative element protein	NA	NA	NA	NA
WP_045633950.1\|61013_61424_-	TIGR03750 family conjugal transfer protein	NA	NA	NA	NA
WP_011005920.1\|61436_61805_-	TIGR03745 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_011005921.1\|61827_62067_-	TIGR03758 family integrating conjugative element protein	NA	NA	NA	NA
WP_011005922.1\|62063_62435_-	hypothetical protein	NA	NA	NA	NA
WP_168209877.1\|62758_63022_+\|transposase	transposase	NA	NA	NA	NA
WP_011005926.1\|64663_65017_-	hypothetical protein	NA	NA	NA	NA
WP_095159411.1\|65421_66819_-	aromatic hydrocarbon degradation protein	NA	NA	NA	NA
WP_011005928.1\|66931_68032_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_138868027.1\|68227_69052_-	ferredoxin--NAD(+) reductase	NA	NA	NA	NA
WP_011005930.1\|69429_70539_-	alkane 1-monooxygenase	A0A1V0SBK9	Catovirus	9.5e-18	25.5
WP_011005931.1\|70566_72030_-	benzaldehyde dehydrogenase	NA	NA	NA	NA
WP_159985337.1\|72061_73015_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L7I1	Tupanvirus	1.1e-09	27.4
WP_023082810.1\|74200_75238_+\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042180

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP042181

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection