CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP040706	Enterococcus faecium strain HOU503 chromosome, complete genome	2 crisprs	RT,DinG,cas3,DEDDh,csa3,cas14j	3	3	15
NZ_CP040708	Enterococcus faecium strain HOU503 plasmid p2	0 crisprs	csa3,RT	0	0	1
NZ_CP040707	Enterococcus faecium strain HOU503 plasmid unnamed1	0 crisprs	NA	0	0	0
NZ_CP040703	Enterococcus faecium strain HOU503 plasmid p3, complete sequence	0 crisprs	NA	0	0	0
NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	1 crisprs	csa3,cas14j	0	2	3
NZ_CP040705	Enterococcus faecium strain HOU503 plasmid p4, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040706_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040706_1

1225801-1225910

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040706_1

>merge|NZ_CP040706|1|1225801-1225910|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP040706|1|1|1225801-1225910|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040706.1\|WP_002294584.1\|1228376_1229249_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP040706.1\|WP_002294577.1\|1232649_1233294_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP040706.1\|WP_002294588.1\|1224803_1225172_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP040706.1\|WP_002294585.1\|1227695_1228364_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP040706.1\|WP_002294587.1\|1226137_1226827_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP040706.1\|WP_002296327.1\|1224008_1224698_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP040706.1\|WP_002287792.1\|1215549_1216515_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP040706.1\|WP_002287788.1\|1218051_1218765_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP040706.1\|WP_002287793.1\|1213340_1215500_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP040706.1\|WP_002290558.1\|1219953_1221486_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP040706.1\|WP_002295743.1\|1221875_1222784_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP040706.1\|WP_002287787.1\|1219018_1219720_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP040706.1\|WP_002291634.1\|1225224_1225728_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP040706.1\|WP_002287791.1\|1216603_1217743_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP040706.1\|WP_002294579.1\|1232141_1232312_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP040706.1\|WP_002291638.1\|1226930_1227353_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP040706.1\|WP_002294578.1\|1232335_1232488_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP040706.1\|WP_002294580.1\|1231495_1232041_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP040706.1\|WP_002294581.1\|1230531_1231419_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP040706.1\|WP_002294583.1\|1229339_1230359_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088

Protein	Function_ID	Function_description	E-value
NZ_CP040706.1\|WP_002294584.1\|1228376_1229249_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP040706.1\|WP_002294577.1\|1232649_1233294_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP040706.1\|WP_002294588.1\|1224803_1225172_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP040706.1\|WP_002294585.1\|1227695_1228364_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP040706.1\|WP_002294587.1\|1226137_1226827_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP040706.1\|WP_002296327.1\|1224008_1224698_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP040706.1\|WP_002287792.1\|1215549_1216515_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP040706.1\|WP_002287788.1\|1218051_1218765_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP040706.1\|WP_002287793.1\|1213340_1215500_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP040706.1\|WP_002290558.1\|1219953_1221486_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP040706.1\|WP_002295743.1\|1221875_1222784_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP040706.1\|WP_002287787.1\|1219018_1219720_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP040706.1\|WP_002291634.1\|1225224_1225728_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP040706.1\|WP_002287791.1\|1216603_1217743_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP040706.1\|WP_002294579.1\|1232141_1232312_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP040706.1\|WP_002291638.1\|1226930_1227353_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP040706.1\|WP_002294578.1\|1232335_1232488_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP040706.1\|WP_002294580.1\|1231495_1232041_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP040706.1\|WP_002294581.1\|1230531_1231419_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP040706.1\|WP_002294583.1\|1229339_1230359_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0

>NZ_CP040706.1|WP_002291634.1|1225224_1225728_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP040706.1|WP_002294588.1|1224803_1225172_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP040706.1|WP_002296327.1|1224008_1224698_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP040706.1|WP_002295743.1|1221875_1222784_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP040706.1|WP_002290558.1|1219953_1221486_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP040706.1|WP_002287787.1|1219018_1219720_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP040706.1|WP_002287788.1|1218051_1218765_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP040706.1|WP_002287791.1|1216603_1217743_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP040706.1|WP_002287792.1|1215549_1216515_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP040706.1|WP_002287793.1|1213340_1215500_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>NZ_CP040706.1|WP_002294587.1|1226137_1226827_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP040706.1|WP_002291638.1|1226930_1227353_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP040706.1|WP_002294585.1|1227695_1228364_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP040706.1|WP_002294584.1|1228376_1229249_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP040706.1|WP_002294583.1|1229339_1230359_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP040706.1|WP_002294581.1|1230531_1231419_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP040706.1|WP_002294580.1|1231495_1232041_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP040706.1|WP_002294579.1|1232141_1232312_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP040706.1|WP_002294578.1|1232335_1232488_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP040706.1|WP_002294577.1|1232649_1233294_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040706_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040706_2

1632450-1632636

Orphan

Consensus_repeat	Method
TTTTCTCGTACATCTACCGTTC	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP040706_2

>merge|NZ_CP040706|2|1632450-1632636|PILER-CR
TTTTCTCGTACATCTACTGTTCGATTTCCATTTTGACTACTTGTAGTATTCTGCAAGTTTTCTCGTACATCTACCGTTCTCGGTTGACTTGTCCCACTACTTTGTACATTTTCTCGTACATCTACTGTTCGATTTCCATTTTGACTACTTGTAGTATTCTGCAAGTTTTCTCGTACATCTACCGTTC

>NZ_CP040706|2|1|1632450-1632636|PILER-CR
TTTTCTCGTACATCTACTGTTC	GATTTCCATTTTGACTACTTGTAGTATTCTGCAAG
TTTTCTCGTACATCTACCGTTC	TCGGTTGACTTGTCCCACTACTTTGTACA
TTTTCTCGTACATCTACTGTTC	GATTTCCATTTTGACTACTTGTAGTATTCTGCAAG
TTTTCTCGTACATCTACCGTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040706.1\|WP_002322860.1\|1627032_1627347_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040706.1\|WP_002348875.1\|1635048_1636092_-\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|369151
NZ_CP040706.1\|WP_002348881.1\|1629137_1629485_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040706.1\|WP_002322861.1\|1626685_1626934_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP040706.1\|WP_060815725.1\|1627803_1629078_+\|ISL3-like-element-IS1476-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP040706.1\|WP_002322858.1\|1629477_1629780_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040706.1\|WP_002348835.1\|1625333_1625579_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP040706.1\|WP_002322862.1\|1625683_1626457_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040706.1\|WP_002287505.1\|1638818_1639211_-\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NZ_CP040706.1\|WP_002348879.1\|1631371_1631983_-\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	unknown
NZ_CP040706.1\|WP_002288118.1\|1640775_1642314_-\|gluconokinase	unknown	unknown	gnl\|CDD\|212659
NZ_CP040706.1\|WP_002322813.1\|1636858_1637509_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP040706.1\|WP_002321715.1\|1636246_1636573_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040706.1\|WP_002318021.1\|1637563_1638730_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP040706.1\|WP_002297290.1\|1640188_1640656_-\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|223854
NZ_CP040706.1\|WP_002348874.1\|1636580_1636784_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224393
NZ_CP040706.1\|WP_002295975.1\|1639226_1639670_-\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703
NZ_CP040706.1\|WP_002348880.1\|1629995_1631387_-\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP040706.1\|WP_002322855.1\|1631994_1632183_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040706.1\|WP_002348876.1\|1634828_1635047_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040706.1\|WP_002322861.1\|1626685_1626934_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	7.3051e-06
NZ_CP040706.1\|WP_002348875.1\|1635048_1636092_-\|replication-initiator-protein-A	gnl\|CDD\|369151	pfam06970, RepA_N, Replication initiator protein A (RepA) N-terminus. This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.	6.35575e-17
NZ_CP040706.1\|WP_060815725.1\|1627803_1629078_+\|ISL3-like-element-IS1476-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.45661e-74
NZ_CP040706.1\|WP_002348874.1\|1636580_1636784_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	3.61213e-06
NZ_CP040706.1\|WP_002287505.1\|1638818_1639211_-\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	1.13095e-82
NZ_CP040706.1\|WP_002288118.1\|1640775_1642314_-\|gluconokinase	gnl\|CDD\|212659	cd07770, FGGY_GntK, Gluconate kinases; a subfamily of the FGGY family of carbohydrate kinases. This subfamily is composed of a group of gluconate kinases (GntK, also known as gluconokinase; EC 2.7.1.12) encoded by the gntK gene, which catalyzes the ATP-dependent phosphorylation of D-gluconate and produce 6-phospho-D-gluconate and ADP. The presence of Mg2+ might be required for catalytic activity. The prototypical member of this subfamily is GntK from Lactobacillus acidophilus. Unlike Escherichia coli GntK, which belongs to the superfamily of P-loop containing nucleoside triphosphate hydrolases, members in this subfamily are homologous to glycerol kinase, xylulose kinase, and rhamnulokinase from Escherichia coli. They have been classified as members of the FGGY family of carbohydrate kinases, which contain two large domains separated by a deep cleft that forms the active site. This model spans both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Some uncharacterized homologous sequences are also included in this subfamily. The Lactobacillus gnt operon contains a single gntK gene. The gnt operons of some bacteria, such as Corynebacterium glutamicum, have two gntK genes. For example, the C. glutamicum gnt operon has both a gluconate kinase gntV gene (also known as gntK) and a second hypothetical gntK gene (also known as gntK2). Both gluconate kinases encoded by these genes belong to this family, however the protein encoded by C. glutamicum gntV is not included in this model as it is truncated in the C-terminal domain.	0
NZ_CP040706.1\|WP_002322813.1\|1636858_1637509_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.06613e-05
NZ_CP040706.1\|WP_002297290.1\|1640188_1640656_-\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	7.4093e-53
NZ_CP040706.1\|WP_002348835.1\|1625333_1625579_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.60019e-05
NZ_CP040706.1\|WP_002295975.1\|1639226_1639670_-\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	4.45441e-103
NZ_CP040706.1\|WP_002348880.1\|1629995_1631387_-\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	3.42818e-26
NZ_CP040706.1\|WP_002318021.1\|1637563_1638730_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.79537e-35

>NZ_CP040706.1|WP_002322855.1|1631994_1632183_-|hypothetical-protein
MQLILQISTQDFLELAELCDSVKKATNEKITVTNYIELMIQEELMMKNEIESNFKCCSLEKM
>NZ_CP040706.1|WP_002348879.1|1631371_1631983_-|plasmid-mobilization-relaxosome-protein-MobC
MDDKQKMYEKNRKHSEALNFRVDKKTYLELTLIAKQRGISRADVCRERLKGLKYEPPLLAEDDRVALIKQLNQIGNNLNQAVKALNIIAKYFREQSENKKEKSLHFSFDVSRYNIFKDELANSIAKKMMISYPDDIFLESNRSTSSFLKLSEVEKDYFQYWLEKQTRPDTKEEYSQKVDRNLIHSIQIIASLKDEVKQLWELL
>NZ_CP040706.1|WP_002348880.1|1629995_1631387_-|relaxase/mobilization-nuclease-domain-containing-protein
MGATITSKGRKKNLSSLLQYAANPSKKEKCVAVSGINCSDNSEEALQEMNLVRTRMNKSEDIAQAFHVIHSFDKNISKELSIEKMHEIAVEFAEKAFPNSQIIVASHNDKDHFHSHLVINNIDMETCKRLRIDPKDLERMRKINDEVLVENGLEPVDNQYYENLEKRTNLYSNDPSKLKNGKINYQEFVQNAIEATLENCEVNSFVRFSDHLAKEYNIEVYQFSKTNNKLGYVLYKQDVNFYERRDELITLGREKQSRKEKSQYVERTFSARKLGKKYSFESVFERLEKNLEETHMNNFVDLDTEQIIALASGVDYKTGELNVPFVELDSIAQKQFSDHEGAKKIIKYDDFLREVDRHYANTISLEDDQEYTIKLHTDVNPRTLRSTKSKTILVKKTDQKELFLPAEGFKNCSHTPSAKQIHYQISRIMNDDVKMYRAKKDYEFTQQMIENQQRRQRDFEMDF
>NZ_CP040706.1|WP_002322858.1|1629477_1629780_-|hypothetical-protein
MSDPYIKVYCSKETKTIFDSFYEQNKGIFGTKANMFRVMVSNLPVLANQSNVKLSNPESKGIEQKISEIESIVVGKLDEIDQKLSYYLKNKCKTEEGKDV
>NZ_CP040706.1|WP_002348881.1|1629137_1629485_-|hypothetical-protein
MFKVYFPFQWLFKGILLLLLGLILFGSYLTIKARYFPEEKPVKIVTKDLKMGETYQADGVEITFKKVELTEKRNEFAQHDRVLQVTYTMKNDTENPIRPQQWSIENKRLFVKSCW
>NZ_CP040706.1|WP_060815725.1|1627803_1629078_+|ISL3-like-element-IS1476-family-transposase
MDNHTRKLLGLTDKHLFFDEEWLIEKEYKGVQAQFIKGKLDDSPSYCEHCRSVRIIRNGSYTTRTQMLKVKEKLTILELKRTRFLCHDCGRTFSAKTDLVDEHHQLTKELKQAILMELYENQSRKLIAKKYFVSDGTVTRILREATKHYQPRMNFLPTVLCMDEFKSMKSVSGSMSFICVDGTTNQLFTILEDRRLYKLTQYFLHFPRKARLKVKYLVMDMNASYCQLLKTVFPNAEIVTDRFHIVQHINRSFNQLRVQIMNRFRTSHSENQKKYRRLKRYWKLLLKDSTTLEPLKRHYHRLFKRPISQTEIVDELLSYNEELRTAYHFCQLLRYYFVKRGTEGFQETLKTISSTLPQSFKKKFTIFHRYQSGISNAFKVSHSNGVTEGLNNKIKLIKRIAFGYRNFYNFRARIYLQQGLIFEN
>NZ_CP040706.1|WP_002322860.1|1627032_1627347_-|hypothetical-protein
MADENKVVPLETLVINKEEFEQLFLDFFVQYDRIYDFSSSLDLFELEAEIIENSREENGKIIISVEKFNELFSETFEIDTDYYQPQEVFRLFRDQIIGISQTTK
>NZ_CP040706.1|WP_002322861.1|1626685_1626934_-|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MDTITPTNFKKNIGKVLQEVVHSNSEIEITRDSKNGLNDGVIMISKRKWELLQEELYLQRTGTWAYVSDLMKNEKEDDFKVV
>NZ_CP040706.1|WP_002322862.1|1625683_1626457_+|hypothetical-protein
MKKFAIILTCALLTGAISGCATSDTNSTSTETSTTTSEKNYPIHFFPVPDGFEAYYHDKKLDVPLSESNSIEKVLPIEIEKNQENIKLKAELPILNSTEIDWHENIKVTIEKGALAQLYTEKVEQFFESGANKDFSKISDYSDNFFNETQDEITNSTFMAEDMYNMTLKKIKAYDHPLNLTLNNGLLSFVLAGYVDYEYSPDYLETPLQHENNDINFRFVYESKSKTWLVDQLSTINTSFHELPKPENEADMVIKIF
>NZ_CP040706.1|WP_002348835.1|1625333_1625579_-|helix-turn-helix-transcriptional-regulator
MLFLKEEKLIDKENVIGSNIRRIRLEKGMGQTELVRELQLSKIAMTRETLVKIEGGRQHIKLDQLRAIRDILQVSYEDLLQ
>NZ_CP040706.1|WP_002348876.1|1634828_1635047_-|hypothetical-protein
MIENHLVDKIHCLDQNADTLELTESICSNTIVLDLKAVNDDYVTHIIIDRKIAQKLSESLRKWAEGGNNENN
>NZ_CP040706.1|WP_002348875.1|1635048_1636092_-|replication-initiator-protein-A
MNEKEVESLVEKQGYSNSDIYAELYYQYPIFLNVNEKYKKMKLSSKLVYMLLKDRNRLSLKNNLYDENQKIFLIFEIKNLVEISGMSKNTILSALDELQKVKLLVKRKNGFNKNKMQMFPNFYYLLKPVLCKDDVYKINKITHQENSQKNLIVQNLNYGTNQYSVDSSKFELCDTSMKTRDKNNFADSSKNELELYKSYKDSKDIKESHNDDLFESLSTKNNKLDEELIETFIEENLLKQMWGESIVNCLKLASNSDYRQFDNWYKKFNYAIKSAEKEQKVQLKIIYEICNNSYFVDHVREQLAMTLRDLIRRAKTDHRIKQKNNYIFTSLKNKALELIKLQKKEGI
>NZ_CP040706.1|WP_002321715.1|1636246_1636573_-|hypothetical-protein
MASWLIEEIENERRKIMDAGITVMLDKQQTNQLKNYVFEMTKEAIDQARIDTGLERPFLKGKEMAKYLNVSYTTFLKFKRMGLPVILLEKMELFSKEECKKWILSHQI
>NZ_CP040706.1|WP_002348874.1|1636580_1636784_-|helix-turn-helix-domain-containing-protein
MITLNDQFIRSLRRHRADLILTKNDAAKLIGINRKTYVKIENGSKESIRASTYQKLVNWLLNDLKSK
>NZ_CP040706.1|WP_002322813.1|1636858_1637509_+|helix-turn-helix-transcriptional-regulator
MSIKTLLNLWFLCYNSLEFTIGGVTLNRIKFYIDSSKKTIKQISTETGINYTTLTNYYRGERNPRNTETWNILADYFHVPVSYLMGLDETNSIEQPNLDRIKTARLEKKDKIVKNIASLDSDYFTELSNLYFSMTSLLEVKLQEDDSDFLFLKSILEDSFEYTILFAKQKKFINKALNLNIDERKELESELFGNLTQVQVNNLKREITARLISKLQ
>NZ_CP040706.1|WP_002318021.1|1637563_1638730_+|site-specific-integrase
MSIQKYTTKSGARYSVRLYVRKDENGKQEYYVKKGFKTEKEAKLHEARKKVEIEDTGYHKPSNDLFITVYEEWLPSYRNRVQETTYQRTKDLFRLHILPKFGNKSISKITPVHCQNAVNEWALKFKNIKQLKSYSSQIFEYAIFAELLHRNPMANTNLPKREKKENENYFSLEELKAFWDILNKEEPLKHILIFQLLITTGIRKGELAALHWSDIYFEEQLMYVRKSYATIRNEEKNARRKTVRIQKNTKNISSERILPIDAQTIEMLKIWKKEQARELLQFGINTNTKNQLIFTYVNADGDINQPLHADYSNNILKRLEKKYKFKHVTIHGFRHTHATLLLEGGASIKETQDRLGHKNAETTLNTYSHVTEKAQRNALEKFIAYTGL
>NZ_CP040706.1|WP_002287505.1|1638818_1639211_-|30S-ribosomal-protein-S9
MAQVQYIGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFAVTETKGAYDVFVNVNGGGYAGQSGAIRHGIARALLEVDPDFRLALKRAGLLTRDARMVERKKPGLKKARKASQFSKR
>NZ_CP040706.1|WP_002295975.1|1639226_1639670_-|50S-ribosomal-protein-L13
MRTTYMAKPGEVERKWYVVDATDVPLGRLSTVVASVLRGKNKPTFTPHLDTGDFVIVINADKVKLTGKKATDKIYYRHSNYPGGLKSITAGELRAKNSRRLIETSVKGMLPKNTLGRKQFTKLNVYGGAEHPHAAQQPEVLDITNLI
>NZ_CP040706.1|WP_002297290.1|1640188_1640656_-|DNA-starvation/stationary-phase-protection-protein
MKFQQTKEVLNQLVADLSQMSVVVHQTHWYMRGPGFLTLHPMMDEFMDDLNAQLDEVSERLITLDGSPYSTLREFADNTKIPDEIGRWDRTIPERLETLVAGYRYLADLYQKGIEVSGEEGDDPTQDIFIEFKTATEKRIWMIQAHLGKAPEIDA
>NZ_CP040706.1|WP_002288118.1|1640775_1642314_-|gluconokinase
MNVSIGLDIGTTQTKAVAFTDEAQEAASAYFRYPLIQETQGMAEQDQELIFQGVCTVIKEVIKQLPSDTIIQFVSFSSAMHGLILLDEEKTPLSRMITWADNRAADEAEKLKYTVLGKEFYRQTGTPIHPMTPLNKIKWLQNSQPELFKKTAYFVGIKDYIFYRLFGELISDYGTASGTGYFDIHEFQWAEEVLDYLNIRIEQLPQVFPSTYQVTGLPSKTAAELGLPNDISFVLGGADGPLSNLGLGAFGDTIAALTVGTSGALRFITTQPQFHPEMETFCYVLDQKHWVVGGATSNGAGIFDWAGHTFLQEVVQSAKEKGENPYDALLSAIAFVPAGANGLIFHPYLLGERAPLWDADAFGSFIGLQRQHTEKEMMKAILEGICLNLYRILKGVCQENQLTEIRATGGFAQSPIFRQMMADVLGYPLVFPTVTEASALGAVILGWRSIGKIQSISEAQELIELKEQVGVQETDHKKYQKIYPLFVSTQKHLAQTYQQFAQLREELADSEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_CP040706.1	1632688-1632722	2	0.943
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NZ_CP040706.1	1632637-1632665	1	0.966
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_CP040706.1	1632688-1632722	2	0.943

1. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to position: 1632688-1632722, mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

2. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to position: 1632637-1632665, mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

3. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to position: 1632688-1632722, mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25581-25615	0	1.0
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25689-25723	0	1.0
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41127-41161	0	1.0
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41235-41269	0	1.0
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50719-50753	0	1.0
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50827-50861	0	1.0
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25581-25615	0	1.0
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25689-25723	0	1.0
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41127-41161	0	1.0
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41235-41269	0	1.0
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50719-50753	0	1.0
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50827-50861	0	1.0
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50776-50804	1	0.966
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50884-50912	1	0.966
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25530-25558	1	0.966
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25638-25666	1	0.966
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41076-41104	1	0.966
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41184-41212	1	0.966
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25473-25507	2	0.943
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41019-41053	2	0.943
NZ_CP040706_2	2.1\|1632472\|35\|NZ_CP040706\|PILER-CR	1632472-1632506	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50935-50969	2	0.943
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_KX853854	Enterococcus faecium strain A120 plasmid pEMA120, complete sequence	25473-25507	2	0.943
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NC_016967	Enterococcus faecium plasmid pZB18, complete sequence	41019-41053	2	0.943
NZ_CP040706_2	2.3\|1632580\|35\|NZ_CP040706\|PILER-CR	1632580-1632614	35	NZ_KX976485	Enterococcus avium strain 19081 plasmid pEA19081, complete sequence	50935-50969	2	0.943
NZ_CP040706_2	2.2\|1632529\|29\|NZ_CP040706\|PILER-CR	1632529-1632557	29	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	33019-33047	8	0.724

1. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

2. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

3. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

4. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

5. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

6. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

7. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

8. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

9. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

10. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

11. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

12. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 0, identity: 1.0

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattctgcaag	Protospacer
***********************************

13. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

14. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

15. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

16. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

17. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

18. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 1, identity: 0.966

tcggttgacttgtcccactactttgtaca	CRISPR spacer
tcggttggcttgtcccactactttgtaca	Protospacer
*******.*********************

19. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

20. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

21. spacer 2.1|1632472|35|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

22. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NZ_KX853854 (Enterococcus faecium strain A120 plasmid pEMA120, complete sequence) position: , mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

23. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NC_016967 (Enterococcus faecium plasmid pZB18, complete sequence) position: , mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

24. spacer 2.3|1632580|35|NZ_CP040706|PILER-CR matches to NZ_KX976485 (Enterococcus avium strain 19081 plasmid pEA19081, complete sequence) position: , mismatch: 2, identity: 0.943

gatttccattttgactacttgtagtattctgcaag	CRISPR spacer
gatttccattttgactacttgtagtattttgtaag	Protospacer
****************************.**.***

25. spacer 2.2|1632529|29|NZ_CP040706|PILER-CR matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.724

tcggttgacttgtcccactactttgtaca	CRISPR spacer
gatgttgacttgtcacgctactttgttac	Protospacer
   *********** *.*********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

146038 : 155581

unidentified_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002348948.1\|146038_147427_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	7.0e-10	26.0
WP_071974475.1\|147794_147983_-	hypothetical protein	NA	NA	NA	NA
WP_002297115.1\|147995_148373_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|148628_149357_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|149356_149611_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|149612_150284_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|150284_152507_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|152491_153931_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002378443.1\|153962_155006_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|155002_155581_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_2

466066 : 488668

Streptococcus_phage(25.0%)

protease,integrase,transposase

attL 462525:462542|attR 498563:498580

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
462525:462542	attL	NA	NA	NA	NA
WP_002378019.1\|466066_466906_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|467090_467978_+	rotamase	NA	NA	NA	NA
WP_002311093.1\|468571_469267_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|469250_469649_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002287107.1\|470057_471308_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296760.1\|471449_472445_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002289423.1\|472462_473017_-	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289422.1\|473004_473496_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002378335.1\|473488_475357_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|475375_476176_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289418.1\|476399_476615_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002303864.1\|476753_477239_+	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|477694_478108_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002322258.1\|478244_478505_+	hypothetical protein	NA	NA	NA	NA
WP_002303865.1\|478432_478672_+	hypothetical protein	NA	NA	NA	NA
WP_002321532.1\|478622_478913_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|479158_480337_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_000222572.1\|480492_481446_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002288357.1\|481502_482630_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_002288355.1\|482723_484559_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.4e-20	24.4
WP_002288353.1\|484705_485926_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002288352.1\|485945_486440_+	nucleoside deoxyribosyltransferase	A0A1W6JK28	Lactococcus_phage	7.2e-42	56.5
WP_002288350.1\|486432_487104_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|487372_488668_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
498563:498580	attR	NA	NA	NA	NA

DBSCAN-SWA_3

613961 : 736106

118

Streptococcus_phage(20.0%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288520.1\|613961_614885_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_002294143.1\|618062_618284_+	hypothetical protein	NA	NA	NA	NA
WP_002294142.1\|618391_618739_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002294141.1\|618765_621072_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
WP_002288509.1\|621084_621396_-	YlxQ-related RNA-binding protein	NA	NA	NA	NA
WP_002288501.1\|621392_621686_-	YlxR family protein	NA	NA	NA	NA
WP_002301262.1\|621707_622883_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002288499.1\|622906_623380_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_002294138.1\|623523_627876_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	3.9e-22	41.4
WP_002294137.1\|628087_629797_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002294136.1\|629864_631133_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294135.1\|631293_632094_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|632090_632903_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002287107.1\|633311_634562_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002293875.1\|634880_635438_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|635440_636163_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|636298_637180_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|637278_638061_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|638419_638899_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326698.1\|639115_640207_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002288432.1\|641329_643021_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288434.1\|643440_644388_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|644502_645522_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|645612_646842_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|647302_648004_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002326809.1\|648175_649471_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002301319.1\|650134_651151_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288445.1\|651147_651612_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002348676.1\|651618_652161_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|652144_652969_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|653057_654038_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|654061_655546_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|655557_656547_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|656794_656962_+	DUF3042 family protein	NA	NA	NA	NA
WP_002288458.1\|657023_658835_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|658831_659197_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|659359_659755_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|659772_660735_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|660734_660947_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|660967_661666_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|661685_662228_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002301321.1\|662359_663364_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|663360_664350_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|664346_665153_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|665318_666275_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|666351_666870_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|666957_667107_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|667334_667781_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002288533.1\|667975_669871_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002303934.1\|670195_671170_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002296332.1\|671735_672302_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002348678.1\|672557_673889_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|673854_674205_+	hypothetical protein	NA	NA	NA	NA
WP_002296337.1\|674716_675061_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002301399.1\|675326_676286_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287776.1\|676475_677072_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|677195_678995_+	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297218.1\|679209_680505_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002297633.1\|680794_681007_-	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|681870_682830_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002326704.1\|683042_683951_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002288573.1\|683999_684386_+	YxeA family protein	NA	NA	NA	NA
WP_002288574.1\|684693_686040_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002288575.1\|686151_687501_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288576.1\|687617_688871_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288577.1\|688941_689427_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288579.1\|689449_690208_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|690223_691402_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002303943.1\|691631_693752_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_099119703.1\|693687_693963_+	hypothetical protein	NA	NA	NA	NA
WP_002296838.1\|693974_694700_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|694689_695199_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|695268_696717_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288590.1\|696716_697433_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|697413_697764_-	SdpI family protein	NA	NA	NA	NA
WP_002288592.1\|697907_698681_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002302293.1\|699437_699740_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|700178_701357_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|701693_701933_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|702294_702555_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|702739_703237_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|703366_704077_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|704089_705754_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|705958_706621_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|706630_707446_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|707707_708151_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|708284_708623_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002302962.1\|708610_708988_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002322902.1\|709211_710405_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|710570_710993_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002303955.1\|711581_712037_+	hypothetical protein	NA	NA	NA	NA
WP_002293154.1\|712004_712202_-	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|712198_713371_-	class C sortase	NA	NA	NA	NA
WP_002288981.1\|713576_714392_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002303960.1\|715002_716016_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002303962.1\|716046_716505_-	cell wall anchor	NA	NA	NA	NA
WP_002303963.1\|716501_718829_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002296840.1\|719100_720288_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002288972.1\|720944_721058_+\|protease	CAAX amino protease	NA	NA	NA	NA
WP_002288970.1\|721145_721439_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002311684.1\|721475_721661_+	hypothetical protein	NA	NA	NA	NA
WP_002286913.1\|721696_722044_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293717.1\|722179_722941_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002293716.1\|722930_723452_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002297190.1\|723621_724413_-	hypothetical protein	NA	NA	NA	NA
WP_002290277.1\|724537_724789_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|724800_725076_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|725328_725883_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|725961_726483_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|726486_727065_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|727176_728595_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|728615_728954_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|728913_729417_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|729547_730252_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002303966.1\|730248_731985_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002297196.1\|732087_734559_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.0e-45	28.8
WP_099745856.1\|734563_734746_-	RNA helicase	NA	NA	NA	NA
WP_002326707.1\|734831_736106_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.5e-54	35.9

DBSCAN-SWA_4

739684 : 796517

Streptococcus_phage(21.05%)

transposase,tRNA,integrase

attL 732572:732587|attR 796874:796889

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
732572:732587	attL	NA	NA	NA	NA
WP_010782561.1\|739684_740644_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002301623.1\|740766_741741_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	7.1e-25	31.8
WP_002297404.1\|742150_743401_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295273.1\|743686_743944_+	hypothetical protein	NA	NA	NA	NA
WP_008266934.1\|744175_744589_-	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002326711.1\|744845_746024_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002295743.1\|746184_747094_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_099098442.1\|747395_748558_-\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
WP_099745852.1\|748662_750001_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	3.4e-78	52.7
WP_002301695.1\|750041_750734_-	hypothetical protein	Q9MCC6	Lactobacillus_phage	4.0e-30	43.4
WP_002296536.1\|750728_750995_+\|integrase	tyrosine-type recombinase/integrase	A0A0P0I3D2	Lactobacillus_phage	1.4e-07	56.5
WP_002294835.1\|751170_751740_-	prevent-host-death protein	NA	NA	NA	NA
WP_002304701.1\|751813_752137_-	hypothetical protein	NA	NA	NA	NA
WP_002294839.1\|752290_753103_-	hypothetical protein	NA	NA	NA	NA
WP_002304700.1\|753456_754305_+	MoxR family ATPase	NA	NA	NA	NA
WP_002304699.1\|754449_755391_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002299539.1\|759185_761357_-	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	5.0e-71	32.3
WP_002312937.1\|761376_763563_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.3e-121	38.6
WP_002289040.1\|763562_763772_-	copper chaperone CopZ	NA	NA	NA	NA
WP_002294855.1\|763784_764225_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002304690.1\|764298_764838_-	topology modulation protein	A0A097BYE2	Leuconostoc_phage	3.8e-20	34.5
WP_002288779.1\|765452_766919_-	amino acid permease	NA	NA	NA	NA
WP_002304688.1\|767229_769311_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.4e-115	35.6
WP_002288776.1\|769834_770194_-	YccF domain-containing protein	NA	NA	NA	NA
WP_002326717.1\|770223_770565_-	hypothetical protein	NA	NA	NA	NA
WP_002304684.1\|770561_771236_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002288767.1\|772288_773587_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002304682.1\|773626_774817_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002348809.1\|774837_775365_-	DUF5590 domain-containg protein	NA	NA	NA	NA
WP_002304681.1\|775411_778201_-	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
WP_002288762.1\|778347_778548_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002323868.1\|778999_779320_-	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|779597_780893_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288760.1\|781344_782463_-	hypothetical protein	NA	NA	NA	NA
WP_002304680.1\|782933_784241_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002297218.1\|784324_785620_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002340453.1\|785881_787081_+	YdcF family protein	NA	NA	NA	NA
WP_002289547.1\|787107_788376_-	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.2e-42	31.1
WP_002306245.1\|789256_789460_-	hypothetical protein	NA	NA	NA	NA
WP_002291751.1\|789592_790096_-	HD domain-containing protein	NA	NA	NA	NA
WP_002294889.1\|790218_790983_-	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	1.7e-05	26.1
WP_002297293.1\|791303_792491_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_002289551.1\|792710_792986_+	acylphosphatase	NA	NA	NA	NA
WP_002348852.1\|793053_793245_-	hypothetical protein	NA	NA	NA	NA
WP_002312285.1\|793423_794374_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_002312284.1\|794552_794753_-	hypothetical protein	NA	NA	NA	NA
WP_002348851.1\|794753_794936_-	hypothetical protein	NA	NA	NA	NA
WP_010782560.1\|795557_796517_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
796874:796889	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1066814 : 1123596

Bacillus_phage(17.65%)

transposase,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002301399.1\|1066814_1067774_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287122.1\|1068144_1069026_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.3e-73	50.3
WP_002287121.1\|1069068_1070088_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_002287119.1\|1070720_1071725_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002287118.1\|1071737_1072787_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002287116.1\|1072803_1073625_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002287115.1\|1073611_1074391_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002287114.1\|1074407_1074878_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002287112.1\|1074889_1075309_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_002302892.1\|1075389_1078158_-	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002294014.1\|1078357_1078582_+	hypothetical protein	NA	NA	NA	NA
WP_002294013.1\|1079360_1081076_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-50	28.3
WP_002289511.1\|1081078_1082842_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-44	30.2
WP_002326809.1\|1083021_1084317_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002289509.1\|1084403_1084940_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_002289508.1\|1085262_1085685_-	methylglyoxal synthase	NA	NA	NA	NA
WP_002289507.1\|1085893_1087003_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	1.2e-20	33.0
WP_002294011.1\|1087126_1087756_-	hypothetical protein	NA	NA	NA	NA
WP_002294004.1\|1088206_1089091_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_002305490.1\|1089083_1089653_-	ribonuclease M5	NA	NA	NA	NA
WP_002294001.1\|1089645_1090422_-	TatD family hydrolase	NA	NA	NA	NA
WP_002294000.1\|1090576_1091899_-	amino acid permease	NA	NA	NA	NA
WP_002293998.1\|1092073_1092661_+	hypothetical protein	NA	NA	NA	NA
WP_002296623.1\|1093225_1094521_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002289325.1\|1094650_1096660_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.4e-96	38.3
WP_002289337.1\|1096927_1097206_+	hypothetical protein	NA	NA	NA	NA
WP_002289327.1\|1097302_1098124_+	NUDIX hydrolase	G3MA14	Bacillus_virus	2.7e-25	32.8
WP_080441679.1\|1098128_1098347_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1098414_1099710_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002289328.1\|1099930_1100941_-	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	2.8e-56	40.8
WP_002289330.1\|1100952_1101906_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.0e-20	33.2
WP_002289332.1\|1101895_1102966_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-20	31.0
WP_002289334.1\|1102971_1104015_-	ABC transporter permease	NA	NA	NA	NA
WP_002293573.1\|1104015_1104957_-	ABC transporter permease	NA	NA	NA	NA
WP_002293992.1\|1105040_1105388_+	DUF3899 domain-containing protein	NA	NA	NA	NA
WP_002289796.1\|1105457_1107119_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293990.1\|1107297_1107417_+	ribonuclease P protein component	NA	NA	NA	NA
WP_002289795.1\|1107664_1108213_-	aminoglycoside N-acetyltransferase AAC(6')-Ii	NA	NA	NA	NA
WP_002303623.1\|1108765_1109869_+	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002297218.1\|1109959_1111255_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002377896.1\|1111381_1111594_-	hypothetical protein	NA	NA	NA	NA
WP_002293986.1\|1111583_1112651_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_002289244.1\|1112880_1115328_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	8.1e-86	50.7
WP_002289243.1\|1115516_1116953_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	1.4e-48	29.4
WP_002289242.1\|1117271_1118087_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002289241.1\|1118104_1118740_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.4e-27	36.4
WP_002289240.1\|1118758_1119400_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_002289239.1\|1119879_1120365_+\|tRNA	prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_002321669.1\|1120636_1122772_-	collagen-binding MSCRAMM adhesin Acm	NA	NA	NA	NA
WP_002289237.1\|1123296_1123596_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA

DBSCAN-SWA_6

1189352 : 1222784

uncultured_virus(16.67%)

protease,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000997695.1\|1189352_1190531_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002288864.1\|1190931_1192557_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002288862.1\|1192607_1192892_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288860.1\|1193116_1193779_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002288858.1\|1193854_1195147_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002288856.1\|1195316_1195946_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_002288854.1\|1196048_1196858_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
WP_002288853.1\|1196912_1197782_-	hypothetical protein	NA	NA	NA	NA
WP_002288852.1\|1197782_1199099_-	hypothetical protein	NA	NA	NA	NA
WP_002288851.1\|1199095_1200931_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.0e-37	37.7
WP_002288850.1\|1200935_1201640_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_002288847.1\|1201829_1202690_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	24.4
WP_002322652.1\|1202676_1203246_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_002286097.1\|1203875_1204829_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002321654.1\|1204825_1204972_-\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002287810.1\|1205075_1205387_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002304799.1\|1205388_1205586_-	enterocin	NA	NA	NA	NA
WP_002287807.1\|1205979_1207707_-	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002287805.1\|1207699_1208893_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287801.1\|1209080_1209725_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002304795.1\|1209672_1209864_-	hypothetical protein	NA	NA	NA	NA
WP_002290587.1\|1209818_1209953_-	hypothetical protein	NA	NA	NA	NA
WP_002287799.1\|1209954_1212087_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_002287797.1\|1212083_1212557_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287795.1\|1212957_1213182_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287793.1\|1213340_1215500_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287792.1\|1215549_1216515_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287791.1\|1216603_1217743_-	AI-2E family transporter	NA	NA	NA	NA
WP_002287788.1\|1218051_1218765_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287787.1\|1219018_1219720_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002290558.1\|1219953_1221486_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002295743.1\|1221875_1222784_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1376959 : 1408738

Bacillus_phage(33.33%)

transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002285932.1\|1376959_1377139_+\|transposase	transposase	NA	NA	NA	NA
WP_002321622.1\|1377132_1377345_+	hypothetical protein	NA	NA	NA	NA
WP_104674935.1\|1377332_1377503_+	hypothetical protein	NA	NA	NA	NA
WP_099704171.1\|1377926_1378667_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002285924.1\|1379092_1382164_-	hypothetical protein	NA	NA	NA	NA
WP_002285920.1\|1384931_1386653_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-37	28.0
WP_002285918.1\|1386667_1388452_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-46	28.2
WP_002285917.1\|1388832_1390386_-	glycosyl hydrolase	NA	NA	NA	NA
WP_002285916.1\|1390733_1393148_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
WP_002301403.1\|1393574_1395593_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	5.8e-13	39.6
WP_002285911.1\|1395962_1396619_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002285909.1\|1396618_1397575_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
WP_002285906.1\|1397574_1398141_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
WP_002378238.1\|1398576_1398807_+	hypothetical protein	NA	NA	NA	NA
WP_002296840.1\|1398999_1400187_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_025479400.1\|1400283_1400586_+	hypothetical protein	NA	NA	NA	NA
WP_002303477.1\|1401360_1402380_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
WP_002301818.1\|1402390_1402597_-\|holin	holin	NA	NA	NA	NA
WP_002301399.1\|1402729_1403689_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002304713.1\|1403891_1404824_+	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	1.8e-57	53.8
WP_002341521.1\|1404895_1405252_+	hypothetical protein	U4KJ82	Streptococcus_phage	9.2e-15	42.2
WP_000997695.1\|1405349_1406528_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_086953915.1\|1407398_1408738_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7

DBSCAN-SWA_8

1542843 : 1555958

Streptococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297366.1\|1542843_1543158_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
WP_002297365.1\|1543170_1543545_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002311649.1\|1543545_1543890_+	hypothetical protein	NA	NA	NA	NA
WP_002343904.1\|1543972_1545118_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	6.0e-132	62.8
WP_002348644.1\|1545483_1545714_+	hypothetical protein	NA	NA	NA	NA
WP_002297361.1\|1545832_1547692_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-30	26.0
WP_002297360.1\|1547785_1548025_+	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	2.1e-23	80.3
WP_002297358.1\|1548102_1548777_+	AAA family ATPase	NA	NA	NA	NA
WP_002321810.1\|1549009_1549444_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
WP_002297356.1\|1549444_1550152_+	DNA methylase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
WP_002297354.1\|1550141_1550432_+	hypothetical protein	NA	NA	NA	NA
WP_002297353.1\|1550690_1551875_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002317225.1\|1551871_1552009_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|1552754_1554665_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033658092.1\|1554768_1554993_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002297350.1\|1555005_1555509_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_002297349.1\|1555568_1555958_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3

DBSCAN-SWA_9

1583136 : 1606703

Bacillus_phage(50.0%)

transposase,integrase

attL 1600065:1600080|attR 1610310:1610325

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297332.1\|1583136_1583331_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_138816292.1\|1583369_1583516_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_077828743.1\|1583522_1583678_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002304821.1\|1585329_1585572_-	hypothetical protein	NA	NA	NA	NA
WP_002297326.1\|1585534_1587151_-	cobalamin biosynthesis protein	NA	NA	NA	NA
WP_002317220.1\|1587268_1587487_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_106913778.1\|1587618_1588143_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.8e-14	36.1
WP_002304820.1\|1588335_1588575_-	hypothetical protein	NA	NA	NA	NA
WP_002297324.1\|1588598_1590122_-	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002322279.1\|1590139_1590262_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_002304819.1\|1590291_1591275_-	GTP-binding protein	NA	NA	NA	NA
WP_002297320.1\|1591298_1591448_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002297319.1\|1591468_1591846_-	hypothetical protein	NA	NA	NA	NA
WP_002297318.1\|1591877_1592057_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_002297316.1\|1592071_1592341_-	30S ribosomal protein S14	NA	NA	NA	NA
WP_002297310.1\|1592863_1594606_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.4e-30	29.1
WP_002297309.1\|1594589_1596344_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-24	24.8
WP_002297308.1\|1596453_1597023_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_002311663.1\|1597040_1598465_-	energy-coupling factor ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	5.9e-20	26.4
WP_002297304.1\|1598466_1599135_-	cobalt transporter	NA	NA	NA	NA
WP_071858995.1\|1599265_1599850_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
1600065:1600080	attL	NA	NA	NA	NA
WP_002297302.1\|1600180_1600414_-	iron-dependent repressor	NA	NA	NA	NA
WP_002297295.1\|1600428_1601379_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297294.1\|1601375_1602218_-	metal ABC transporter permease	NA	NA	NA	NA
WP_002297293.1\|1602539_1603727_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_002297292.1\|1603818_1604559_-	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.7e-19	33.2
WP_002320809.1\|1605246_1605405_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297291.1\|1605476_1606703_+\|integrase	site-specific integrase	NA	NA	NA	NA
1610310:1610325	attR	NA	NA	NA	NA

DBSCAN-SWA_10

1828064 : 1887211

Bacillus_phage(18.75%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287909.1\|1828064_1828361_-\|tRNA	phenylalanyl-tRNA synthetase subunit alpha	NA	NA	NA	NA
WP_002287910.1\|1828716_1829073_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002348747.1\|1829082_1829982_+	metallophosphoesterase	NA	NA	NA	NA
WP_010782507.1\|1830214_1831174_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002331051.1\|1831431_1832877_+\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	7.5e-124	48.0
WP_002348590.1\|1832922_1833657_-	aquaporin family protein	NA	NA	NA	NA
WP_002301190.1\|1833982_1834393_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_002294273.1\|1834385_1835087_+	LrgB family protein	NA	NA	NA	NA
WP_002348592.1\|1835086_1836700_+	M protein trans-acting positive regulator	NA	NA	NA	NA
WP_002290506.1\|1836689_1836911_+	DUF2829 domain-containing protein	A0A0S2MV93	Bacillus_phage	1.1e-05	33.3
WP_002297929.1\|1836907_1837669_+	3-oxoacyl-ACP reductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.2e-16	31.7
WP_002294268.1\|1838049_1838559_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	7.5e-10	31.8
WP_002294267.1\|1838628_1839168_-	biotin transporter BioY	NA	NA	NA	NA
WP_002294265.1\|1839307_1839919_-	30S ribosomal protein S4	NA	NA	NA	NA
WP_002324284.1\|1840234_1841032_+	formate/nitrite transporter	NA	NA	NA	NA
WP_002294262.1\|1841059_1841695_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_002294261.1\|1841714_1842488_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002297924.1\|1842484_1842643_-	hypothetical protein	NA	NA	NA	NA
WP_002348595.1\|1842895_1843693_+	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_002297923.1\|1843670_1844084_+	hypothetical protein	NA	NA	NA	NA
WP_002294258.1\|1844067_1846713_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.6e-39	26.1
WP_002301736.1\|1846730_1848839_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.8e-57	41.1
WP_002348596.1\|1848860_1849421_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_002285758.1\|1849592_1849787_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|1849776_1850130_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002296127.1\|1850231_1851779_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002348864.1\|1851858_1853847_-	PTS system trehalose-specific EIIBC component	NA	NA	NA	NA
WP_002294254.1\|1854069_1854783_+	trehalose operon repressor	A0A291LID1	Streptomyces_phage	1.2e-05	39.7
WP_002294252.1\|1854859_1855306_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_002290528.1\|1855475_1856078_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_002289812.1\|1856090_1857092_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-07	25.8
WP_002341570.1\|1857120_1857699_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_002294249.1\|1857750_1858233_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_002289815.1\|1858349_1858724_+	hypothetical protein	NA	NA	NA	NA
WP_002294246.1\|1859523_1860876_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_002297079.1\|1861022_1861613_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_002294242.1\|1861740_1863090_-	amino acid permease	NA	NA	NA	NA
WP_002294240.1\|1863257_1863998_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-30	39.7
WP_002297081.1\|1864010_1865603_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002325201.1\|1865641_1865833_-	hypothetical protein	NA	NA	NA	NA
WP_002293448.1\|1866170_1866467_-	hypothetical protein	NA	NA	NA	NA
WP_002294236.1\|1866642_1867368_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_002301156.1\|1867360_1868203_+	chorismate mutase	NA	NA	NA	NA
WP_002294232.1\|1868205_1868727_+	transcription repressor NadR	NA	NA	NA	NA
WP_002304058.1\|1868765_1868975_-	hypothetical protein	NA	NA	NA	NA
WP_002289284.1\|1868979_1869543_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.3e-12	37.1
WP_002289282.1\|1869793_1870063_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_002297086.1\|1870250_1872377_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_002289280.1\|1872762_1873029_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002289279.1\|1873172_1875164_+	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	8.4e-65	33.9
WP_002294228.1\|1875517_1876819_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002326809.1\|1877194_1878490_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_010782510.1\|1878557_1879736_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	3.8e-65	39.9
WP_002289277.1\|1880082_1881453_-	MATE family efflux transporter	NA	NA	NA	NA
WP_002289744.1\|1881634_1881958_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_002299254.1\|1882282_1882891_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_002348768.1\|1883220_1883937_+	pseudouridine synthase	NA	NA	NA	NA
WP_002289749.1\|1883949_1884645_+	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_002289751.1\|1884728_1885358_+	uridine kinase	A0A1V0SAA3	Catovirus	3.1e-34	40.2
WP_086953915.1\|1885872_1887211_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7

DBSCAN-SWA_11

1900859 : 1937656

Lysinibacillus_phage(22.22%)

transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326809.1\|1900859_1902155_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002301399.1\|1902421_1903381_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002294203.1\|1903606_1906312_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_002317078.1\|1906500_1906722_+	hypothetical protein	NA	NA	NA	NA
WP_002294202.1\|1906908_1908732_+	APC family permease	NA	NA	NA	NA
WP_002348885.1\|1908873_1909059_-	hypothetical protein	NA	NA	NA	NA
WP_002294199.1\|1909533_1909797_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002301121.1\|1909796_1910063_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002301116.1\|1911293_1911965_-	ABC transporter permease	NA	NA	NA	NA
WP_002301114.1\|1911961_1912879_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293405.1\|1912875_1913517_-	ABC transporter permease	NA	NA	NA	NA
WP_002348889.1\|1913520_1914696_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.0e-17	32.9
WP_002352545.1\|1914888_1915920_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_002341590.1\|1917596_1918550_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002319878.1\|1918640_1919936_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-54	37.2
WP_002326809.1\|1920097_1921393_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002289743.1\|1922102_1924742_+	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.6e-84	31.2
WP_002294185.1\|1924909_1925608_-	DUF975 family protein	NA	NA	NA	NA
WP_002341590.1\|1925710_1926664_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002294183.1\|1926892_1928038_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	40.9
WP_002300794.1\|1928134_1928515_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_076005167.1\|1928611_1928791_-	hypothetical protein	NA	NA	NA	NA
WP_010782512.1\|1928819_1931417_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_010782513.1\|1931324_1932935_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	8.4e-124	48.0
WP_002300788.1\|1935212_1935692_+	TRAP transporter small permease	NA	NA	NA	NA
WP_086953915.1\|1936317_1937656_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7

DBSCAN-SWA_12

1963847 : 1974026

Streptococcus_phage(77.78%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002290101.1\|1963847_1965137_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-22	30.2
WP_002345011.1\|1965564_1966044_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_001825268.1\|1966254_1966374_+	hypothetical protein	NA	NA	NA	NA
WP_000420682.1\|1966396_1966711_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|1966726_1967113_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|1967141_1968527_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000398284.1\|1968705_1969911_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_002286940.1\|1970694_1972605_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_032509114.1\|1972708_1972933_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.5e-27	97.1
WP_002345010.1\|1973049_1973547_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.3e-88	97.6
WP_002345009.1\|1973633_1974026_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	4.6e-68	99.2

DBSCAN-SWA_13

2398766 : 2407238

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|2398766_2399411_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002378197.1\|2399425_2399755_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|2399768_2400707_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|2400742_2401567_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|2401559_2401907_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|2401975_2402848_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|2402956_2404078_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|2404131_2404734_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|2405048_2407238_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_14

2460248 : 2535695

Enterococcus_phage(25.64%)

head,transposase,protease,portal,holin,integrase,tRNA,terminase,capsid,tail

attL 2515832:2515847|attR 2519185:2519200

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|2460248_2463047_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|2463095_2464622_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|2464636_2465284_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|2465467_2465797_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|2465973_2466702_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|2466717_2467731_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|2467730_2469008_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|2469070_2471773_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|2471924_2472242_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|2472271_2472592_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|2472699_2474160_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|2474227_2474449_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|2474479_2474662_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|2474661_2475075_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|2475197_2476379_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286587.1\|2476909_2478049_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|2478347_2478983_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|2479095_2479731_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|2479764_2480226_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002348715.1\|2480355_2480787_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|2480804_2481125_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|2481423_2482200_+	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|2482214_2482418_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|2482433_2482772_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296610.1\|2482758_2482938_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|2482980_2483451_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|2483537_2484236_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|2484413_2484755_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|2484747_2485419_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286553.1\|2485424_2486111_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286552.1\|2486113_2486863_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286696.1\|2486874_2487144_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|2487305_2487608_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|2487604_2487766_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|2487762_2488068_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|2488067_2488424_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|2488383_2488629_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|2488625_2489045_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|2489041_2489599_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|2489595_2489892_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|2489968_2490382_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002300143.1\|2490839_2491115_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|2491568_2491775_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|2491970_2492138_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|2492163_2492508_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|2492512_2492794_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|2492896_2493211_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|2493188_2494883_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|2494902_2496081_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|2496043_2496730_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|2496729_2497890_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|2497899_2498775_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|2498771_2499083_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|2499072_2499426_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|2499415_2499817_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|2499809_2500214_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|2500225_2500834_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|2500853_2501216_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|2501218_2501401_+	hypothetical protein	NA	NA	NA	NA
WP_002348716.1\|2501417_2504849_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002286500.1\|2504899_2505637_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002286497.1\|2505646_2507938_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	9.6e-89	30.0
WP_002286495.1\|2507961_2510088_+	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002286491.1\|2510250_2510697_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|2510698_2510836_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|2510873_2511167_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|2511163_2511388_+\|holin	holin	NA	NA	NA	NA
WP_002349643.1\|2511384_2512410_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.8e-64	61.3
WP_087046766.1\|2513349_2514511_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|2515434_2515842_+	hypothetical protein	NA	NA	NA	NA
2515832:2515847	attL	NA	NA	NA	NA
WP_002296902.1\|2515855_2516257_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|2516258_2516630_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|2516665_2516968_-	hypothetical protein	NA	NA	NA	NA
WP_076005172.1\|2517216_2517417_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002348827.1\|2517721_2518954_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|2519210_2519780_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
2519185:2519200	attR	NA	NA	NA	NA
WP_002297963.1\|2519957_2520398_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|2520555_2521320_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|2521351_2522275_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002331243.1\|2522350_2523490_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|2523482_2524283_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|2524282_2525110_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|2525087_2525822_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|2525921_2526788_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|2526801_2527374_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002294532.1\|2527395_2528424_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286428.1\|2528521_2529373_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002348826.1\|2529406_2531440_+	hypothetical protein	NA	NA	NA	NA
WP_002348825.1\|2531483_2532764_+	EpaQ family protein	NA	NA	NA	NA
WP_002297185.1\|2532860_2534156_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_010782578.1\|2534420_2535695_-\|transposase	ISL3-like element IS1476 family transposase	A0A1S5SBP9	Streptococcus_phage	8.6e-55	36.1

DBSCAN-SWA_15

2612524 : 2678998

Streptococcus_phage(18.18%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287651.1\|2612524_2614465_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.3e-114	35.2
WP_002287653.1\|2614688_2615537_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002296946.1\|2615830_2617984_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_002296623.1\|2618205_2619501_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002296740.1\|2619680_2620490_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002295362.1\|2620782_2622219_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.8e-43	29.0
WP_002290958.1\|2622388_2623585_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_002295359.1\|2623646_2623832_-	YjzD family protein	NA	NA	NA	NA
WP_002311576.1\|2624062_2627377_+	DNA polymerase III subunit alpha	R4TB75	Streptomyces_phage	1.8e-149	33.0
WP_002304759.1\|2627544_2628507_+	6-phosphofructokinase	NA	NA	NA	NA
WP_002295355.1\|2628580_2630365_+	pyruvate kinase	NA	NA	NA	NA
WP_002295354.1\|2630399_2631302_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002295352.1\|2631487_2632057_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_002290970.1\|2632114_2632294_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_002295350.1\|2632463_2633885_+	NADP-dependent phosphogluconate dehydrogenase	A0A1D8KPW3	Synechococcus_phage	4.2e-34	31.1
WP_002290973.1\|2634077_2634764_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-28	31.2
WP_002298265.1\|2634760_2636266_+	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	3.9e-06	25.1
WP_002322034.1\|2638687_2638885_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|2643644_2644940_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002326809.1\|2645297_2646593_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002288809.1\|2646784_2647660_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002288811.1\|2647763_2648528_+	carbohydrate deacetylase	NA	NA	NA	NA
WP_002288812.1\|2648544_2649957_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002303716.1\|2649973_2651299_+	maltose-6'-phosphate glucosidase	NA	NA	NA	NA
WP_002288815.1\|2651311_2651770_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002288817.1\|2652061_2653363_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002295336.1\|2653389_2653650_+	diacylglycerol kinase	NA	NA	NA	NA
WP_002303719.1\|2654164_2654353_+	hypothetical protein	NA	NA	NA	NA
WP_002288819.1\|2654648_2655884_-	glycosyl transferase	NA	NA	NA	NA
WP_002288821.1\|2656451_2657279_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002288823.1\|2657551_2658322_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002288825.1\|2658539_2659607_+	L-ascorbate 6-phosphate lactonase	NA	NA	NA	NA
WP_002295331.1\|2659624_2660086_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002288827.1\|2660105_2661590_+	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_002288830.1\|2661632_2661932_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002288832.1\|2661946_2662585_+	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	NA	NA	NA	NA
WP_002289048.1\|2662589_2663450_+	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_002295327.1\|2663439_2664150_+	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_002289050.1\|2664381_2664816_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289065.1\|2664912_2665212_-	hypothetical protein	NA	NA	NA	NA
WP_002289063.1\|2665480_2665675_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|2665831_2667010_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002297183.1\|2668466_2670329_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002291790.1\|2670328_2670661_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002287107.1\|2670803_2672054_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002288314.1\|2672463_2672820_+	hypothetical protein	NA	NA	NA	NA
WP_002288312.1\|2672835_2673186_+	DUF4312 family protein	NA	NA	NA	NA
WP_002288309.1\|2673214_2673994_+	DUF4311 domain-containing protein	NA	NA	NA	NA
WP_002296962.1\|2674004_2674682_+	DUF4310 family protein	NA	NA	NA	NA
WP_002288305.1\|2674700_2675807_+	amidohydrolase/deacetylase family metallohydrolase	NA	NA	NA	NA
WP_002288304.1\|2675796_2676888_+	DgaE family pyridoxal phosphate-dependent ammonia lyase	NA	NA	NA	NA
WP_002288301.1\|2676900_2677641_+	KDGP aldolase family protein	NA	NA	NA	NA
WP_002296840.1\|2677810_2678998_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP040708

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

764 : 54084

Streptococcus_phage(52.94%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000122610.1\|764_2057_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_001059542.1\|2388_3357_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_001079843.1\|3349_4381_+	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
WP_000402348.1\|4386_4995_+	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
WP_000732308.1\|5422_6334_+	VanY-A/VanY-F/VanY-M family D-Ala-D-Ala carboxypeptidase	NA	NA	NA	NA
WP_000516404.1\|6486_6972_+	glycopeptide resistance protein VanZ-A	NA	NA	NA	NA
WP_000754864.1\|7258_7588_-	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	2.6e-16	44.6
WP_000629052.1\|7892_8222_+	hypothetical protein	NA	NA	NA	NA
WP_000312841.1\|8211_8499_+	hypothetical protein	NA	NA	NA	NA
WP_000017403.1\|8777_9341_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	2.3e-36	46.4
WP_000222572.1\|9983_10937_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_000443455.1\|10914_12390_+	RNA-directed DNA polymerase	Q2P9X6	Enterobacteria_phage	3.5e-68	34.8
WP_002354485.1\|14228_14915_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001232859.1\|15095_15512_-	hypothetical protein	NA	NA	NA	NA
WP_000353844.1\|15514_15799_-	hypothetical protein	NA	NA	NA	NA
WP_002311817.1\|16144_16390_+	hypothetical protein	NA	NA	NA	NA
WP_138816312.1\|16691_16763_-	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_002354485.1\|16821_17508_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001033544.1\|18308_18509_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_001120991.1\|18524_18704_+	hypothetical protein	NA	NA	NA	NA
WP_000388479.1\|18834_19104_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000588503.1\|19096_19354_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_001809248.1\|19991_20816_+	hypothetical protein	NA	NA	NA	NA
WP_001261742.1\|20980_21595_-	recombinase family protein	M9Q1K0	Clostridium_phage	3.8e-16	30.9
WP_000969590.1\|22044_23370_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	6.3e-101	44.0
WP_000568378.1\|23362_23713_+	hypothetical protein	NA	NA	NA	NA
WP_001021554.1\|23709_23889_+	hypothetical protein	NA	NA	NA	NA
WP_000026576.1\|24024_24315_+	hypothetical protein	NA	NA	NA	NA
WP_000101106.1\|24682_25471_+	ParA family protein	H7BUL8	unidentified_phage	4.7e-27	35.7
WP_000796719.1\|25457_25784_+	hypothetical protein	NA	NA	NA	NA
WP_000997689.1\|26132_27173_+	replication initiator protein A	NA	NA	NA	NA
WP_014748749.1\|27788_28475_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.0e-126	99.1
WP_001814874.1\|28614_28698_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001038792.1\|28822_29560_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_138816310.1\|29564_29756_+	hypothetical protein	E4ZFP9	Streptococcus_phage	2.9e-15	100.0
WP_002326809.1\|29823_31119_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.5
WP_000567888.1\|32375_32621_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_000228166.1\|32723_33593_+	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000662263.1\|33573_34308_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_001255866.1\|34340_35249_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000627290.1\|35245_35788_+	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001096887.1\|35880_36675_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_002354485.1\|37119_37806_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000599739.1\|38003_38609_+	cell filamentation protein	NA	NA	NA	NA
WP_000170424.1\|38624_39197_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_002360715.1\|39533_39773_+	hypothetical protein	NA	NA	NA	NA
WP_073120187.1\|39669_40242_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_086953888.1\|40342_41505_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_077828739.1\|41545_41929_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-12	45.5
WP_000199136.1\|41910_42165_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_001196543.1\|42357_42633_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|42604_43558_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1
WP_000947691.1\|44169_45663_+	replication protein RepR	NA	NA	NA	NA
WP_000053907.1\|45797_46094_+	replication control protein PrgN	NA	NA	NA	NA
WP_000222573.1\|46117_47077_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-32	36.1
WP_002354485.1\|47203_47890_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002354485.1\|48179_48866_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_001280781.1\|49566_50262_+	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_002305818.1\|50239_51394_+	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_000122610.1\|51491_52784_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_001059542.1\|53115_54084_+	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP040704

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040704_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040704_1

67305-67432

TypeV

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP040704_1

>merge|NZ_CP040704|1|67305-67432|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP040704|1|1|67305-67432|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040704.1\|WP_002311530.1\|74471_75590_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP040704.1\|WP_002311528.1\|74046_74448_+\|IS200/IS605-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP040704.1\|WP_108676098.1\|60783_61946_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP040704.1\|WP_002322486.1\|68739_69072_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040704.1\|WP_002340500.1\|58972_59932_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP040704.1\|WP_002297185.1\|62302_63598_+\|ISL3-like-element-ISEfa5-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP040704.1\|WP_002348862.1\|58702_58912_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040704.1\|WP_002311532.1\|76033_76789_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP040704.1\|WP_002290394.1\|64012_64330_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP040704.1\|WP_002313090.1\|60298_60640_+\|bacteriocin-immunity-protein	unknown	unknown	gnl\|CDD\|370205
NZ_CP040704.1\|WP_002340501.1\|57629_57809_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040704.1\|WP_002313084.1\|56978_57584_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP040704.1\|WP_002311527.1\|71909_73538_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP040704.1\|WP_002290397.1\|64330_64585_-\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NZ_CP040704.1\|WP_002313088.1\|60082_60298_+\|bacteriocin	unknown	unknown	gnl\|CDD\|366773
NZ_CP040704.1\|WP_002311521.1\|69690_70032_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP040704.1\|WP_002311526.1\|71185_71857_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP040704.1\|WP_002311523.1\|70050_70341_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040704.1\|WP_002311524.1\|70532_70766_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040704.1\|WP_002311533.1\|76785_77613_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237019

Protein	Function_ID	Function_description	E-value
NZ_CP040704.1\|WP_002311532.1\|76033_76789_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.06599e-60
NZ_CP040704.1\|WP_002311528.1\|74046_74448_+\|IS200/IS605-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	1.83008e-44
NZ_CP040704.1\|WP_108676098.1\|60783_61946_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	5.85297e-49
NZ_CP040704.1\|WP_002290394.1\|64012_64330_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP040704.1\|WP_002340500.1\|58972_59932_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.33474e-54
NZ_CP040704.1\|WP_002297185.1\|62302_63598_+\|ISL3-like-element-ISEfa5-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.08521e-63
NZ_CP040704.1\|WP_002311530.1\|74471_75590_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.49829e-52
NZ_CP040704.1\|WP_002313090.1\|60298_60640_+\|bacteriocin-immunity-protein	gnl\|CDD\|370205	pfam08951, EntA_Immun, Enterocin A Immunity. Gram-positive lactobacilli produce bacteriocins to kill closely-related competitor species. To protect themselves from the bacteriocidal activity of this molecule they co-express an immunity protein (for discussion of this operon see Bacteriocin_IIc pfam10439). The immunity protein structure is a soluble, cytoplasmic, antiparallel four alpha-helical globular bundle with a fifth, more flexible and more divergent C-terminal helical hair-pin. The C-terminal hair-pin recognizes the C-terminus of the producer bacteriocin and this interaction is sufficient to dis-orient the bacteriocin within the membrane and close up the permeabilising pore that on its own the bacteriocin creates. These immunity proteins interact in the same way with other bacteriocins, family Bacteriocin_II, pfam01721. Since many enterococci can produce more than one bacteriocin it seems likely that the whole operon can be carried on transferable plasmids.	8.23626e-05
NZ_CP040704.1\|WP_002311533.1\|76785_77613_+\|hypothetical-protein	gnl\|CDD\|237019	PRK11907, PRK11907, bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.	0.00482945
NZ_CP040704.1\|WP_002313084.1\|56978_57584_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.22326e-46
NZ_CP040704.1\|WP_002311527.1\|71909_73538_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.13339e-27
NZ_CP040704.1\|WP_002290397.1\|64330_64585_-\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.45571e-07
NZ_CP040704.1\|WP_002313088.1\|60082_60298_+\|bacteriocin	gnl\|CDD\|366773	pfam01721, Bacteriocin_II, Class II bacteriocin. The bacteriocins are small peptides that inhibit the growth of various bacteria. Bacteriocins of lactic acid bacteria may inhibit their target cells by permeabilising the cell membrane.	1.36604e-06
NZ_CP040704.1\|WP_002311521.1\|69690_70032_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	8.60138e-49
NZ_CP040704.1\|WP_002311526.1\|71185_71857_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	1.18165e-44

>NZ_CP040704.1|WP_002290397.1|64330_64585_-|AbrB-family-transcriptional-regulator
MGKELKVRKIGNSVGVILPSSLGLKSGDTIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP040704.1|WP_002290394.1|64012_64330_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP040704.1|WP_002297185.1|62302_63598_+|ISL3-like-element-ISEfa5-family-transposase
MNDSIKKMLRLIEKDLMITEVSYETFQKKKTLIVDAVFSPAPHTCRNCGSTVVDGNGKVIVVKNGKKETIVRFEQYNHMPLVMRLKKQRYTCKNCRTHWTAQSYFVQPRHSIANHVRYKIASLLTEKVSLSFIAKNCQVSLTTVIRTLKEFKSYLPKQSKRILPRVLMVDEFRSHASIEDKMSFICADGETGQLIDVLPTRKLPRLTSYFLGCANPEEVKFLVTDMNAAYFQLTKRILPNAKVVIDRFHIIKHMNQAFNELRIREMNELRKVGQKSQAEKLKKNWRFLLKNRANINHYEYKTWKSFRAPKYPFLTEAMMIDRLLGFSTSLKEAYPYFHELVEAFRDKDPDLFFSLLAELPETLDDGFREKLQNLLTYEEGITNAMIYPYTNGKIEAKNTHIKTMKRVSYGFKSFENMRIRIFLINQLIKVR
>NZ_CP040704.1|WP_108676098.1|60783_61946_-|IS3-family-transposase
MSKRTRRTFSQEFKQQIVNLYLAGKPRVEIIREYELTASAFDKWVKQSKTSSSFKEKDNLTPEQKELLELRKRNQQLEMENDILKQAALIFGPKRQVIDANKHLYPISAMCRILGLSRQSYYYQSKPKKDESELEEVVAEEFIRSRKAYGSRKIKKALSKRGIQISRRKISRIMKNRGLKSSYTVAYFKVHHSTCNEAKTTNVLNRKFLRDNPLEAIVTDLTYVRVGKKWNYVCFILDLFNREILGYSCGEHKDAVLVKKAFSRIKQPLTEVEIFHTDRGKEFDNQAIDELLTTFDINRSLSHKGCPFDNAVAESTYKSLKVEFVYQYTFETLQQLDLELFDYVNWWNHLRLHGTLGYETPVGYRNQRLAQRILDNELGCANASEAV
>NZ_CP040704.1|WP_002313090.1|60298_60640_+|bacteriocin-immunity-protein
MIDIRETKKIIHELYNSLMKRDKTKAILDITDVLLQVYKKIDSEKYPEILINKLVNYIYIVGFDNKIHFLGNDEKLLIELGDISKKAGINSKYKANFTDKSQFYSYSEKVPIR
>NZ_CP040704.1|WP_002313088.1|60082_60298_+|bacteriocin
MKKKLVKGSVICSMIGIGFIVIGTNVEAATYYGNGVYCNKQKCWVNWGQAWSKGVKRWGDNLFGSFSGGRI
>NZ_CP040704.1|WP_002340500.1|58972_59932_-|IS30-family-transposase
MTYTHLTTDELVMIESYFKINQSVAKTAHCLNRSRQTIHKVYLFFKQGKSALEYYQQYKKNKSNCGGRPLVLPEEQSEYIQRKVVQGWTPDVIVGRAAFPIRCSARTIYRMFKKGLFNPSDLPMKGKRKPNGHQERRGKQAFRRSIHEREKDYSQFSNEFGHLEGDTIVGLKHKSAVITLVERLSKVIITLKPCGRQAIDIENKLNHWFESVPKNLFKSITFDCGKEFSNWKQISNANDIAIYFADPGTPSQRGLNENSNGLLRRDGLLKSMDFNSVDEFFIQSVASKRNNIPRKSLDYRTPLEVFLSYVSIDDLSNLI
>NZ_CP040704.1|WP_002348862.1|58702_58912_-|hypothetical-protein
MICYISFLILGLPQAVFPEMFSGDWGIVSYSILTLIAMVLGTSFYNAFVSKHVEEYEVLMYLKEKKTSN
>NZ_CP040704.1|WP_002340501.1|57629_57809_-|hypothetical-protein
MTELTADMSDTWLQEYLFPEKQTTARGYLPVDWEYVHKELMKKNMTLKLLHREYGVHGT
>NZ_CP040704.1|WP_002313084.1|56978_57584_+|recombinase-family-protein
MAKIGYIRVSSQDQNLDRQLAMMEDLNIDKLFQEKASGKDIQRPEFQKLLNYIREGDCVIVASLDRLGRDYEDIKNTVTFMKQKKVALKILDAQFLDFNTGNELLDTAMFDMFLSLLSYIAQNEREKIRERQRQGVLLAKKAGRYKGRPIEYSENSTDPQKRLVFKTVVDMLNQGVPVAEIAKENGLSRPTIYKIKKANDL
>NZ_CP040704.1|WP_002322486.1|68739_69072_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP040704.1|WP_002311521.1|69690_70032_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALNEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP040704.1|WP_002311523.1|70050_70341_+|hypothetical-protein
MKFFEVKSPYYYALIAAKNEEECAELYEQVVTDIENREEFIRCLHELNRNEAIQEDAKKISEETLQPIGMEEATKDIFTIIDEQKSCVLSIDSTLV
>NZ_CP040704.1|WP_002311524.1|70532_70766_+|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWREHNGIKDLKPARPVIRRKKLKK
>NZ_CP040704.1|WP_002311526.1|71185_71857_+|class-A-sortase
MKKWLFGFLGVALIVFCSVFGYVSYQKHEGDVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTCKFIVSEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP040704.1|WP_002311527.1|71909_73538_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAEKANIKVTNNDGSVVLKENTDYKIENSDSGFVIDFIVNNGQVSDTVANLHGQDLKMTYNMFVNDSAEIANPLTNSVDFVYSNNPFNQEEHHEKTKADAVTYGAKFLKADGGLFGTGIKATPLEGAEFAAKNAEGKYYSFCGR
>NZ_CP040704.1|WP_002311528.1|74046_74448_+|IS200/IS605-family-transposase
MDNEYRYSKTTVSLVNYHFVFCPRYRRKIFVNSEVDARFKALVQEIAKENEWNIIAIETDKDHCHLLINVQPTYSPSKIMKIIKGKTSSIIRQEFEHLSKMPSVWTRSYFVSTAGNVSSEIIKRYVENQRTRY
>NZ_CP040704.1|WP_002311530.1|74471_75590_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MKKAHKIRIYPNCRQEIQFQKTFGCVRFYWNFLLDQRITNYKKKKENADYKEDKTTYASLKKMEEYAWLKEVEAQPLSQVAMDLNKAFKNTFNSTFGFPKFKSKKYSKKSYRTAMGIKVNRNYFYVSKVGWVKMAETLRFNGKLMNVTISQSKTEKYFATFLVDIENFQKDPVTESIGLDLGLTHFCITSAGEKIGNERFYRSLEKRLVVEQRKLSRRLEVAKKHNRKLEECKNYQKQRVKVARIHEKIFNQRNDFLHKLSSRITDENQIICIEDLNVTGMVRNHKLAKSIADVSWSEFVRQLTYKCEWKGRTLVKIDRFYPSSQICSSCGHNDGKKELDIREWTCSNCGTNHDRDINASINIRTEGLSGIA
>NZ_CP040704.1|WP_002311532.1|76033_76789_+|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPVVETNVAKFQQKQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSEKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFAFLLFLFIKKIRRRSE
>NZ_CP040704.1|WP_002311533.1|76785_77613_+|hypothetical-protein
MNKRKWLFVCVAALFATAAYSQISFADSSTTPTTSQTTDSSTTATSDTDSSKNTAEETADSSTSSTESAESTSESSSETSEKLQEVEDTQVIKQNIHIQKIISSNRINNQGRQVAHQEGVNGAKFIVYDITNILEEMTQDDNEKNQSVEIIESKLKDRAKKLSYDQLKKVTEGETKTIDDQEGVIDFSIEVPANKKQAYYIVNESSPENISNSEDIILLTPISDEKGEFLTDVWLYPKSKKSEPKEEIKKVVSTGVKKNFFDNCWDFFTHLFFND

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.2\|67391\|19\|NZ_CP040704\|CRISPRCasFinder	67391-67409	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP040704_1	1.1\|67328\|40\|NZ_CP040704\|CRISPRCasFinder	67328-67367	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|67391|19|NZ_CP040704|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|67328|40|NZ_CP040704|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 45235

Streptococcus_phage(26.32%)

transposase,integrase

attL 3149:3167|attR 46222:46240

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002351511.1\|266_503_-	addiction module antitoxin	NA	NA	NA	NA
WP_002351510.1\|639_873_-	hypothetical protein	NA	NA	NA	NA
WP_002351509.1\|857_1460_-	hypothetical protein	NA	NA	NA	NA
WP_002351507.1\|2322_2511_-	hypothetical protein	NA	NA	NA	NA
WP_002340535.1\|2531_2744_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002340534.1\|2733_3129_+	hypothetical protein	NA	NA	NA	NA
3149:3167	attL	NA	NA	NA	NA
WP_002340533.1\|3221_3902_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-110	84.5
WP_002340532.1\|3984_4602_+	hypothetical protein	NA	NA	NA	NA
WP_002340531.1\|4765_5098_+	hypothetical protein	NA	NA	NA	NA
WP_002351685.1\|5162_5384_+	hypothetical protein	NA	NA	NA	NA
WP_002340530.1\|5421_5583_+	hypothetical protein	NA	NA	NA	NA
WP_111944786.1\|5614_6295_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	83.6
WP_002340528.1\|6292_6571_-	hypothetical protein	NA	NA	NA	NA
WP_002339787.1\|6729_6996_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002339788.1\|6985_7342_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002340527.1\|7424_8204_-	abortive infection family protein	NA	NA	NA	NA
WP_002340526.1\|8217_8934_-	Fic family protein	NA	NA	NA	NA
WP_002340525.1\|8982_9582_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	4.2e-28	35.6
WP_002351732.1\|10533_11130_-	YdhK family protein	NA	NA	NA	NA
WP_002307659.1\|11150_11357_-	hypothetical protein	NA	NA	NA	NA
WP_002351733.1\|11371_12421_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.2e-39	32.8
WP_002340523.1\|12417_12765_-	hypothetical protein	NA	NA	NA	NA
WP_071974500.1\|12948_13137_+	hypothetical protein	NA	NA	NA	NA
WP_098049569.1\|13120_14283_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.0e-78	50.9
WP_002301358.1\|14793_15336_-	hypothetical protein	NA	NA	NA	NA
WP_002307628.1\|15648_16200_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	2.9e-31	41.7
WP_002340522.1\|16492_18424_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.2e-97	36.9
WP_002320191.1\|18722_19037_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002340521.1\|19078_19987_+	cation transporter	NA	NA	NA	NA
WP_002340520.1\|20088_20700_-	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_002340519.1\|20716_21079_-	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	1.4e-15	41.3
WP_002307621.1\|21388_23293_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.7e-99	35.5
WP_002292161.1\|23490_23724_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002340518.1\|23870_24725_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_025476824.1\|24876_25584_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002307615.1\|25768_26341_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	3.9e-23	42.6
WP_002340516.1\|26875_28066_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.3e-22	26.6
WP_138816284.1\|28510_29419_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002329978.1\|30250_30565_-	hypothetical protein	NA	NA	NA	NA
WP_002340513.1\|30731_33722_-	DEAD/DEAH box helicase family protein	A0A2K5B2C2	Erysipelothrix_phage	0.0e+00	70.7
WP_002340512.1\|33742_35587_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	3.0e-165	51.6
WP_002351807.1\|35614_36337_-	DUF4391 family protein	A0A2K5B2C0	Erysipelothrix_phage	5.9e-69	51.3
WP_002340510.1\|36337_39595_-	DEAD/DEAH box helicase family protein	A0A2K5B2B9	Erysipelothrix_phage	0.0e+00	80.7
WP_002340509.1\|39643_39844_-	helix-turn-helix transcriptional regulator	A0A2K5B261	Erysipelothrix_phage	3.1e-12	55.6
WP_002340507.1\|41683_42811_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	3.2e-13	32.9
WP_002295679.1\|42840_43569_-	peptidase	A0A1B0T6A2	Bacillus_phage	3.1e-09	26.1
WP_002292681.1\|43828_44377_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|44377_45235_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
46222:46240	attR	NA	NA	NA	NA

DBSCAN-SWA_2

54972 : 178880

118

Streptococcus_phage(23.68%)

holin,transposase,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010729506.1\|54972_55944_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-05	22.4
WP_002313084.1\|56978_57584_+	recombinase family protein	A0A219YA40	Aeromonas_phage	3.6e-19	32.6
WP_002340501.1\|57629_57809_-	hypothetical protein	NA	NA	NA	NA
WP_002348862.1\|58702_58912_-	hypothetical protein	NA	NA	NA	NA
WP_002340500.1\|58972_59932_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.7e-32	35.8
WP_002313088.1\|60082_60298_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_002313090.1\|60298_60640_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_108676098.1\|60783_61946_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002297185.1\|62302_63598_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.8
WP_002290394.1\|64012_64330_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002290397.1\|64330_64585_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002295675.1\|66875_67916_+	replication protein RepA	NA	NA	NA	NA
WP_002322486.1\|68739_69072_+	hypothetical protein	NA	NA	NA	NA
WP_002311521.1\|69690_70032_+	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	3.1e-36	63.4
WP_002311523.1\|70050_70341_+	hypothetical protein	NA	NA	NA	NA
WP_002311524.1\|70532_70766_+	hypothetical protein	NA	NA	NA	NA
WP_002311526.1\|71185_71857_+	class A sortase	NA	NA	NA	NA
WP_002311527.1\|71909_73538_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002311528.1\|74046_74448_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	6.9e-43	62.4
WP_002311530.1\|74471_75590_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A286QMQ9	Streptococcus_phage	1.1e-95	50.8
WP_002311532.1\|76033_76789_+	class C sortase	NA	NA	NA	NA
WP_002311533.1\|76785_77613_+	hypothetical protein	NA	NA	NA	NA
WP_002311534.1\|77622_77871_+	hypothetical protein	NA	NA	NA	NA
WP_002349469.1\|77901_80013_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002311537.1\|80048_82100_-\|protease	serine protease	NA	NA	NA	NA
WP_002311538.1\|82219_82429_-	hypothetical protein	NA	NA	NA	NA
WP_000222572.1\|82764_83718_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_137217503.1\|83695_84142_+	hypothetical protein	NA	NA	NA	NA
WP_002307547.1\|84138_84381_+	DUF5415 family protein	NA	NA	NA	NA
WP_002295662.1\|84398_84701_+	hypothetical protein	NA	NA	NA	NA
WP_002311542.1\|84770_86825_+	hypothetical protein	NA	NA	NA	NA
WP_002378383.1\|86824_89434_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_002340494.1\|89430_91827_+	hypothetical protein	NA	NA	NA	NA
WP_002340493.1\|91878_92211_+	hypothetical protein	NA	NA	NA	NA
WP_002340492.1\|92211_92805_+	hypothetical protein	NA	NA	NA	NA
WP_002340490.1\|92967_94992_+	hypothetical protein	NA	NA	NA	NA
WP_002323679.1\|94991_96197_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	1.1e-32	42.4
WP_002340489.1\|96212_96857_+	hypothetical protein	NA	NA	NA	NA
WP_002311549.1\|96867_97674_+	hypothetical protein	NA	NA	NA	NA
WP_002340488.1\|97696_97927_+	hypothetical protein	NA	NA	NA	NA
WP_002340487.1\|98044_99004_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.1e-35	36.7
WP_002311551.1\|99497_99785_+	hypothetical protein	NA	NA	NA	NA
WP_002311552.1\|99802_100225_+	hypothetical protein	NA	NA	NA	NA
WP_033583488.1\|100244_101837_+	hypothetical protein	NA	NA	NA	NA
WP_002316755.1\|102092_102287_+	hypothetical protein	NA	NA	NA	NA
WP_002287107.1\|102422_103673_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002311557.1\|104082_106455_+	hypothetical protein	B5SP25	Lactococcus_phage	1.1e-10	28.9
WP_002353044.1\|106515_107976_+	hypothetical protein	NA	NA	NA	NA
WP_002301799.1\|109964_110096_+	hypothetical protein	NA	NA	NA	NA
WP_002299811.1\|110341_110938_+	transcriptional regulator	NA	NA	NA	NA
WP_002311562.1\|110950_111850_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002295625.1\|112358_112616_+	hypothetical protein	NA	NA	NA	NA
WP_002311565.1\|112774_112909_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295623.1\|113051_113312_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002295619.1\|113760_113967_+	hypothetical protein	NA	NA	NA	NA
WP_002293542.1\|113966_114218_+	hypothetical protein	NA	NA	NA	NA
WP_002311567.1\|114233_114671_+	hypothetical protein	NA	NA	NA	NA
WP_033795402.1\|114890_115091_+	hypothetical protein	NA	NA	NA	NA
WP_002293546.1\|115351_115747_+	hypothetical protein	NA	NA	NA	NA
WP_002314432.1\|115728_115995_+	hypothetical protein	NA	NA	NA	NA
WP_002340480.1\|116004_116238_+	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_002335346.1\|116580_116763_+	hypothetical protein	NA	NA	NA	NA
WP_002340479.1\|116752_116974_+	hypothetical protein	NA	NA	NA	NA
WP_086956687.1\|117014_118176_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002290556.1\|118967_119735_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002290555.1\|120223_120649_+	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_002290554.1\|120665_121181_+	galactose-6-phosphate isomerase subunit LacB	A0A222YX14	Synechococcus_phage	3.3e-05	36.0
WP_002340477.1\|121191_122124_+	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_002378516.1\|122126_122666_+	tagatose 1,6-diphosphate aldolase	NA	NA	NA	NA
WP_002354485.1\|122688_123375_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000751236.1\|123499_123952_+	hypothetical protein	NA	NA	NA	NA
WP_000718009.1\|123965_124655_+	hypothetical protein	NA	NA	NA	NA
WP_000344083.1\|124779_127131_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_002304891.1\|127210_127606_+	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|127930_128548_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_000366408.1\|128588_128888_+	hypothetical protein	NA	NA	NA	NA
WP_000824191.1\|128921_129089_+	hypothetical protein	NA	NA	NA	NA
WP_002321606.1\|129133_129739_-	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-19	33.2
WP_000343406.1\|129863_132851_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.3e-206	38.3
WP_029756604.1\|133501_133858_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	3.4e-25	60.9
WP_005228365.1\|134371_134539_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	8.1e-14	64.0
WP_002354485.1\|134948_135635_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000713874.1\|136969_137344_-\|bacteriocin	lactococcin 972 family bacteriocin	NA	NA	NA	NA
WP_002324322.1\|137756_138935_-\|transposase	IS256-like element ISEfm2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-29	24.9
WP_002302078.1\|140673_142113_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002302077.1\|142114_143077_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_086953894.1\|143246_144673_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|144915_145371_+\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_002325009.1\|145391_145625_+	hypothetical protein	NA	NA	NA	NA
WP_002289255.1\|145956_146187_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|146416_147235_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|147395_148085_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|148098_149601_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002300328.1\|149613_150090_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_086956687.1\|150587_151750_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002322543.1\|152015_152207_-	fructokinase	NA	NA	NA	NA
WP_002305874.1\|152252_152501_-	hypothetical protein	NA	NA	NA	NA
WP_002287870.1\|152867_153386_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002313170.1\|153728_153932_+	hypothetical protein	NA	NA	NA	NA
WP_002301591.1\|155461_156547_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_002286097.1\|156654_157608_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.8e-34	35.8
WP_002301126.1\|157738_158989_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298736.1\|159007_159934_-	PEP phosphonomutase	NA	NA	NA	NA
WP_002301128.1\|160012_161008_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002301130.1\|161023_162193_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002301131.1\|162208_162943_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_087043335.1\|163713_164876_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.2e-79	51.3
WP_002297185.1\|166889_168185_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.8
WP_002287522.1\|168580_168985_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002287525.1\|169001_170150_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002313174.1\|170423_170684_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|170839_172018_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002300494.1\|172107_173427_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|173423_174077_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002364827.1\|174138_174279_-	hypothetical protein	NA	NA	NA	NA
WP_002348630.1\|175216_175933_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.5e-45	50.0
WP_002302256.1\|175982_176192_-	hypothetical protein	NA	NA	NA	NA
WP_002302261.1\|177848_178880_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6

DBSCAN-SWA_3

185931 : 205242

Streptococcus_phage(25.0%)

transposase,integrase

attL 195315:195374|attR 201840:202085

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002330696.1\|185931_187554_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-122	47.5
WP_002298085.1\|187839_189216_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|189215_189872_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|189881_191159_-	ABC transporter permease	NA	NA	NA	NA
WP_111944785.1\|191408_192570_+\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
WP_010706480.1\|193207_193558_-	hypothetical protein	NA	NA	NA	NA
WP_115250354.1\|194024_195186_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.9e-79	53.8
195315:195374	attL	NA	NA	NA	NA
WP_002305938.1\|195657_195864_-	hypothetical protein	NA	NA	NA	NA
WP_002305939.1\|196001_196961_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.5e-32	33.9
WP_002305121.1\|196947_197553_-	hypothetical protein	NA	NA	NA	NA
WP_002343836.1\|197792_198941_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	3.9e-200	90.8
WP_002287522.1\|198957_199362_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002303574.1\|199610_200165_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	6.6e-36	46.7
WP_085807902.1\|200629_201583_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.0e-11	29.0
WP_000997695.1\|201705_202884_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
201840:202085	attR	NA	NA	NA	NA
WP_010729766.1\|203973_204585_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.9e-99	84.7
WP_002351514.1\|204645_205242_+	recombinase family protein	M9Q1K0	Clostridium_phage	2.9e-13	31.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040706

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP040708

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP040704

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection