CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP040697	Citrobacter freundii strain R47 plasmid pR47-54, complete sequence	0 crisprs	RT	0	1
NZ_CP040698	Citrobacter freundii strain R47 chromosome R47, complete sequence	1 crisprs	RT,csa3,PD-DExK,cas3,DEDDh,WYL,DinG	1	9
NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	0 crisprs	NA	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4071 : 40208

Escherichia_phage(36.84%)

integrase,transposase

attL 4812:4828|attR 28640:28656

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067784.1\|4071_4776_+\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	1.9e-120	85.8
4812:4828	attL	NA	NA	NA	NA
WP_046788546.1\|4860_5262_-	hypothetical protein	NA	NA	NA	NA
WP_015344976.1\|5270_8222_-\|transposase	Tn3-like element TnAs3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.5
WP_000147567.1\|8224_8785_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
WP_000993245.1\|8910_9123_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001446012.1\|9085_9205_+	hypothetical protein	NA	NA	NA	NA
WP_001087807.1\|9188_9425_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001277466.1\|9421_9787_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000209296.1\|9804_11490_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
WP_000522996.1\|11528_11954_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_000732275.1\|11981_12257_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_004200999.1\|12272_12638_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|12709_13165_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001776119.1\|13424_13952_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	5.7e-21	39.5
WP_001776120.1\|13984_14416_-	hypothetical protein	NA	NA	NA	NA
WP_001776122.1\|14895_15861_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	1.6e-58	42.7
WP_032419551.1\|16068_16338_-	hypothetical protein	NA	NA	NA	NA
WP_004152765.1\|16330_17815_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_009483812.1\|17814_18066_-	hypothetical protein	NA	NA	NA	NA
WP_000776034.1\|18223_18655_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.6e-29	53.3
WP_004118291.1\|18654_19926_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	4.9e-151	63.3
WP_012600007.1\|20007_20985_-	ParB/RepB/Spo0J family partition protein	Q38420	Escherichia_phage	2.6e-88	54.4
WP_000368714.1\|20981_22187_-	ParA family protein	A0A077SL49	Escherichia_phage	2.4e-163	69.6
WP_000339857.1\|22601_22871_+	hypothetical protein	NA	NA	NA	NA
WP_100115263.1\|22903_23101_-	hypothetical protein	NA	NA	NA	NA
WP_004118283.1\|23227_24094_-	replication initiation protein	A0A222YYK1	Escherichia_phage	1.5e-23	31.1
WP_000764642.1\|24861_25119_+	hypothetical protein	NA	NA	NA	NA
WP_138827844.1\|25176_25956_-\|integrase	tyrosine-type recombinase/integrase	I3WFA4	Macacine_betaherpesvirus	6.4e-53	92.9
WP_077250520.1\|25952_26765_-	hypothetical protein	NA	NA	NA	NA
WP_052433691.1\|26828_27128_-	hypothetical protein	NA	NA	NA	NA
WP_138827845.1\|27332_27719_-	hypothetical protein	NA	NA	NA	NA
WP_001261282.1\|27702_27933_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_016236302.1\|27929_28346_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_001348075.1\|28419_28656_+	AAA family ATPase	NA	NA	NA	NA
28640:28656	attR	NA	NA	NA	NA
WP_001067855.1\|28702_29407_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_138827846.1\|29352_29637_-	hypothetical protein	NA	NA	NA	NA
WP_011977766.1\|29809_30145_+	C2H2-type zinc finger protein	NA	NA	NA	NA
WP_032445200.1\|30695_30884_+	hypothetical protein	NA	NA	NA	NA
WP_001327128.1\|31367_31562_-	hypothetical protein	NA	NA	NA	NA
WP_000807690.1\|31562_32318_-	replication initiation protein RepE	I3WF20	Macacine_betaherpesvirus	4.5e-136	96.0
WP_000861580.1\|33329_33521_-	hypothetical protein	NA	NA	NA	NA
WP_001039463.1\|33529_33916_-	hypothetical protein	NA	NA	NA	NA
WP_071549086.1\|34461_34722_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|34667_35372_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_071549088.1\|35396_35909_+	restriction endonuclease	NA	NA	NA	NA
WP_001749967.1\|35913_36120_+	hypothetical protein	NA	NA	NA	NA
WP_001288432.1\|36501_37935_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
WP_001749969.1\|37968_39177_-	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_024139167.1\|39189_39402_-	hypothetical protein	NA	NA	NA	NA
WP_001389365.1\|39443_40208_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP040698

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040698_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040698_1

3423184-3423307

Orphan

Consensus_repeat	Method
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040698_1

>merge|NZ_CP040698|1|3423184-3423307|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTACGGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAACGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

>NZ_CP040698|1|1|3423184-3423307|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CGGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAA
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040698.1\|WP_138828458.1\|3419481_3420537_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238562
NZ_CP040698.1\|WP_138828461.1\|3422263_3422986_-\|solute-binding-protein	unknown	unknown	gnl\|CDD\|270259
NZ_CP040698.1\|WP_138828460.1\|3421524_3422277_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP040698.1\|WP_049002814.1\|3411306_3412734_+\|gamma-aminobutyraldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143411
NZ_CP040698.1\|WP_138828455.1\|3415204_3416413_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|379187
NZ_CP040698.1\|WP_138828468.1\|3429771_3430068_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040698.1\|WP_043016519.1\|3424734_3424950_-\|DUF1233-family-excisionase	unknown	unknown	gnl\|CDD\|369087
NZ_CP040698.1\|WP_138828453.1\|3412745_3413219_+\|ester-cyclase	unknown	unknown	gnl\|CDD\|377824
NZ_CP040698.1\|WP_138828459.1\|3420523_3421528_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP040698.1\|WP_138828465.1\|3426587_3427748_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377617
NZ_CP040698.1\|WP_048997921.1\|3427744_3427948_-\|ANR-family-transcriptional-regulator	unknown	unknown	unknown
NZ_CP040698.1\|WP_043016516.1\|3429498_3429711_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040698.1\|WP_138828466.1\|3428218_3428821_-\|3'-5'-exoribonuclease	unknown	unknown	gnl\|CDD\|374562
NZ_CP040698.1\|WP_138828454.1\|3413308_3415201_+\|NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|379192
NZ_CP040698.1\|WP_138828462.1\|3423463_3424735_-\|DUF3596-domain-containing-protein	unknown	unknown	gnl\|CDD\|271189
NZ_CP040698.1\|WP_138828456.1\|3416456_3417932_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|224089
NZ_CP040698.1\|WP_138828457.1\|3418038_3419301_+\|4-aminobutyrate-transaminase	unknown	unknown	gnl\|CDD\|182078
NZ_CP040698.1\|WP_138828467.1\|3428827_3429055_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040698.1\|WP_138828463.1\|3425235_3425484_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040698.1\|WP_138828464.1\|3425775_3426579_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040698.1\|WP_138828458.1\|3419481_3420537_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238562	cd01142, TroA_e, Periplasmic binding protein TroA_e. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	6.53396e-82
NZ_CP040698.1\|WP_138828461.1\|3422263_3422986_-\|solute-binding-protein	gnl\|CDD\|270259	cd13541, PBP2_ModA_like_2, Substrate binding domain of molybdate-binding proteins;the type 2 periplasmic binding protein fold. This subfamily contains domains found in ModA proteins of putative ABC-type transporter. ModA proteins serve as initial receptors in the ABC transport of molybdate in eubacteria and archaea. Bacteria and archaea import molybdenum and tungsten from the environment in the form of the oxyanions molybdate (MoO(4) (2-)) and tungstate (WO(4) (2-)). After binding molybdate and tungstate with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ModA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.64517e-89
NZ_CP040698.1\|WP_138828460.1\|3421524_3422277_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	4.98836e-79
NZ_CP040698.1\|WP_049002814.1\|3411306_3412734_+\|gamma-aminobutyraldehyde-dehydrogenase	gnl\|CDD\|143411	cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like. NAD+-dependent, tetrameric, gamma-aminobutyraldehyde dehydrogenase (ABALDH), YdcW of Escherichia coli K12, catalyzes the oxidation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ABALDH can also oxidize n-alkyl medium-chain aldehydes, but with a lower catalytic efficiency.	0
NZ_CP040698.1\|WP_138828455.1\|3415204_3416413_+\|c-type-cytochrome	gnl\|CDD\|379187	pfam13442, Cytochrome_CBB3, Cytochrome C oxidase, cbb3-type, subunit III.	3.68763e-10
NZ_CP040698.1\|WP_043016519.1\|3424734_3424950_-\|DUF1233-family-excisionase	gnl\|CDD\|369087	pfam06806, DUF1233, Putative excisionase (DUF1233). This family consists of several putative phage excisionase proteins of around 80 residues in length.	5.38056e-21
NZ_CP040698.1\|WP_138828453.1\|3412745_3413219_+\|ester-cyclase	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	9.80895e-20
NZ_CP040698.1\|WP_138828459.1\|3420523_3421528_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.28123e-81
NZ_CP040698.1\|WP_138828465.1\|3426587_3427748_-\|hypothetical-protein	gnl\|CDD\|377617	pfam06156, YabB, Initiation control protein YabA. YabA is involved in initiation control of chromosome replication. It interacts with both DnaA and DnaN, acting as a bridge between these two proteins.	5.25566e-05
NZ_CP040698.1\|WP_138828466.1\|3428218_3428821_-\|3'-5'-exoribonuclease	gnl\|CDD\|374562	pfam16473, DUF5051, 3' exoribonuclease, RNase T-like. This is a highly divergent 3' exoribonuclease family. The proteins constitute a typical RNase fold, where the active site residues form a magnesium catalytic centre. The protein of the solved structure readily cleaves 3' overhangs in a time-dependent manner. It is similar to DEDD-type RNases and is an unusual ATP-binding protein that binds ATP and dATP. It forms a dimer in solution and both protomers in the asymmetric unit bind a magnesium ion through Asp-6 in UniProtKB:P9WJ73.	2.88505e-25
NZ_CP040698.1\|WP_138828454.1\|3413308_3415201_+\|NAD(P)-binding-protein	gnl\|CDD\|379192	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain.	2.67302e-06
NZ_CP040698.1\|WP_138828462.1\|3423463_3424735_-\|DUF3596-domain-containing-protein	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.38337e-32
NZ_CP040698.1\|WP_138828456.1\|3416456_3417932_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.53596e-139
NZ_CP040698.1\|WP_138828457.1\|3418038_3419301_+\|4-aminobutyrate-transaminase	gnl\|CDD\|182078	PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional.	0

>NZ_CP040698.1|WP_138828461.1|3422263_3422986_-|solute-binding-protein
MPSSILLFAAGSLRPAFTPLISQFTRMSGIDVKVEYGPAGLLRDRIEAGEPCALFASANREHPQNLLVRNKAVSTHTFCWNKLSLVSNRIGTWLDLLRDPTLRPGTSTPGCDPSGDYTWAFFDNMDVLEPGLGRQLRARAIPLVGGRDTVKIPQGELASAWILRQGLADLFIGYAHYAHALHAMTDVHYVAIPDEHNICCEYQLAVLDASKEVMALVEFILSRSGQAFLTAAGFLPLNAE
>NZ_CP040698.1|WP_138828460.1|3421524_3422277_+|ATP-binding-cassette-domain-containing-protein
MIPAALRVNQLSYGYRAPLFEPLTFCCQKGDIWAVLGRNGLGKSTLLDTLTGTLPALGGSIENNGGIGIVAQHSHLPFPYTVSDVVLMGRAQHVKLFAQPSQQDQQRAMQALEPLSIAHLASSSFGSLSGGQQQLVMIARALVTECQTLLLDEPCSALDLANQQVVLQLISDLAHQQGCSILFSTHDPLHALQVASHTLLLLPEGKWRAGPTNSIVTEENLFLAYGLPLRKLSVENHPTPFIAPLFSIRR
>NZ_CP040698.1|WP_138828459.1|3420523_3421528_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MQLSNRFLPQQPLLIVVVLLLGVSSLCLGQYPLSLSEVFYHLTHYSDVGGIASQVIWTVRLPRILMALLAGGALGLCGATLQGVFHNPLVDPHIIGVTSGAAFGGTLAILLGLSPLLMMGSTFFFGLTALILVYVIAALQGLENTLVLILSGIILSGFFAALVSLIQYQADTEETLPNIVFWLLGSFATANWHKVLLLAVPVGIAATVLFQLRWRINLLSLNDKDARALGVAVVPLRRSVLVCCAFLVAAQVAVSGSIAWVGLVIPHLARLLVGVDHRRLLPCAFWLGGGFMIVVDDIARTLMHAEIPLGIITALFGAPLFAFLLIRTSRREKS
>NZ_CP040698.1|WP_138828458.1|3419481_3420537_+|ABC-transporter-substrate-binding-protein
MLTFRSFVLVCASMLFAFSAQADRTITDQLGRQVTIPDHVDKVVVLQHQTLNILVQLNAQQDIVGVMSSWKKQLGPEFARFMPTITTLPTPGDLTSVNIESLLAIHPQVVFVANYAPAEMIQQIQNAGIPVVAISLRKDADGQQNKMNPTMADEEQVYNGGLKQGIRLIADVVGRKPQAETLIDYVFAAREKFNAPVANIPDAQKVRIYMANPDLMTYGSGKYTGLMMQHAGGLNVAAASVKGARQVALEQVLAWNPQVIFVQDRYPQVVTQIQNDPNWQGIDAVKNHRVWLMPEYAKAWGYPMPEALAIGELWMAKKLYPDAYKDVDVDAQAQDYYQRFYRVNWQSDAAK
>NZ_CP040698.1|WP_138828457.1|3418038_3419301_+|4-aminobutyrate-transaminase
MNNKNLQQRRLDATPRGVGVMCDFYAQSAENSTITDIEGNQYIDFAAGIAVLNTGHRHPRLVQAVEAQLQAFTHTAYQIVPYESYVSLAEKINAVAPIDGKRKTTFFTTGAEAVENAVKIARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHAPYPSELHGISTEDSLKAIERLFKADIDPTQVAAIIFEPVQGEGGFVVAPPEFVAAIRRICDEHGIVMIADEVQSGFARTGQLFAMDHYADKADLMTMAKSLAGGMPLSGVVGKAEIMDAPAPGGLGGTYAGNPLSIAAAHAVLDIIHDEQLCQRAAALGEQLRAALTDAQAGCPELAEVRGLGSMIAAEFCDPVTGEPNASAAQRVQKKALEQGLLLLTCGQYGNVIRFLYPLTIPQDQFAKALQVIKAATK
>NZ_CP040698.1|WP_138828456.1|3416456_3417932_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MRSLAGDVIKHAFSQQTDEKLHRRLYAAICSSILEGSLKPATRMPPSRDLAGELMLSRNTVLRVYEQLQAEGYISARTSSGTFVTDSVLDNLNLRPNKEPVAAALEDHTRLSARCLELLGNASASPRQWGAFIPGVPDVEHFPHRVLKKIQDRLARRLRPEFLTYDAAGGVNELKEALADYLRTARGVRCSPEQILITEGIHQALDLVTRTLCNPGDHAWIEEPGYWGIKNILRINAVNFSAIPVDEQGMVPPDAGETPPKLIFVTPSHQYPLGSVMSLSRRRQLIFRARETRSWIVEDDYDSEFRFSGQPIPSLQGLEEETPVIYIGTFSKTLYPALRLGYVVLPKSLAAPLKKVHNDLYRGGHLLIQAALAEFIREGYYAAHIRKMRQLYSRRRQMLVELINRQLGEHYLGSFSSNAGLHMILQLPAGSDDAVIAQQANAQGLLVRPLSRYYVNEEKRSGLLLGFASIEEHEMTAAFTRLADIIRVNTV
>NZ_CP040698.1|WP_138828455.1|3415204_3416413_+|c-type-cytochrome
MRNETILAACLFTASVSAAESNGEYIARISDCVACHTAEGGAAMAGGKKFPTPVGDIYSTNITPDKAQGIGNYSYEDFEKAVRQGIAKDGHPLYPAMPYPSYAKLSDEDVQALYRYFMHDVTPSAQPNKENAIPWLLSARWPLHIWNWLFTDAPATTVDSAKPDDNAALVKRGAYLVEGPGHCGSCHTPRGMAMNEKAYTHADAEYLSGAMIDGWYAPSLRGSGMSEQALKSLLLTGKSKHAAVSGSMAEVVTQSTQYLTDEDATAIAQYLLSLKSAKPETVRAAATTASWSNSPEAGKVTYNRYCSTCHGLEGKGTDDNAPSLVNNPLVMVDDPTPLFRVIAHGAETPTTRGSISFKMPAYGGMLSDNEMRDVINYVRKTWGEGNGEVSHEDLAGIKKASH
>NZ_CP040698.1|WP_138828454.1|3413308_3415201_+|NAD(P)-binding-protein
MAITRRDFLNGVAVTIAAGLTPLEWVRATGKGNAFIDGNYYPPALTGLRGNHPGSFEMAHALGREQKHFDLNALPVEEEYDLVIVGGGISGLAAGCFWRQVAGQNSRVLILDNHDDFGGHAKRNEFTSSGKKLLGYGGSEAFQSPAHNFSPEVQKLMETVGVSVTRLKESFDVNFYPDWQLSRGVFFDKKNFGVTKIVSGDPGRAVSDDIPPDRLNGRKIEDFINDFPLGENDRKALIDLHVRPGDYLPGMTVDEKMEWLDTHSYSEFLATKVGLSKMALLYFQQRSNDFFAIGIEGISCSDARACALPGMEGMGLPPLDGESLADLEEPYVYHFPDGNAGLARLLVRYMLPDALPGNTMEDSVLARLHYEKLDLPENTTRLRLNSTVINAANVQDGVVVTYLRDGKMHRVRGKNTIMAGYNMMIPYLVPEMPEQQQADLKLNVKAPLVYTNVMVKNWQAFKQLGVHEFYSPAAPYSRVKLDYPVSIGGYQHPASPDDPMVIHMVYVPTYPGSNLSAREQFRLGRAYLLGTTFAAHEEMIRSQLQEMFGSTGFDNQRDISAITVNRWAHGYAYYANSLFDDMDKMPEIIERARQPVGRIAIANSDSDWSAYAHTAIDQAWRAVNELKDMG
>NZ_CP040698.1|WP_138828453.1|3412745_3413219_+|ester-cyclase
MKTVKIAVLSLVMLSGYSLAESTSLNTVKEYMAAWNAHDASRAAQYLADDAVYYDAAAGEPINGREKAEKEVIGAFIKAVPDLNWKMVGKPVYDEDTVAFRWEFSGKNSGEWPGSPPTNNPIKFEGVSYIHVKAGKITWQGDYYDSKKLDEELKPVK
>NZ_CP040698.1|WP_049002814.1|3411306_3412734_+|gamma-aminobutyraldehyde-dehydrogenase
MKTLKHFINGHYVAGSSEDSFELVSPVDGETYAISPNANEAEVEQAYSAAEAAFSIWRKSTPAQRQKALLLLADEIERNVERLVTAQSQETGQLRHFIEKEEIAASCDAIRFFAGAARCLEGKAAGEYSAGFTSTIRREPLGIVGQVTPWNYPFMMAVWKIAPALAAGNTVVLKPSDTTPVSTLLLAELAAPLFPRGAFNVVLGKASTGSLVVSNPKASLVSITGSVRAGLQVAASAAANLTRAHLELGGKAPAVVFADADMDKAIATITTAGFFNAGQDCTAATRILVEQSIYAEFLEKLIQKTKSIKFGPPEDQNALYGALNSRNQLEQVKGFIERLPAHAKIETGGRAGPGPGFYFEPTIVSGLHQNDEAIQHEVFGPVMTIQSFSTDEEVLHKANDVEYGLAASVWTRNHGRAQRFSIDLDFGTVWINNHIPLCAEMPHGGFKKSGYGKDLSSYSLEEYTRVKHIMCDISE
>NZ_CP040698.1|WP_138828462.1|3423463_3424735_-|DUF3596-domain-containing-protein
MAALPTGVEIHNGKIRIWFVYRGSRCREVLHGWAITAANIRKAGNLRAGIIGDIQMGTFDYARRFPESKTIKKFTTTQRITTFTELCDLFLKIKKLELSAASHDSLTSRIDTLLRIVGGRTHIAEIQHTDLLRYRQELLTGDVTYKKVVWFNKEGRKASTVNNLMGTLCSMLKLANHSKFITHAPYENVKNLRVSQRDPDPLLLHEYQAFINTLPRRFALTWIVAIHTGMRHGELCALAWEDIDLKKGEIHVCRNLTAKGLFVPPKTNAGIRTITLLQPALEALNEIHQLTANQPKTDIVLHHREYGRTEQLSVRFVFIPGQQSREKKQYFSKRSFPYSWESGMKRAGVRVRDPYQSRHTYACWLLSSGANPSFIASQMGHENAKMVYEVYSKWISEMNADQVSMLNSRMPTQMPPLCPQRTA
>NZ_CP040698.1|WP_043016519.1|3424734_3424950_-|DUF1233-family-excisionase
MPDIVFNEEWVVETRLSERTGLSKGQIKNYRLGVWIEGVHFKHLTALGETSSSNGVLWYNYPRINKFVQEA
>NZ_CP040698.1|WP_138828463.1|3425235_3425484_-|hypothetical-protein
MVSPITGGSYFDFNTDYSIKPLPPGTTANSGEVCGQTGVWKSETYKVVTGVTKGEVMPQYQGRDVEWELTGHSLSELDQPTE
>NZ_CP040698.1|WP_138828464.1|3425775_3426579_-|hypothetical-protein
MSLQHKTDAELIETATKLASYSEAGPVLKELLSRWQVQRQLADVQHQQMINLAAESELLHQHAVKQSDAVSEIITVLASVAPNLMPDQQLELSAGAEKLVPSLTLSNTVSQIRAVEVVDLQGALATQFSASARIQQMDPLDLMALSCCIDSVISRRLAELLYLPIGPVPVERDQIGRWSHPASALQPDWDESTPPAEIKNWFRSHGLEVKVVDLADQDDALFERCMDDVAAVEEWNPIPPEGEDWFLFSIFDSEEGVHAEFVHPAAV
>NZ_CP040698.1|WP_138828465.1|3426587_3427748_-|hypothetical-protein
MTTISDSTVATALATSLRPVRSQLELALEQTVGTARASVESALALTDQLEVLVIEQYNLQVDEFNAVVEQCEALDDRNTTLGLQAAGLAEKLADMELTTKEARAAEEIAKAQIAVLQGDKRQLKTENDQLKSMNPERQKTQIVSLKETIASKTTLLDQQKQEMRKIRGELATTKTNLAVAIQQNTELNLENEELRTRLQRIDGDVEPVWYPAADDSGLQFYFYTFGWRLTLGSTDRDLHLDLLQDIDWHIEIRSNSGISVLVSVTQWCRARYPILDQFKSAWPSALGIALNRRIIELLGDTHPHLVQRTEWAMATPLSNLPLQDKWLDLLNASGLYSLWTVVSHTPEELSNLVKGFGIATARQVHAACMNVVKDWQAENWPKTNAA
>NZ_CP040698.1|WP_048997921.1|3427744_3427948_-|ANR-family-transcriptional-regulator
MKTLAQKMKEQGKMITERAASEERRGNYKTAQVFWLKSTEYPCSEANMHYRNVRADICQRRSQEVSE
>NZ_CP040698.1|WP_138828466.1|3428218_3428821_-|3'-5'-exoribonuclease
MQEPVHIMIDNETLSVLPNAHIAQVGLVQFDPHTFTPLAQKVISISHERQSGTVIDASTVAWWMARDKETQQSVFYGDEDRISIRSACCEFYRFVIDSCRRTWQEDETPGLSDLHQSVHIWAKPARFDIPQWENAFRHADVQVPWFRRNVNDVQSLLNDAERNGFVASSLKQLSAGIHMPLNDCLWQIRLLKAITEFKSR
>NZ_CP040698.1|WP_138828467.1|3428827_3429055_-|hypothetical-protein
MKSQVLTKSMAARNARQAIFINDPFRPHPRCQARFNKHPEPVTVMPPDSQLRWPVLFAVALCGFALAFLNFAMQM
>NZ_CP040698.1|WP_043016516.1|3429498_3429711_-|hypothetical-protein
MSFFGNNEKSPTEEEINRITSLVNQYPGKAFQVLNKKINSQGLMLSVREVPDELLTDEERICKQHRLRQH
>NZ_CP040698.1|WP_138828468.1|3429771_3430068_-|hypothetical-protein
MNGQSGTAGMAVCAEPKRSVIDVKVNQVWDQLDSLHGRISNLHDRLIPVVTPCPEVKGSGASEVNEPLSPLADVIHRFGASVATANARLDEIIRQLEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040698_1	1.1\|3423227\|38\|NZ_CP040698\|CRISPRCasFinder	3423227-3423264	38	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	113727-113764	3	0.921

1. spacer 1.1|3423227|38|NZ_CP040698|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 3, identity: 0.921

cggacgcaagatggtgcgttcaattggactcgaaccaa	CRISPR spacer
cagacgcagaatggtgcgttcaattggactcgaaccaa	Protospacer
*.******..****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3212806 : 3219844

uncultured_Caudovirales_phage(44.44%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030769.1\|3212806_3214057_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	9.4e-22	94.4
WP_003030767.1\|3214192_3214702_-	hypothetical protein	NA	NA	NA	NA
WP_003840850.1\|3214876_3215119_-	DinI family protein	Q6UAW0	Klebsiella_phage	1.5e-29	77.9
WP_138828399.1\|3215197_3215431_+	DNA polymerase V	A0A222YZE2	Escherichia_phage	8.6e-22	80.3
WP_138828400.1\|3215507_3216206_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	5.5e-88	67.2
WP_138828401.1\|3216291_3216612_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	8.5e-20	45.7
WP_138828402.1\|3216661_3217945_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	7.8e-165	70.7
WP_003030760.1\|3217957_3218383_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	7.3e-51	70.7
WP_057101667.1\|3218626_3218830_+	hypothetical protein	Q77Z09	Phage_21	3.7e-21	94.1
WP_032948081.1\|3219358_3219844_+	outer membrane beta-barrel protein	A0A1B0VBR9	Salmonella_phage	2.3e-08	34.9

DBSCAN-SWA_2

3310986 : 3314485

Enterobacteria_phage(42.86%)

integrase

attL 3310784:3310806|attR 3320376:3320398

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3310784:3310806	attL	NA	NA	NA	NA
WP_138828427.1\|3310986_3312195_+\|integrase	tyrosine-type recombinase/integrase	I6R9B6	Salmonella_phage	3.6e-180	76.2
WP_032936075.1\|3312152_3312389_-	hypothetical protein	A0A1P8DTG1	Proteus_phage	3.3e-13	53.7
WP_138828428.1\|3312494_3312797_-	hypothetical protein	NA	NA	NA	NA
WP_138828429.1\|3312806_3313046_-	DUF4222 domain-containing protein	M1FPC8	Enterobacteria_phage	8.6e-09	44.2
WP_138828430.1\|3313008_3313350_-	DUF2591 family protein	R9VYJ6	Serratia_phage	6.5e-10	38.2
WP_138828431.1\|3313349_3313568_-	TraR/DksA family transcriptional regulator	M1FQT7	Enterobacteria_phage	5.0e-24	76.4
WP_138828432.1\|3313664_3313961_-	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	8.7e-27	61.3
WP_138828433.1\|3313957_3314485_-	phage N-6-adenine-methyltransferase	Q9ZWX6	Enterobacteria_phage	2.9e-65	68.3
3320376:3320398	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3323977 : 3334015

Tupanvirus(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003832580.1\|3323977_3324961_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.4e-33	38.5
WP_003030574.1\|3324976_3327364_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003030571.1\|3327368_3327668_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_003832584.1\|3327821_3328802_+	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	6.7e-15	24.8
WP_003030569.1\|3328862_3329414_+	glutathione peroxidase	NA	NA	NA	NA
WP_003030567.1\|3329413_3330163_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	9.3e-09	30.3
WP_003836644.1\|3330240_3330705_+	lipoprotein nlpC	A0A1V0DZX6	Clostridioides_phage	3.5e-14	38.2
WP_003836643.1\|3331021_3331735_+	EAL domain-containing protein	NA	NA	NA	NA
WP_138828436.1\|3331796_3333239_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	4.5e-52	35.3
WP_003836641.1\|3333235_3334015_-	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	7.9e-11	26.7

DBSCAN-SWA_4

3430502 : 3437685

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138828469.1\|3430502_3432002_+	RNA-directed DNA polymerase	Q2P9X6	Enterobacteria_phage	1.0e-78	34.4
WP_051642696.1\|3432689_3433382_-	helix-turn-helix transcriptional regulator	F1C599	Cronobacter_phage	2.8e-15	31.9
WP_048997915.1\|3433474_3433666_+	hypothetical protein	NA	NA	NA	NA
WP_043016513.1\|3433707_3434016_+	hypothetical protein	NA	NA	NA	NA
WP_138828470.1\|3434268_3435240_+	replication protein 15	K7PLZ7	Enterobacterial_phage	6.8e-36	48.6
WP_138828471.1\|3435236_3435932_+	DNA replication protein	C1JJ54	Enterobacteria_phage	6.7e-54	50.2
WP_138828472.1\|3436112_3436691_+	S-adenosylmethionine-binding protein	A0A193GYV6	Enterobacter_phage	2.0e-80	72.7
WP_138828473.1\|3436674_3437685_+	DUF968 domain-containing protein	A0A1W6JP62	Morganella_phage	8.6e-58	36.0

DBSCAN-SWA_5

4054308 : 4144329

111

Enterobacteria_phage(31.51%)

portal,protease,head,terminase,integrase,tail,holin,capsid,tRNA

attL 4059623:4059638|attR 4148892:4148907

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841958.1\|4054308_4054521_-	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	2.1e-22	74.3
WP_050499177.1\|4054895_4055441_-	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	1.0e-12	46.2
WP_032941335.1\|4055419_4055968_-	lysozyme	K7PM52	Enterobacteria_phage	2.1e-98	94.0
WP_003841952.1\|4055939_4056218_-	hypothetical protein	K7P6H9	Enterobacteria_phage	1.5e-44	98.9
WP_003841950.1\|4056371_4056560_-	hypothetical protein	NA	NA	NA	NA
WP_071524345.1\|4056614_4056794_+	hypothetical protein	NA	NA	NA	NA
WP_003841948.1\|4057990_4058206_-	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	5.9e-25	80.6
WP_003841946.1\|4058502_4058715_+	cold shock-like protein CspF	NA	NA	NA	NA
WP_042270662.1\|4059001_4059433_-	antitermination protein	Q8W638	Enterobacteria_phage	3.9e-36	59.2
WP_057101938.1\|4059447_4060140_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.5e-64	42.0
4059623:4059638	attL	NA	NA	NA	NA
WP_057101939.1\|4060136_4060496_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	2.3e-42	63.6
WP_057108923.1\|4060498_4060699_-	hypothetical protein	H6WRY8	Salmonella_phage	3.3e-22	69.2
WP_003841938.1\|4060704_4061304_-	DUF1367 family protein	K7PKS6	Enterobacteria_phage	1.1e-105	95.5
WP_071524344.1\|4061338_4061587_-	hypothetical protein	K7PHG9	Enterobacteria_phage	2.2e-39	91.5
WP_003841935.1\|4061697_4061931_-	DinI family protein	K7PM44	Enterobacteria_phage	8.9e-27	71.4
WP_123977203.1\|4062206_4062572_-	hypothetical protein	NA	NA	NA	NA
WP_123977205.1\|4063136_4063592_-	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	9.2e-44	86.5
WP_138828607.1\|4063588_4063900_-	hypothetical protein	NA	NA	NA	NA
WP_138828608.1\|4063918_4064668_-	ATP-binding protein	S4TNF5	Salmonella_phage	3.1e-121	85.9
WP_123977211.1\|4064670_4065543_-	DNA-binding protein	V5URT9	Shigella_phage	4.2e-85	51.9
WP_138828609.1\|4065755_4068290_+	exodeoxyribonuclease VIII	K7P6V4	Enterobacteria_phage	4.7e-238	62.7
WP_057101942.1\|4068301_4069387_+	recombinase RecT	K7PKR8	Enterobacteria_phage	8.7e-125	63.6
WP_057101943.1\|4069425_4069668_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	3.0e-33	88.6
WP_072276910.1\|4069732_4070005_+	excisionase	A0A2H4J5E1	uncultured_Caudovirales_phage	1.5e-28	63.3
WP_057101944.1\|4069973_4071059_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4IYC8	uncultured_Caudovirales_phage	4.8e-147	68.4
WP_003034934.1\|4071395_4071734_-	YebY family protein	NA	NA	NA	NA
WP_049002332.1\|4071754_4072627_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_003844136.1\|4072630_4073005_-	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_003034925.1\|4073148_4073379_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.0e-14	60.3
WP_003841657.1\|4073485_4074142_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_003833802.1\|4074165_4074828_+	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	9.1e-08	31.1
WP_138828610.1\|4074818_4076897_-	oligopeptidase B	NA	NA	NA	NA
WP_138828611.1\|4076959_4077619_-	DUF533 domain-containing protein	NA	NA	NA	NA
WP_003034909.1\|4077713_4078067_-	hypothetical protein	NA	NA	NA	NA
WP_003034906.1\|4078188_4078479_-	DNA damage-inducible protein YebG	NA	NA	NA	NA
WP_044700298.1\|4078610_4079789_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_003034901.1\|4079856_4080498_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_003841668.1\|4080532_4082344_-	phosphogluconate dehydratase	NA	NA	NA	NA
WP_003034896.1\|4082577_4084053_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.3e-78	37.1
WP_003034893.1\|4084420_4085290_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003034890.1\|4085408_4086851_+	pyruvate kinase	NA	NA	NA	NA
WP_138828612.1\|4086894_4087866_-	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
WP_138828613.1\|4087985_4089305_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	36.8
WP_003844151.1\|4089320_4090265_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_138828614.1\|4090343_4091099_+	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	6.5e-18	28.3
WP_138828615.1\|4091095_4091881_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_003841680.1\|4091959_4092970_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.6e-08	25.4
WP_003034869.1\|4092978_4093590_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003034867.1\|4093670_4094192_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
WP_003034865.1\|4094226_4094970_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003844155.1\|4094998_4095442_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_003034862.1\|4095443_4097216_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_003841685.1\|4097505_4098072_+	hydrolase	NA	NA	NA	NA
WP_138828832.1\|4098153_4098270_-	preprotein translocase subunit SecY	NA	NA	NA	NA
WP_138828616.1\|4098394_4099063_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.8e-80	60.9
WP_138828617.1\|4099063_4099453_-	LexA family transcriptional regulator	Q1MVE7	Enterobacteria_phage	6.0e-52	72.1
WP_138828618.1\|4099773_4099941_+	DinI-like family protein	Q6UAW0	Klebsiella_phage	1.3e-16	74.1
WP_138828619.1\|4100217_4100928_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_138828620.1\|4103333_4106051_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	56.7
WP_138828621.1\|4106047_4106428_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	1.4e-58	78.6
WP_085396128.1\|4106437_4106920_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	1.1e-63	75.0
WP_138828622.1\|4106916_4107390_-	hypothetical protein	A0A286S298	Klebsiella_phage	6.8e-58	61.9
WP_138828623.1\|4107389_4109912_-\|tail	phage tail tape measure protein	K7PM62	Enterobacteria_phage	8.6e-216	70.2
WP_138828624.1\|4110179_4110560_-\|tail	phage tail protein	K7PJU9	Enterobacteria_phage	2.0e-44	77.4
WP_138828625.1\|4110612_4111104_-\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	5.6e-63	71.2
WP_039517932.1\|4111162_4111528_-	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	3.8e-48	68.6
WP_069323626.1\|4112055_4112388_-\|head	phage head closure protein	K7PH08	Enterobacteria_phage	1.2e-53	90.9
WP_039517925.1\|4112389_4112602_-	hypothetical protein	NA	NA	NA	NA
WP_138828626.1\|4112665_4112992_-\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	6.1e-50	88.0
WP_138828627.1\|4113033_4114245_-\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	4.4e-194	86.0
WP_138828628.1\|4114254_4115103_-\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	9.2e-138	91.4
WP_138828629.1\|4115116_4116421_-\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	8.9e-233	93.3
WP_138828630.1\|4116420_4118157_-\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	99.3
WP_138828631.1\|4118156_4118654_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.7e-73	83.6
WP_138828632.1\|4118811_4119162_-	HNH endonuclease	K7PHK9	Enterobacteria_phage	1.4e-52	82.8
WP_138828633.1\|4119161_4119752_-	hypothetical protein	S4TR53	Salmonella_phage	6.5e-98	84.1
WP_138828634.1\|4119733_4121191_-	glycosyltransferase	K7PKP3	Enterobacterial_phage	4.7e-267	90.3
WP_138828635.1\|4121209_4121437_-	hypothetical protein	NA	NA	NA	NA
WP_138828636.1\|4121456_4121687_-	hypothetical protein	NA	NA	NA	NA
WP_138828833.1\|4121664_4121871_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	1.1e-17	78.6
WP_138828637.1\|4121827_4122097_-	hypothetical protein	G8C7W1	Escherichia_phage	2.0e-06	79.4
WP_138828638.1\|4122104_4122722_-	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	8.9e-82	72.7
WP_008323297.1\|4122721_4123003_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	4.2e-39	88.2
WP_008323296.1\|4122989_4123385_-	membrane protein	K7PHB9	Enterobacterial_phage	2.6e-50	81.7
WP_138828639.1\|4123483_4124086_-	hypothetical protein	NA	NA	NA	NA
WP_138828640.1\|4124192_4124771_-	DUF1133 family protein	A0A0U2S606	Escherichia_phage	3.0e-47	56.1
WP_138828641.1\|4124785_4125775_-	DUF968 domain-containing protein	K7PJS6	Enterobacterial_phage	4.5e-144	72.3
WP_138828642.1\|4125771_4126497_-	phage regulatory protein/antirepressor Ant	G0ZND1	Cronobacter_phage	9.8e-56	53.5
WP_075848445.1\|4126513_4126903_-	RusA family crossover junction endodeoxyribonuclease	K7PKN5	Enterobacterial_phage	9.2e-61	88.1
WP_049003108.1\|4126902_4127121_-	hypothetical protein	NA	NA	NA	NA
WP_138828643.1\|4127117_4127777_-	DNA methyltransferase	I6PDF5	Cronobacter_phage	1.2e-95	77.3
WP_138828834.1\|4127776_4128220_-	hypothetical protein	U5P0U0	Shigella_phage	2.6e-11	29.8
WP_138828644.1\|4128222_4129218_-	hypothetical protein	S5FM81	Shigella_phage	6.9e-60	69.3
WP_138828645.1\|4129627_4130092_-	hypothetical protein	K7PJS5	Enterobacterial_phage	1.7e-69	89.5
WP_032207801.1\|4130117_4130315_-	hypothetical protein	H9C161	Pectobacterium_phage	1.9e-17	66.7
WP_032207827.1\|4130419_4131067_+	helix-turn-helix domain-containing protein	H9C160	Pectobacterium_phage	1.4e-74	63.0
WP_138828646.1\|4132529_4133567_+	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	9.7e-166	89.3
WP_138828647.1\|4133550_4134135_+	hypothetical protein	A0A193GYL1	Enterobacter_phage	2.2e-29	63.2
WP_138828648.1\|4134131_4134479_+	DUF551 domain-containing protein	K7PH61	Enterobacteria_phage	1.5e-22	64.5
WP_138828649.1\|4134475_4135054_+	ead/Ea22-like family protein	A0A1B0VCG7	Salmonella_phage	2.0e-43	49.1
WP_138828650.1\|4135056_4135245_+	diguanylate phosphodiesterase	A0A192Y8X2	Salmonella_phage	2.8e-23	91.9
WP_138828651.1\|4135798_4136176_+	hypothetical protein	NA	NA	NA	NA
WP_003034696.1\|4136240_4136477_+	excisionase family protein	Q8W657	Enterobacteria_phage	2.1e-39	92.3
WP_047389241.1\|4136535_4137849_+\|integrase	site-specific integrase	Q8W658	Enterobacteria_phage	3.6e-234	89.2
WP_138828652.1\|4137836_4138601_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.2e-56	79.5
WP_003034689.1\|4138653_4139049_+	membrane protein	NA	NA	NA	NA
WP_003034686.1\|4139089_4139833_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	3.2e-25	31.3
WP_003844163.1\|4139829_4140798_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_044701481.1\|4141041_4141788_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_003034677.1\|4141790_4142357_-	VOC family protein	NA	NA	NA	NA
WP_003034673.1\|4142595_4144329_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	1.7e-85	33.6
4148892:4148907	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4302382 : 4310604

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003842215.1\|4302382_4303486_-	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	5.9e-36	30.9
WP_003842218.1\|4303502_4303898_-	WxcM-like domain-containing protein	NA	NA	NA	NA
WP_032941356.1\|4303894_4304446_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.5e-45	50.0
WP_138828692.1\|4304860_4305739_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.6e-107	63.1
WP_003841822.1\|4305792_4306692_-	dTDP-4-dehydrorhamnose reductase	A0A140G5S3	Enterobacteria_phage	2.1e-31	36.3
WP_138828693.1\|4306691_4307777_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.8e-99	53.1
WP_138828694.1\|4308150_4309044_-	UTP--glucose-1-phosphate uridylyltransferase GalF	A0A127AW70	Bacillus_phage	6.2e-44	40.0
WP_138828695.1\|4309209_4310604_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	5.2e-21	34.2

DBSCAN-SWA_7

4352454 : 4362033

Bacillus_phage(28.57%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841761.1\|4352454_4353858_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	3.9e-32	29.6
WP_003036797.1\|4353854_4354577_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	9.2e-30	32.7
WP_003841759.1\|4354712_4355045_+	YegP family protein	NA	NA	NA	NA
WP_003844346.1\|4355204_4356566_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.1e-204	92.9
WP_048218204.1\|4356836_4359113_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	41.8
WP_003036810.1\|4359143_4359464_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-13	45.7
WP_003036813.1\|4359787_4360012_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_003840216.1\|4360086_4362033_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.4e-40	41.8

DBSCAN-SWA_8

4400175 : 4408594

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844377.1\|4400175_4402209_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.0e-54	27.6
WP_071697500.1\|4402415_4402874_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	1.0e-50	69.3
WP_003027346.1\|4402916_4403387_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.9e-64	76.9
WP_003840155.1\|4403433_4404153_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_003027348.1\|4404149_4405835_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-281	91.6
WP_049002964.1\|4406060_4406792_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.8e-105	93.5
WP_003027354.1\|4406843_4406951_+	protein YohO	NA	NA	NA	NA
WP_003844383.1\|4406931_4407663_-	ABC transporter permease	NA	NA	NA	NA
WP_016150643.1\|4407646_4408594_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	2.0e-08	25.8

DBSCAN-SWA_9

4941989 : 4951957

Enterobacteria_phage(88.89%)

integrase,capsid

attL 4921451:4921465|attR 4948608:4948622

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4921451:4921465	attL	NA	NA	NA	NA
WP_138828794.1\|4941989_4943180_+\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	1.6e-108	50.4
WP_138828795.1\|4943272_4944781_+	hypothetical protein	NA	NA	NA	NA
WP_138828796.1\|4945170_4945746_-	phage polarity suppression protein	Q7M2A1	Enterobacteria_phage	1.3e-39	51.9
WP_138828797.1\|4945762_4946005_-	hypothetical protein	Q7M294	Enterobacteria_phage	4.2e-19	58.0
WP_138828798.1\|4946001_4946805_-\|capsid	capsid protein	Q7M2A2	Enterobacteria_phage	2.8e-11	25.5
WP_000557711.1\|4947363_4947630_+	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	6.8e-23	62.5
WP_087855476.1\|4947626_4948226_+	host cell division inhibitor Icd-like protein	Q7M2A7	Enterobacteria_phage	1.6e-48	76.6
WP_087855475.1\|4948218_4948518_+	Derepression protein	Q7M2A0	Enterobacteria_phage	4.1e-32	68.7
WP_138828799.1\|4948510_4948960_+	hypothetical protein	Q7M298	Enterobacteria_phage	6.3e-45	67.3
4948608:4948622	attR	NA	NA	NA	NA
WP_138828838.1\|4949064_4949292_+	hypothetical protein	NA	NA	NA	NA
WP_071692548.1\|4949288_4949609_+	DUF5375 domain-containing protein	NA	NA	NA	NA
WP_138828800.1\|4949623_4951957_+	toprim domain-containing protein	Q7M2A8	Enterobacteria_phage	0.0e+00	84.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP040696

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

23674 : 111969

Escherichia_phage(27.59%)

integrase,protease,transposase

attL 75871:75930|attR 89282:90101

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001585166.1\|23674_24754_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	2.8e-38	34.1
WP_001040058.1\|24755_25529_-	hypothetical protein	NA	NA	NA	NA
WP_001280115.1\|25521_26664_-	hypothetical protein	A0A172Q0Y1	Acinetobacter_phage	6.5e-30	34.5
WP_012695441.1\|26673_27732_-	hypothetical protein	NA	NA	NA	NA
WP_000254137.1\|28052_28634_+	tellurium resistance-associated protein TerZ	K4JRX3	Caulobacter_phage	6.3e-13	30.0
WP_001054786.1\|28633_29791_+	tellurium resistance protein TerA	NA	NA	NA	NA
WP_000007449.1\|29813_30269_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_000255079.1\|30291_31332_+	tellurium resistance membrane protein TerC	K7QKE8	Escherichia_phage	2.2e-77	48.0
WP_000116680.1\|31380_31959_+	tellurium resistance membrane protein TerD	A0A2P1N0L4	Streptomyces_phage	2.5e-06	40.0
WP_000301247.1\|32027_32603_+	TerD family protein	K4JRX3	Caulobacter_phage	8.7e-31	41.6
WP_001053340.1\|33031_34273_+	tellurium resistance protein TerF	NA	NA	NA	NA
WP_000374058.1\|34363_34819_+	hypothetical protein	NA	NA	NA	NA
WP_000398479.1\|35059_35251_-	hypothetical protein	NA	NA	NA	NA
WP_001151572.1\|35342_35684_-	hypothetical protein	NA	NA	NA	NA
WP_000880375.1\|36670_36925_+	hypothetical protein	NA	NA	NA	NA
WP_001531258.1\|37265_38048_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	6.1e-136	96.5
WP_000627495.1\|38044_39067_-\|transposase	IS21-like element ISSen3 family transposase	A0A2L1IVA1	Escherichia_phage	1.9e-174	85.3
WP_000211823.1\|40924_41911_-	hypothetical protein	NA	NA	NA	NA
WP_000341066.1\|42831_43224_+	hypothetical protein	NA	NA	NA	NA
WP_012695443.1\|43202_43514_+	hypothetical protein	NA	NA	NA	NA
WP_000462754.1\|43882_44539_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_123906519.1\|44578_44761_+	hypothetical protein	NA	NA	NA	NA
WP_000340139.1\|44741_45239_+	membrane protein	NA	NA	NA	NA
WP_012695445.1\|45243_46632_+	hypothetical protein	NA	NA	NA	NA
WP_012477377.1\|47032_47326_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000088044.1\|47330_48656_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_000134171.1\|48716_48923_+	hypothetical protein	NA	NA	NA	NA
WP_000985909.1\|49023_49434_+	hypothetical protein	NA	NA	NA	NA
WP_001805097.1\|49446_49971_+	hypothetical protein	NA	NA	NA	NA
WP_023280914.1\|50822_51746_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.3e-166	92.8
WP_000405672.1\|52312_52747_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001287661.1\|52832_55238_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-141	46.1
WP_000118563.1\|55234_56311_+	signal peptidase II	NA	NA	NA	NA
WP_000993245.1\|56319_56532_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001446012.1\|56494_56614_+	hypothetical protein	NA	NA	NA	NA
WP_001087807.1\|56597_56834_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001277466.1\|56830_57196_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000209297.1\|57213_58899_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.8e-39	29.1
WP_000522996.1\|58937_59363_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_000732275.1\|59390_59666_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294656.1\|59681_60047_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|60118_60574_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_000278471.1\|61251_61677_+	hypothetical protein	NA	NA	NA	NA
WP_001224686.1\|62225_62534_+	hypothetical protein	NA	NA	NA	NA
WP_000784387.1\|62549_63407_+	HNH endonuclease	G0X580	Salmonella_phage	3.9e-11	34.2
WP_001194554.1\|63468_63672_+	hypothetical protein	NA	NA	NA	NA
WP_001287391.1\|64013_64418_-	H-NS histone family protein	NA	NA	NA	NA
WP_001100635.1\|64595_64889_-	hypothetical protein	NA	NA	NA	NA
WP_000175475.1\|64914_65151_-	hypothetical protein	NA	NA	NA	NA
WP_000916941.1\|65191_65647_-	hypothetical protein	NA	NA	NA	NA
WP_000490638.1\|65706_66372_-	hypothetical protein	NA	NA	NA	NA
WP_001371925.1\|66429_66810_-	hypothetical protein	NA	NA	NA	NA
WP_000027057.1\|67139_68000_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001235713.1\|68182_68740_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_001143760.1\|68903_71909_+\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	100.0
75871:75930	attL	NA	NA	NA	NA
WP_001067855.1\|75922_76627_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_124060971.1\|76597_77179_+	hypothetical protein	NA	NA	NA	NA
WP_002008781.1\|77444_77945_+	hypothetical protein	A0A1V0SB21	Catovirus	3.3e-10	31.7
WP_000019304.1\|77944_78514_+	trimethoprim-resistant dihydrofolate reductase DfrA19	A0A1V0SD48	Indivirus	3.5e-08	27.2
WP_072058701.1\|78896_79148_-\|transposase	transposase	NA	NA	NA	NA
WP_000845039.1\|79116_80130_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001082319.1\|80287_81091_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_000480968.1\|81090_81927_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_024139167.1\|82416_82629_+	hypothetical protein	NA	NA	NA	NA
WP_001749969.1\|82641_83850_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_001288432.1\|83883_85317_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
WP_001749967.1\|85698_85905_-	hypothetical protein	NA	NA	NA	NA
WP_012561158.1\|85909_86551_-	restriction endonuclease	NA	NA	NA	NA
WP_013279382.1\|86606_86918_-	hypothetical protein	NA	NA	NA	NA
WP_016338363.1\|86953_87268_-	KikA	NA	NA	NA	NA
WP_012561155.1\|87264_87609_-	hypothetical protein	NA	NA	NA	NA
WP_071562618.1\|87624_87975_-	H-NS histone family protein	NA	NA	NA	NA
WP_013279384.1\|88038_88776_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_016338364.1\|88784_89066_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|89333_90038_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001572372.1\|90203_90680_-	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
89282:90101	attR	NA	NA	NA	NA
WP_001572373.1\|90756_92376_-	phosphoethanolamine--lipid A transferase MCR-9.1	NA	NA	NA	NA
WP_001572374.1\|92564_93488_-\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	2.4e-176	99.3
WP_004248839.1\|93571_94918_+	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	8.8e-18	26.6
WP_000723070.1\|95135_95570_+	hypothetical protein	NA	NA	NA	NA
WP_001572377.1\|95827_96943_-	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
WP_000019951.1\|97065_97338_+	Ni(II)/Co(II)-binding transcriptional repressor RcnR	NA	NA	NA	NA
WP_000193207.1\|97803_98622_+	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_001371952.1\|98618_99824_+	hypothetical protein	NA	NA	NA	NA
WP_000121164.1\|99887_100091_-	hypothetical protein	NA	NA	NA	NA
WP_000078513.1\|100103_101423_-	DUF1173 family protein	NA	NA	NA	NA
WP_000833380.1\|101673_103101_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	3.4e-100	52.3
WP_138827843.1\|103315_103831_+	nuclease	A0A1X6WF84	Pacmanvirus	2.1e-07	38.6
WP_001118616.1\|104570_105494_-\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	1.1e-176	99.3
WP_077257931.1\|105540_105963_-	hypothetical protein	A0A1B0VFY5	Salmonella_phage	6.7e-65	97.6
WP_001567369.1\|106016_106649_+	hypothetical protein	NA	NA	NA	NA
WP_001567368.1\|106677_108081_-\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_000785965.1\|108294_108612_+	hypothetical protein	NA	NA	NA	NA
WP_001100610.1\|108634_108940_+	hypothetical protein	NA	NA	NA	NA
WP_000285959.1\|108984_109656_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_001371904.1\|110113_110521_+	hypothetical protein	NA	NA	NA	NA
WP_000900745.1\|110571_110889_-	hypothetical protein	NA	NA	NA	NA
WP_122966916.1\|110857_111073_-	hypothetical protein	NA	NA	NA	NA
WP_100185530.1\|111054_111969_-\|transposase	IS5 family transposase	A0A077SK28	Escherichia_phage	3.6e-172	98.4

DBSCAN-SWA_2

155124 : 224322

Escherichia_phage(55.17%)

integrase,transposase

attL 174836:174895|attR 219821:223397

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000219087.1\|155124_156363_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	2.5e-11	23.1
WP_000589001.1\|156784_158125_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_000137794.1\|158555_159161_-	hypothetical protein	NA	NA	NA	NA
WP_000703842.1\|159377_159659_-	hypothetical protein	NA	NA	NA	NA
WP_000633161.1\|160034_160346_-	hypothetical protein	NA	NA	NA	NA
WP_000814953.1\|160568_160769_-	hypothetical protein	NA	NA	NA	NA
WP_000551490.1\|160808_161033_-	hypothetical protein	NA	NA	NA	NA
WP_000781547.1\|161087_161291_-	hypothetical protein	NA	NA	NA	NA
WP_024143014.1\|161470_161764_-	hypothetical protein	I7B2L9	Escherichia_phage	4.1e-05	38.6
WP_001371932.1\|161843_162335_-	DUF3085 domain-containing protein	NA	NA	NA	NA
WP_001165367.1\|162339_162651_-	DUF957 domain-containing protein	NA	NA	NA	NA
WP_000071366.1\|163167_163488_-	hypothetical protein	NA	NA	NA	NA
WP_001371935.1\|163666_163897_-	hypothetical protein	NA	NA	NA	NA
WP_000252081.1\|164068_164962_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|165271_165976_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_002903955.1\|167609_168512_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_023148136.1\|168549_168783_-	hypothetical protein	NA	NA	NA	NA
WP_002210513.1\|168773_169535_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002904004.1\|169555_170416_-	class A extended-spectrum beta-lactamase SHV-12	A0A077SL40	Escherichia_phage	2.2e-155	99.3
WP_071538079.1\|170379_170562_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|170552_171257_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000842134.1\|171746_172856_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.8e-33	30.2
WP_001039466.1\|172950_174135_-	tetracycline efflux MFS transporter Tet(D)	NA	NA	NA	NA
WP_000113282.1\|174230_174887_+	tetracycline resistance transcriptional repressor TetR(D)	NA	NA	NA	NA
174836:174895	attL	NA	NA	NA	NA
WP_001067855.1\|174898_175603_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001011939.1\|175746_176388_-	type A-2 chloramphenicol O-acetyltransferase CatII	G3CFL0	Escherichia_phage	7.3e-55	45.9
WP_001239317.1\|176537_177038_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|177117_177822_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001550559.1\|177855_178347_-	hypothetical protein	NA	NA	NA	NA
WP_001446887.1\|178453_179191_+	recombinase family protein	NA	NA	NA	NA
WP_000743213.1\|179187_179412_+	hypothetical protein	NA	NA	NA	NA
WP_000954592.1\|179533_179710_+	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
WP_000427619.1\|179891_180896_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_042863651.1\|180974_183941_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.8
WP_001067855.1\|184061_184766_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_138827841.1\|184802_185822_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	8.1e-72	45.5
WP_032488579.1\|185998_186553_+	aminoglycoside N-acetyltransferase AAC(6')-Ib3	NA	NA	NA	NA
WP_012695455.1\|186780_187521_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.4e-43	41.7
WP_077249983.1\|187507_189016_-\|transposase	IS21-like element ISCfr8 family transposase	A0A2L1IVA1	Escherichia_phage	9.9e-26	32.7
WP_001067855.1\|189175_189880_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000376623.1\|189955_190456_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001993321.1\|190474_190654_+	hypothetical protein	NA	NA	NA	NA
WP_000259031.1\|190583_191423_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_052238321.1\|191416_191752_-	ethidium bromide resistance protein	NA	NA	NA	NA
WP_025999322.1\|191644_192010_+	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_004193231.1\|192013_192889_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004236386.1\|192999_194139_+	class C beta-lactamase DHA-1	NA	NA	NA	NA
WP_004193241.1\|195489_195720_-	phage shock protein PspD	NA	NA	NA	NA
WP_004193243.1\|195728_196088_-	envelope stress response membrane protein PspC	NA	NA	NA	NA
WP_004193245.1\|196087_196312_-	envelope stress response membrane protein PspB	NA	NA	NA	NA
WP_003020532.1\|196366_197035_-	phage shock protein PspA	NA	NA	NA	NA
WP_004193248.1\|197205_198180_+	phage shock protein operon transcriptional activator	NA	NA	NA	NA
WP_017900990.1\|198262_198907_+	quinolone resistance pentapeptide repeat protein QnrB4	NA	NA	NA	NA
WP_004193260.1\|199002_199911_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	4.3e-77	53.0
WP_004193262.1\|200087_200666_-	2-oxo-tetronate isomerase	B5TK85	Pseudomonas_phage	2.0e-19	34.0
WP_004193264.1\|200613_201060_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_004193267.1\|201069_201573_-	hypothetical protein	NA	NA	NA	NA
WP_004193269.1\|201704_202097_+	YdeI family stress tolerance OB fold protein	NA	NA	NA	NA
WP_004193272.1\|202397_204041_+	peptide ABC transporter substrate-binding protein SapA	NA	NA	NA	NA
WP_004193276.1\|204037_205003_+	peptide ABC transporter permease SapB	NA	NA	NA	NA
WP_000050481.1\|205678_207220_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000259031.1\|207624_208464_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000679427.1\|208457_208805_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_012695487.1\|210114_210546_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_012695486.1\|210908_211322_-	NAD(+)--rifampin ADP-ribosyltransferase	NA	NA	NA	NA
WP_012695485.1\|211449_212259_-	AAC(3)-II family aminoglycoside N-acetyltransferase	O64018	Bacillus_phage	1.2e-17	29.3
WP_006473457.1\|212500_213856_-\|transposase	IS1380-like element IS1247 family transposase	A0A1X9I6F6	Streptococcus_phage	2.2e-45	29.7
WP_012695484.1\|214343_214925_-	aminoglycoside N-acetyltransferase AAC(6')-IIc	NA	NA	NA	NA
WP_000845048.1\|215087_216101_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001550559.1\|216368_216860_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|216893_217598_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001239317.1\|217677_218178_+	hypothetical protein	NA	NA	NA	NA
WP_001011939.1\|218327_218969_+	type A-2 chloramphenicol O-acetyltransferase CatII	G3CFL0	Escherichia_phage	7.3e-55	45.9
WP_001067855.1\|219112_219817_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000159617.1\|220332_220527_-	hypothetical protein	NA	NA	NA	NA
WP_000172888.1\|220523_220835_-	hypothetical protein	NA	NA	NA	NA
WP_001180999.1\|220897_221137_-	hypothetical protein	NA	NA	NA	NA
WP_000140246.1\|222952_223282_-	hypothetical protein	NA	NA	NA	NA
WP_022646498.1\|223398_224322_-\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	3.8e-177	99.7
219821:223397	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040697

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP040698

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP040696

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection