CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP031182	Lactobacillus brevis strain UCCLB95 chromosome, complete genome	1 crisprs	DinG,csa3,cas3,DEDDh	1	15
NZ_CP031184	Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_B, complete sequence	0 crisprs	NA	0	0
NZ_CP031183	Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031182_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031182_1

114140-114352

Orphan

I-E,II-B

Consensus_repeat	Method
AGTATTCCCCACATGTGTGGGGGTGATCC	CRISPRCasFinder
AGTATTCCCCACATGTGTGGGGGTGATCCTCA	PILER-CR
GTATTCCCCACATGTGTGGGGGTGATCC	CRT

3 spacers

The CRISPR arrays of NZ_CP031182_1

>merge|NZ_CP031182|1|114140-114352|CRISPRCasFinder,PILER-CR,CRT
TGTATTCCCCACATGTGTGGGGGTGATCCTGACTATGGAACCGGGGTTGAGGTTAACTTAAAGTATTCCCCACATGTGTGGGGGTGATCCTCATCATTCCGTGCTTCATGGTGTAGCCTCCTAGTATTCCCCACATGTGTGGGGGTGATCCCCAATCAAAAATGGCCGTCAATCCGTCTGTATCCGTATTCCCCACATATGTGAGGGTGAACG

>NZ_CP031182|1|1|114140-114352|CRISPRCasFinder
TGTATTCCCCACATGTGTGGGGGTGATCC	TGACTATGGAACCGGGGTTGAGGTTAACTTAA
AGTATTCCCCACATGTGTGGGGGTGATCC	TCATCATTCCGTGCTTCATGGTGTAGCCTCCT
AGTATTCCCCACATGTGTGGGGGTGATCC	CCAATCAAAAATGGCCGTCAATCCGTCTGTATC
CGTATTCCCCACATATGTGAGGGTGAACG

>NZ_CP031182|1|1|114141-114293|PILER-CR
GTATTCCCCACATGTGTGGGGGTGATCCTGAC	TATGGAACCGGGGTTGAGGTTAACTTAAA
GTATTCCCCACATGTGTGGGGGTGATCCTCAT	CATTCCGTGCTTCATGGTGTAGCCTCCTA
GTATTCCCCACATGTGTGGGGGTGATCCCCA

>NZ_CP031182|1|1|114141-114352|CRT
GTATTCCCCACATGTGTGGGGGTGATCC	TGACTATGGAACCGGGGTTGAGGTTAACTTAAA
GTATTCCCCACATGTGTGGGGGTGATCC	TCATCATTCCGTGCTTCATGGTGTAGCCTCCTA
GTATTCCCCACATGTGTGGGGGTGATCC	CCAATCAAAAATGGCCGTCAATCCGTCTGTATCC
GTATTCCCCACATATGTGAGGGTGAACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031182.1\|WP_139588526.1\|124462_125122_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP031182.1\|WP_095347822.1\|119163_120084_+\|IS30-like-element-ISLsa1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031182.1\|WP_087128068.1\|123567_124314_+\|NADPH-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|380322
NZ_CP031182.1\|WP_021742820.1\|123097_123571_+\|class-Ib-ribonucleoside-diphosphate-reductase-assembly-flavoprotein-NrdI	unknown	unknown	gnl\|CDD\|179443
NZ_CP031182.1\|WP_042522032.1\|125286_126756_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP031182.1\|WP_039106905.1\|114670_115246_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP031182.1\|WP_042522038.1\|116843_117686_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381314
NZ_CP031182.1\|WP_139588524.1\|120601_121417_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235640
NZ_CP031182.1\|WP_024525964.1\|109466_110954_-\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_CP031182.1\|WP_015473476.1\|107514_108444_-\|IS30-like-element-ISLpl1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031182.1\|WP_087127911.1\|108531_109248_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031182.1\|WP_042522043.1\|105991_106429_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225064
NZ_CP031182.1\|WP_087129316.1\|106512_107268_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227625
NZ_CP031182.1\|WP_065901546.1\|112389_113748_-\|transposase	unknown	unknown	gnl\|CDD\|379252
NZ_CP031182.1\|WP_139588523.1\|117974_119021_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031182.1\|WP_139588522.1\|105478_105907_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP031182.1\|WP_087127908.1\|108470_108563_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	unknown
NZ_CP031182.1\|WP_139588525.1\|121563_122610_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031182.1\|WP_024525968.1\|103892_105335_-\|NADP-dependent-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236453
NZ_CP031182.1\|WP_024525970.1\|102609_102873_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP031182.1\|WP_139588526.1\|124462_125122_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.76982e-08
NZ_CP031182.1\|WP_095347822.1\|119163_120084_+\|IS30-like-element-ISLsa1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.61178e-75
NZ_CP031182.1\|WP_087128068.1\|123567_124314_+\|NADPH-dependent-oxidoreductase	gnl\|CDD\|380322	cd02146, NfsA-like, nitroreductase similar to Escherichia coli NfsA. This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor.	2.99442e-80
NZ_CP031182.1\|WP_021742820.1\|123097_123571_+\|class-Ib-ribonucleoside-diphosphate-reductase-assembly-flavoprotein-NrdI	gnl\|CDD\|179443	PRK02551, PRK02551, flavoprotein NrdI; Provisional.	2.51141e-95
NZ_CP031182.1\|WP_042522032.1\|125286_126756_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.36598e-55
NZ_CP031182.1\|WP_039106905.1\|114670_115246_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.98196e-10
NZ_CP031182.1\|WP_042522038.1\|116843_117686_-\|aldo/keto-reductase	gnl\|CDD\|381314	cd19088, AKR_AKR13B1, AKR13B family of aldo-keto reductase (AKR). Xylella fastidiosa phenylacetaldehyde dehydrogenase is a founding member of aldo-keto reductase family 13 member B1 (AKR13B1). phenylacetaldehyde dehydrogenase (EC 1.2.1.39) catalyzes the NAD+-dependent oxidation of phenylactealdehyde to phenylacetic acid.	2.06137e-134
NZ_CP031182.1\|WP_139588524.1\|120601_121417_-\|hypothetical-protein	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	0.00239462
NZ_CP031182.1\|WP_024525964.1\|109466_110954_-\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_CP031182.1\|WP_015473476.1\|107514_108444_-\|IS30-like-element-ISLpl1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.5414e-69
NZ_CP031182.1\|WP_087129316.1\|106512_107268_-\|hypothetical-protein	gnl\|CDD\|227625	COG5309, COG5309, Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism].	0.0078109
NZ_CP031182.1\|WP_065901546.1\|112389_113748_-\|transposase	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.07556e-17
NZ_CP031182.1\|WP_139588523.1\|117974_119021_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	5.48692e-73
NZ_CP031182.1\|WP_139588522.1\|105478_105907_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	1.22414e-14
NZ_CP031182.1\|WP_139588525.1\|121563_122610_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.38625e-74
NZ_CP031182.1\|WP_024525968.1\|103892_105335_-\|NADP-dependent-phosphogluconate-dehydrogenase	gnl\|CDD\|236453	PRK09287, PRK09287, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_CP031182.1\|WP_042522043.1\|105991_106429_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225064	COG2153, ElaA, Predicted acyltransferase [General function prediction only].	4.37487e-33

>NZ_CP031182.1|WP_065901546.1|112389_113748_-|transposase
MNIIRQKNTENELHNIVHQFTSLIGLSKLTKLVNYRRNSEISLMKVIEWLLTTKFLGRSLYRAHETPNFTSRTVRNNLNDGRINWQRLICQVGSHLIKHLRPFIDRRRRLALIIDDTLFSREYATQTELLARVFDHDKQLYIKGYRALTLGWSDANTFLPINFALMSSKKPQNVLGKSAKTTDQRTIAGRRRRQAQQKMNLVSLQLVKQALANGVLADYVLFDSWYSSPKMFYELTKLGLNGVGMLKRSSKIYYQYRGRQYSVKALYKRLQASKYQPKQAYQYSCFVEAHVGNQKFKLRLVFVANRARQDDYLVLATTQLGLQPQEIIQLYARRWQIENYFKVAKQYLRLDKSQVQNYDGLCGHLAIVMMTYDLLAWQERQNQDDRTIGDLFFIMNEAMPDIELSQALVWLLNSLKTIINHEVYARRAQIIQMMNQFFTFLPKRLVSLLTAS
>NZ_CP031182.1|WP_024525964.1|109466_110954_-|glucose-6-phosphate-dehydrogenase
MATERTALFMFFGGTGDLAYRKLYPSLFNLYRKGNLRTHFAVIGTSRQSIDDDKFRAAVKKSLADSGNRADSKEASDFISHFYYQSHDVTDTAHYSVLKELAEKLDKKYKLQGNRIFYLSMAPQFFGTIAQDLKTQGLMSTDKDAFNRLVIEKPFGRDFDSAKQLNDALSKSFEEEQIFRIDHYLGKEMIQNIEALRFGNTLVESLWNNRYIDNIQVTLSEKLGVEERASYYDNSGALRDMVQNHIMQIVSLLAMEQPVAFTDTDIRAEKVKALRSLRVYNVADAATNFVRGQYGSVNDQPDYRHEDNVPVDSTTETFVAGKLLFDNYRWSGTPFYVRTGKMLADKFTRVDVVFKRPLVDIFAFPQSQNTPLAANVLTIFVEPHAGFSLQLNAKTNDTGFQTEPIKLDYIVGAEKSKDTPEPYERLIHDVLKGDGTNFSSWPEVSYAWKFVDQIRRVWDLQEPNFPNYTPHSMGPAAAEELIQRDHREWIYRLNN
>NZ_CP031182.1|WP_087127911.1|108531_109248_-|hypothetical-protein
MTFSPLNVPILLLSTSLLTLTLANVQPVTAHATATSVSLAEKTTTSTATAQLFTSPVNQPLTLTADTYPLYNDEGQETTDILPGKQQLTTTKILVDPLAETTYYRVQENPDRFIKYDATTVNLKHTLTLNFSGPDGRTIKDPLMFRMTQGNDFDAIASDLKDQYAAVIDGFVFNKTTMDNTTDPYNTQFNFSYDKAGGSSTDESHTSIPASSLPSLSTLTNEKIRLTSPNDYSLYGRL
>NZ_CP031182.1|WP_087127908.1|108470_108563_+|ABC-transporter-ATP-binding-protein
MVNTILKEADLFCPNSVRINFTIYHIMNSH
>NZ_CP031182.1|WP_015473476.1|107514_108444_-|IS30-like-element-ISLpl1-family-transposase
MSSITYSERIKIETFCELGLSNIQMGVRLNRSPSTISYELSRCQPYQAELAQTDAEYKRSRCGRKTKLSDELKQKILNHLRLSWSPGMIAHEFKLATKSIYNWLNQGRIDFSLNDLPEHGVRQRRNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQVMLTNLSKNSD
>NZ_CP031182.1|WP_087129316.1|106512_107268_-|hypothetical-protein
MLDTGLVTGDDLNNLIKELQTWQPTIDGYTYQGVSPTADTLTFKYTPTSASSSSDTSSSTSSSSQPSSSTSTDSTASSDTHNSVVTSASSTRPDKSIVPKGAAVTAIRKIGLYRDVQFTKQNRRHWYQRQPQTKRPQFVVTGYARTKAGTLRYQIRDVNHRSATDGQRGYITANSKFVMPTYYQTAPKRIKVISPHGVNAYHQINLTQKKRHYRVGTTITVKAIKSYHLTTRLVISNGTYVTANKILVAKK
>NZ_CP031182.1|WP_042522043.1|105991_106429_+|GNAT-family-N-acetyltransferase
MEWQAKSFDELSREEFFDIAYERIRTFVMAQHRPYQEIDATDKVARHILGYQAEQLVAYARVFREAGHVTFGRVLTIPEQRGTGLGRQLMVQIEAEIRRNFAGEAISIEAQIDKQHFYEKFGYAAIGAVFDFNGTPHIRMDKAGL
>NZ_CP031182.1|WP_139588522.1|105478_105907_-|MarR-family-transcriptional-regulator
MPNAFRSIGLIARATAAMGNQLFQADDLNNNQFIFLMRIVETPGITQAELATQLHVDPSTCLRAVRKLIATQYVTRGTDAHDKKRRPLLATAEGQAMYPALEDYEQQILSVGTQGLSTGETALLEELLAKVARNVRDYQNQH
>NZ_CP031182.1|WP_024525968.1|103892_105335_-|NADP-dependent-phosphogluconate-dehydrogenase
MADQKANIGVVGMAVMGKNLALNIESRGYTVGIYNRSANKTEQVMKDHSEKKLVPSYTVEDFVKSLETPRRILLMVKAGKPTDAVIHELLPLLDKGDVLIDGGNTNFHDTMARNAELDKSGINFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKIAAKAPQDGKPCVTYIGPNGAGHYVKMVHNGIEYGDEELIDESYNIMRNVAGISVDDMADIFKEWNKGELDSYLIEITADILTRKDDLGDDKNLPIVDAIKDRGNNKGTGKWSSEDALDVQVPQSVITESVYARYISMLKDERVKASKVLPAAEKQGKADIADKDKFVEEVRQALFFGKLMSYAQGFEQLRFASEANDWDLKFGELAQIWRGGCIIRAQFLQNITDAFDKDPKLSNLLFDDYFKDIAGKYQQSIRDVVAMAVQAGIPVPSLSAAITYYDSFRAEVLPANLLQAQRDYFGAHTYERNDREGNFHYSWYEEQ
>NZ_CP031182.1|WP_024525970.1|102609_102873_+|hypothetical-protein
MTENVVLAPPEALELAKHLDEWAKWRQTHDRTTADMDWDQFIAKSREKAQWQAGLATEIDHWESLHAIQLALTDNLMGTAHGGHTRQ
>NZ_CP031182.1|WP_039106905.1|114670_115246_+|TetR/AcrR-family-transcriptional-regulator
MREKDTAKQTSIIDEVSNIILNEGIAAVSMSKIAKASGISSSTIYVYFTDKEDVLKQVYLAKKEMLATFLLKNIEATTDNPVIFAQQFMRALYEFGMQYYEALMIIEQFNSSPVRNNLQISQAESYRGFERLFEATSHAPQFVTDSAAVILGFAYAPIVLYVKARKTNQLAAQTISIEQVIDMCMHALLKE
>NZ_CP031182.1|WP_042522038.1|116843_117686_-|aldo/keto-reductase
MEKTFTFDSDLTVNRLGYGTMQLTGDGVWGPVADPDNAVKVIETAIDHGVNFIDTADAYGPFYANLYLRDALKNRPDNHVMVATKVGNTRQGPDVWTPVGVPAYLRQQVEMNLFTLGLDHIDLLQLHRVDPNVPLADQIGVLKDMQDEGKIKHIGLSQVSVDQLKEATAIAPIVSVQNMYNLSNRQDEDVLDYADAHHIAFIPWFPLATGELIKDATLTNIAQKYSASPAQIALAWLLKRSDVILPIPGTKSSDHELQNIQAQDIDLSQADFDALKALAK
>NZ_CP031182.1|WP_139588523.1|117974_119021_+|IS30-family-transposase
MQEQLTISRRKGHHLTEIERGIIAALHAAGASNRAITKSIGVCPQTINNELRRGQTRQVKRVNGKLRPFSKYLPDAAHTRYLMNRLRCHRSSKFDQCQAFLNYFVEHFKTDDWSPDEAVGRAKHDCKFLAEEMVSTSTLYHYIDAQLLEIRNIDLTEKTQRRIAHHYIPKNKKRLGPGIEERSQAANDRSEFGHFEIDTIVGKRNGHESVVLNLIERQTRTAILRLIDGRDADSVAYAMQDIKRQYGHLIRSITADNGPEFSTLAAVMTDTAPVYFAHPYTSCERGTNEVHNRMIRRDLPKGLSLDTVSPARIATIQAKLNGSPRRLLDYDTPAERFAIAAGSAQRLD
>NZ_CP031182.1|WP_095347822.1|119163_120084_+|IS30-like-element-ISLsa1-family-transposase
MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDRVKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIATAYNLSTASIYNWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRACSD
>NZ_CP031182.1|WP_139588524.1|120601_121417_-|hypothetical-protein
MKKFMVALTGLVTLATVGATVQATAVTTAHAATKSTYVSPSLKVNAIYTTSTKVAGTATKGSKITVKATKNAKTNLASGTASKTTGKYSIKLSKKLKKNANVYVYATNSKTKAYFYRIIRVQAASTKAATTKSTSTKKTTTKKTTTKKSTTSSKTSAASFSVKTPTGTWTSNTANKYSQKWVFSQKTGLNEYLYKNGKKVKTLVSYAKYSVSAKTPTFWKITYTPKGSKTKQTMYLRFTSAKKFKVVNSKNQVISTKAGVAPAAKWAFTKA
>NZ_CP031182.1|WP_139588525.1|121563_122610_-|IS30-family-transposase
MQEQLTISRRKGHHLTEIERGIIAALHAAGASNRAIAKSIGVCPQTINNELRRGQTRQVKRVNGKLRPFSKYLPDAAHTRYLMNRLRCHRSSKFDQCQAFLNYFVEHFKTDDWSPDEAVGRAKHDCKFLAEEMVSTSTLYHYIDAQLLEIRNIDLTEKTQRRIAHHYIPKNKKRLGPGIEERSQAANDRSEFGHFEIDTIVGKRNGHESVVLNLIERQTRTAILRLIDGRDADSVAYAMQDIKRQYGHLIRSITADNGPEFSTLAAVMTDTAPVYFAHPYTSCERGTNEVHNRMIRRDLPKGLSLDTVSPARIATIQAKLNGSPRRLLDYDTPAERFAIAAGSAQRLD
>NZ_CP031182.1|WP_021742820.1|123097_123571_+|class-Ib-ribonucleoside-diphosphate-reductase-assembly-flavoprotein-NrdI
MQPIRILFISIEGNTRNFVENLTAYAAKQHASQPELPEITATEISETSDLTDETQPFFCFVPTYLDGGNGIDNGVKELMTNVLGEYIAYHHNAQQLLGVVGSGNRNFNEQYCLTAKRYATTFGVPFIADYELRGVPRDETRIYDALVNRLKEVTPAS
>NZ_CP031182.1|WP_087128068.1|123567_124314_+|NADPH-dependent-oxidoreductase
MNPTLTTLFNHRSIRQFTPEKLTTDEVATLITAAQHAATSTFSQQYSVISVTDPAKLAVLGDITGHHWLEQAGHYFVMVADQYRNQQLVPPTATTTTNLHSLDKLLAGVFDAAIATEAIVTAGESLNLGSTIMGSILNDAARVIDLLDLPKLTFPVLGLAIGHPTEHPEQKPRLPQDLMHFTNGYQALTADNARLAAYDQVIHDYYQQRGTHQRDETFSHHIVSEMSRDPQQRAGILQALQQQGFLTK
>NZ_CP031182.1|WP_139588526.1|124462_125122_-|TetR-family-transcriptional-regulator
MATENERRQQMIRRITQTIVQNGFADLKMEKIAKLMGVSRTKMYQYYSCKTAIMTDVVARYLEFMATRSVPQSVDAKTSVTNFPQVILNLANLIASSSQKFRRDLAQADEELSEQFEESYASWCHQVRDFLTNGVTNGAFNSSLQPELFLIQMEATVAALMQPRVLTQHKVVTQNVLREYLQLVITQVVAPKYRAQINLDAVEPDLEHLTLKYQQTLTK
>NZ_CP031182.1|WP_042522032.1|125286_126756_+|MFS-transporter
MTETRRRIITFGLLLANIMAGFEGTIISTAMPTIVADLHGLSLMNWGFTIYFLFNAIGTPIWGRVADIIGRKRSFLFGTAIFVIGSLLEGLATNMIWLIIARGIMGIGAGGMLAIPFIIFSEIYPVDQRASVFGFTAAFGGISAVCGPLLGGWIIDVLNWHWVFFINIPIGIISILIVYFAFREESKERHAKIDVWGSLSLSIVILAFLLGVQLIGQSHTPVIWAIAFLLIAIVFGFLFVRIERNTHDPLIPLHLFKNKDMLLWDLMAFVGMGFYISFSVYIPMWAQGILLTSALAGGATQIPTAGLWYSGSRFGSYLSKKRNHHLTAVLALSFALIGTLVLLALGMTPNYAFFIIVGALLGIALGMLLTTSQVGVSEAVTSNDLAVATTLNRLFNTLGQTIMTAIYGLVFNIVVNHQATKLGLPSAKISGLTNSAVTSDSKAQLLIMHHVLFAGIKSVLIVAFVLLLVALVLEIGNIHLTRIKKQSVQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031182_1	1.5\|114234\|29\|NZ_CP031182\|PILER-CR	114234-114262	29	LN713926	Pseudomonas fluorescens SBW25 plasmid pQBR57, complete sequence	272051-272079	6	0.793

1. spacer 1.5|114234|29|NZ_CP031182|PILER-CR matches to LN713926 (Pseudomonas fluorescens SBW25 plasmid pQBR57, complete sequence) position: , mismatch: 6, identity: 0.793

tcattccgtgcttcatggtgtagcctcct	CRISPR spacer
tgagcaggtgcttcatggtggagcctcct	Protospacer
* * .  ************* ********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9655 : 73770

Bacillus_phage(17.65%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011373852.1\|9655_10576_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_011666822.1\|10786_11083_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_011666824.1\|11710_11947_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_139588508.1\|15424_16198_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_139588509.1\|16315_17587_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_087128657.1\|19023_20625_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_139588510.1\|21150_22176_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_087128673.1\|23105_23339_+	permease	Q6A1Z9	Oenococcus_phage	4.3e-05	50.9
WP_139588511.1\|23675_25691_+	hypothetical protein	NA	NA	NA	NA
WP_011666833.1\|25759_26218_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_087128660.1\|26393_26612_+	hypothetical protein	NA	NA	NA	NA
WP_087128663.1\|27137_28526_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.6e-131	56.1
WP_087128666.1\|29950_30490_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_139588512.1\|30630_31806_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	1.1e-53	36.0
WP_024526026.1\|31879_32149_+	hypothetical protein	NA	NA	NA	NA
WP_139588513.1\|32596_34207_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_065901546.1\|34449_35808_-\|transposase	transposase	NA	NA	NA	NA
WP_021741337.1\|35970_36216_+	hypothetical protein	NA	NA	NA	NA
WP_139588514.1\|36263_37265_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_086989537.1\|38128_38904_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_011666843.1\|40576_41293_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.0e-41	39.6
WP_139588515.1\|41337_43194_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	7.1e-34	34.6
WP_021741328.1\|43180_44482_+	YycH protein	NA	NA	NA	NA
WP_087128985.1\|44504_45359_+	hypothetical protein	NA	NA	NA	NA
WP_087128987.1\|45504_46332_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	1.3e-32	34.5
WP_087128989.1\|46478_47825_+	PDZ domain-containing protein	W5SAB9	Pithovirus	5.4e-07	26.2
WP_087128991.1\|48357_48837_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_087128996.1\|48957_49803_+	DUF4393 domain-containing protein	NA	NA	NA	NA
WP_050894571.1\|49768_50698_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_087127842.1\|50724_50844_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_139588516.1\|50868_51628_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.7e-26	50.9
WP_087129025.1\|51910_52204_+	hypothetical protein	NA	NA	NA	NA
WP_139588517.1\|52228_52561_+	hypothetical protein	NA	NA	NA	NA
WP_139588518.1\|52475_53219_+	NlpC/P60 family protein	F8WPZ7	Bacillus_phage	3.3e-14	37.4
WP_087129033.1\|53640_55134_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	4.7e-12	26.0
WP_021742006.1\|55543_56152_+	LysE family transporter	NA	NA	NA	NA
WP_087129036.1\|56345_56777_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_139588958.1\|56881_57856_+	alpha/beta hydrolase fold domain-containing protein	A0A167RJ59	Powai_lake_megavirus	7.0e-65	42.0
WP_042520568.1\|57980_58925_+	ADP-ribosylglycohydrolase	A0A1S6UB21	Serratia_phage	5.4e-22	28.7
WP_042520566.1\|59627_59942_-	hypothetical protein	NA	NA	NA	NA
WP_035464723.1\|59981_60554_-	permease cadmium resistance protein	NA	NA	NA	NA
WP_035464720.1\|60642_61074_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021741997.1\|61116_61629_-	GtrA family protein	NA	NA	NA	NA
WP_139588519.1\|62810_63800_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_042520564.1\|65294_65930_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042520563.1\|66024_67344_+	ABC transporter permease	NA	NA	NA	NA
WP_087128015.1\|68265_69207_+	DMT family transporter	NA	NA	NA	NA
WP_087129238.1\|69372_70221_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_011666874.1\|70234_70564_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_042520559.1\|70661_71399_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_139588520.1\|71708_72275_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_139588509.1\|72498_73770_+\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

90057 : 166401

unidentified_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081374820.1\|90057_91569_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_042749724.1\|91746_92661_+	hypothetical protein	NA	NA	NA	NA
WP_024525976.1\|98317_99604_+	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_042522237.1\|100694_101258_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_021741909.1\|101365_101713_-	hypothetical protein	NA	NA	NA	NA
WP_042522047.1\|101876_102518_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_024525970.1\|102609_102873_+	hypothetical protein	NA	NA	NA	NA
WP_024525968.1\|103892_105335_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.4e-37	28.9
WP_139588522.1\|105478_105907_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_042522043.1\|105991_106429_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_087129316.1\|106512_107268_-	hypothetical protein	NA	NA	NA	NA
WP_015473476.1\|107514_108444_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_087127908.1\|108470_108563_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_087127911.1\|108531_109248_-	hypothetical protein	NA	NA	NA	NA
WP_024525964.1\|109466_110954_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	2.3e-67	32.6
WP_065901546.1\|112389_113748_-\|transposase	transposase	NA	NA	NA	NA
WP_039106905.1\|114670_115246_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042522038.1\|116843_117686_-	aldo/keto reductase	NA	NA	NA	NA
WP_139588523.1\|117974_119021_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.2e-33	32.0
WP_095347822.1\|119163_120084_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-50	38.2
WP_139588524.1\|120601_121417_-	hypothetical protein	NA	NA	NA	NA
WP_139588525.1\|121563_122610_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.2e-34	32.3
WP_021742820.1\|123097_123571_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_087128068.1\|123567_124314_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_139588526.1\|124462_125122_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_042522032.1\|125286_126756_+	MFS transporter	NA	NA	NA	NA
WP_087128065.1\|126858_127473_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_139588527.1\|127563_128910_-	MFS transporter	NA	NA	NA	NA
WP_087128688.1\|131016_132537_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	6.4e-41	27.4
WP_021742818.1\|132635_134069_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_042522025.1\|134238_134418_+	hypothetical protein	NA	NA	NA	NA
WP_139588528.1\|134577_135351_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_087128682.1\|135413_136382_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_011666918.1\|136443_137799_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_011666919.1\|138006_138363_+	hypothetical protein	NA	NA	NA	NA
WP_087128685.1\|138641_139067_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_139588959.1\|139278_140760_+	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_011666922.1\|140947_141796_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.0e-55	43.6
WP_139588529.1\|142257_144597_+	HAD-IC family P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	3.9e-29	22.7
WP_011666925.1\|144685_145210_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_139588530.1\|145264_147058_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_087128127.1\|147418_150037_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_087128129.1\|150499_151075_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_139588531.1\|151579_152230_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	1.1e-16	67.7
WP_087128749.1\|152452_152803_+	aggregation promoting factor surface protein	NA	NA	NA	NA
WP_041816398.1\|152931_153180_-	hypothetical protein	NA	NA	NA	NA
WP_087128751.1\|153368_153986_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_087128753.1\|154118_154964_+	5-dehydro-4-deoxy-D-glucuronate isomerase	NA	NA	NA	NA
WP_087128756.1\|154981_155962_+	sugar kinase	NA	NA	NA	NA
WP_087128758.1\|156085_157273_+	acetate kinase	NA	NA	NA	NA
WP_087128760.1\|157558_158056_+	hypothetical protein	NA	NA	NA	NA
WP_087128763.1\|158108_159731_-	permease	NA	NA	NA	NA
WP_139588532.1\|159736_160630_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-21	26.6
WP_139588533.1\|160798_161455_+	HD domain-containing protein	S4W232	Pandoravirus	1.3e-14	33.8
WP_087128769.1\|164189_165092_+	decarboxylating 6-phosphogluconate dehydrogenase	A0A222YX62	Synechococcus_phage	8.2e-52	35.4
WP_087128238.1\|165369_166401_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.4e-41	33.2

DBSCAN-SWA_3

334128 : 387158

Staphylococcus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003561746.1\|334128_335304_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_139588556.1\|335397_336321_+	hypothetical protein	NA	NA	NA	NA
WP_139588557.1\|336448_337432_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_139588558.1\|337516_339589_-	sodium:proton antiporter	NA	NA	NA	NA
WP_043022543.1\|339781_340384_+	4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein	NA	NA	NA	NA
WP_139588510.1\|341685_342711_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_035464148.1\|342977_343193_+	hypothetical protein	NA	NA	NA	NA
WP_139588559.1\|343260_344595_-	Sapep family Mn(2+)-dependent dipeptidase	NA	NA	NA	NA
WP_139588560.1\|344621_346136_-	YfcC family protein	NA	NA	NA	NA
WP_021741055.1\|346236_347067_-	response regulator	NA	NA	NA	NA
WP_024526334.1\|347063_348362_-	sensor histidine kinase	NA	NA	NA	NA
WP_139588561.1\|348462_350025_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_011668704.1\|351389_352622_+	arginine deiminase	NA	NA	NA	NA
WP_139588562.1\|352664_353696_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_011668702.1\|353772_355185_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_087128029.1\|355195_356305_+	aminotransferase	NA	NA	NA	NA
WP_039106124.1\|356332_357277_+	carbamate kinase	NA	NA	NA	NA
WP_004561985.1\|357462_358452_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_021741913.1\|358495_359140_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_080662538.1\|359227_359944_+	hypothetical protein	NA	NA	NA	NA
WP_021741915.1\|360041_360443_-	hypothetical protein	A0A0E3XCL7	Enterococcus_phage	7.2e-16	58.6
WP_021741916.1\|360665_361232_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_139588563.1\|361228_362770_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	8.3e-28	27.9
WP_024526340.1\|363147_364539_+\|tRNA	asparagine--tRNA ligase	M1PB22	Moumouvirus	1.7e-80	36.3
WP_042749577.1\|364633_365548_-	hypothetical protein	NA	NA	NA	NA
WP_024526342.1\|365801_366059_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_021741920.1\|366629_366812_+	hypothetical protein	NA	NA	NA	NA
WP_015474303.1\|366828_367248_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_021741921.1\|367259_367670_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_075168469.1\|367844_369194_+\|transposase	transposase	NA	NA	NA	NA
WP_139588564.1\|369356_369719_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021741923.1\|369854_370583_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_086989966.1\|371169_371826_+	hypothetical protein	NA	NA	NA	NA
WP_024526347.1\|371967_372756_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_139588565.1\|372876_373683_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_042520866.1\|373900_375076_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_021741931.1\|375149_375902_+	HAD family phosphatase	NA	NA	NA	NA
WP_042520870.1\|375990_376464_+	glutathione peroxidase	NA	NA	NA	NA
WP_087129207.1\|376529_377492_-	serine hydrolase	NA	NA	NA	NA
WP_011668679.1\|377703_378078_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_021741934.1\|378070_378781_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-11	26.2
WP_042520872.1\|378773_379529_+	hypothetical protein	NA	NA	NA	NA
WP_087129205.1\|379694_380477_+	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_042520875.1\|380542_381256_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_042520876.1\|381563_382097_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_139588566.1\|382124_383894_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.9e-105	40.3
WP_042520879.1\|383987_384602_+	pyroglutamyl-peptidase I	NA	NA	NA	NA
WP_139588510.1\|384967_385993_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_004561985.1\|386168_387158_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5

DBSCAN-SWA_4

431985 : 480925

Staphylococcus_prophage(18.18%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075168469.1\|431985_433335_-\|transposase	transposase	NA	NA	NA	NA
WP_042520933.1\|433609_434218_+	sugar O-acetyltransferase	A0A191KBJ5	Streptococcus_virus	3.0e-05	33.6
WP_087127730.1\|434233_434323_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_024855727.1\|434349_435279_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_004561985.1\|435745_436735_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_011668608.1\|436772_438353_+	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_021742650.1\|438464_438923_+	universal stress protein	NA	NA	NA	NA
WP_041815579.1\|439058_439751_+	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_011668605.1\|439689_440082_-	DUF488 family protein	NA	NA	NA	NA
WP_039106069.1\|440143_440776_+	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_051345754.1\|440817_441684_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588571.1\|442193_442910_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_042520940.1\|442925_443723_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_011668598.1\|444204_445617_+	MFS transporter	NA	NA	NA	NA
WP_024526406.1\|445685_446129_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_087128833.1\|446215_447034_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_039106063.1\|447048_447909_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_139588572.1\|447928_449152_-	MFS transporter	NA	NA	NA	NA
WP_139588573.1\|449308_450037_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.6e-05	24.3
WP_139588574.1\|450030_450210_+	hypothetical protein	NA	NA	NA	NA
WP_042520950.1\|450262_451981_+	hypothetical protein	NA	NA	NA	NA
WP_021741742.1\|452039_452717_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_024526414.1\|452713_453052_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588575.1\|453211_454225_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_042520952.1\|454297_455263_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_139588576.1\|455276_456071_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_011668590.1\|456080_457199_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_042520956.1\|457531_458554_+	galactose mutarotase	NA	NA	NA	NA
WP_139588577.1\|458575_460306_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	8.9e-180	53.6
WP_021741749.1\|460594_460840_+	hypothetical protein	NA	NA	NA	NA
WP_024526421.1\|460891_462316_+	sodium:solute symporter	NA	NA	NA	NA
WP_021741751.1\|462475_463645_+	galactokinase	NA	NA	NA	NA
WP_011668584.1\|463721_464726_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	6.7e-55	39.1
WP_139588578.1\|464729_466193_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_086989602.1\|466215_467226_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_024526425.1\|468245_468431_+	hypothetical protein	NA	NA	NA	NA
WP_086989600.1\|468914_471167_+	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	S5Y360	Mycobacterium_phage	8.0e-88	33.6
WP_087128840.1\|471271_471742_-	hypothetical protein	NA	NA	NA	NA
WP_139588579.1\|471734_472400_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-24	34.7
WP_139588580.1\|472410_473100_-	hypothetical protein	NA	NA	NA	NA
WP_042520970.1\|473089_473881_-	hypothetical protein	NA	NA	NA	NA
WP_042520971.1\|474267_474801_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_087127905.1\|474901_476857_-	peptidase M13	A0A1V0SHG2	Klosneuvirus	7.7e-79	29.0
WP_139588581.1\|476993_477497_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_139588582.1\|477772_478462_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_139588510.1\|478559_479585_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_011373852.1\|480004_480925_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_5

717019 : 775255

Bacillus_phage(21.43%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011373852.1\|717019_717940_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_139588964.1\|718046_718289_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_139588628.1\|718292_719318_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-41	35.8
WP_139588629.1\|719410_719977_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_139588630.1\|719915_720038_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_062916767.1\|720064_720994_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_139588631.1\|720994_722116_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_042749459.1\|722159_723233_+	LytR family transcriptional regulator	NA	NA	NA	NA
WP_042521135.1\|723350_724358_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.3e-69	41.3
WP_052471674.1\|724454_725402_-	phosphoglycerate dehydrogenase	NA	NA	NA	NA
WP_021742717.1\|725690_727142_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_021742718.1\|727134_728145_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_139588632.1\|728241_729975_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	2.1e-19	22.3
WP_042521137.1\|729971_731711_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	6.0e-27	24.9
WP_065201539.1\|732025_733003_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_024526595.1\|733111_734020_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_011668337.1\|734106_734682_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_087128251.1\|734777_735929_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_086231927.1\|736164_738390_+	DNA helicase PcrA	A7KV33	Bacillus_phage	2.0e-123	39.4
WP_042521141.1\|738415_740446_+	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	3.8e-97	34.6
WP_086989530.1\|740468_741614_+	CamS family sex pheromone protein	NA	NA	NA	NA
WP_011668332.1\|742054_742366_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_139588633.1\|742366_743836_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_011668330.1\|743835_745257_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_011668329.1\|745276_746296_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	4.8e-16	27.1
WP_024748245.1\|746507_747431_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.7e-31	30.7
WP_021742731.1\|749018_749450_+	EutP/PduV family microcompartment system protein	NA	NA	NA	NA
WP_011668322.1\|749655_750363_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	4.9e-28	29.8
WP_139588634.1\|750761_751682_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-50	38.2
WP_139588965.1\|751787_753047_+	L-fucose:H+ symporter permease	NA	NA	NA	NA
WP_075168828.1\|753095_754415_-	amino acid permease	NA	NA	NA	NA
WP_015473960.1\|754552_755911_-	permease yojA	NA	NA	NA	NA
WP_139588635.1\|757826_758708_+	SIS domain-containing protein	NA	NA	NA	NA
WP_024526618.1\|758763_759525_+	lysozyme M1 (1,4-beta-N-acetylmuramidase)	NA	NA	NA	NA
WP_011668285.1\|759597_759960_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_139588636.1\|760122_761127_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_021742758.1\|762654_762843_+	hypothetical protein	NA	NA	NA	NA
WP_011668281.1\|762919_763372_+	universal stress protein	NA	NA	NA	NA
WP_139588637.1\|763530_764886_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_139588638.1\|764971_765913_-	glycosyltransferase	V5USA4	Oenococcus_phage	1.3e-71	45.7
WP_024526624.1\|766107_767238_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.2e-22	27.2
WP_011668277.1\|767230_768082_+	NERD domain-containing protein	NA	NA	NA	NA
WP_087127983.1\|768097_769009_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_042521174.1\|769053_769503_-	flavodoxin	NA	NA	NA	NA
WP_011668274.1\|769717_770518_+	recombination regulator RecX	NA	NA	NA	NA
WP_042521177.1\|770548_771727_+	serine hydrolase	NA	NA	NA	NA
WP_011668272.1\|771830_772076_-	YdeI/OmpD-associated family protein	NA	NA	NA	NA
WP_011668271.1\|772239_772797_+	DUF402 domain-containing protein	NA	NA	NA	NA
WP_042521184.1\|772869_774012_+	AI-2E family transporter	NA	NA	NA	NA
WP_003561746.1\|774079_775255_-\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

790929 : 907017

109

Lactobacillus_phage(34.29%)

portal,terminase,protease,integrase,transposase,tail,holin,capsid

attL 837089:837105|attR 891522:891535

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087128001.1\|790929_793167_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	2.5e-126	41.0
WP_011668257.1\|793833_794100_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_024526639.1\|794099_795836_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_042521196.1\|796019_797198_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_042521197.1\|797210_798233_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011668252.1\|799348_799585_+	YkuJ family protein	NA	NA	NA	NA
WP_087128004.1\|799720_801778_+	LTA synthase family protein	W6LM83	Streptococcus_phage	7.1e-152	47.0
WP_042522195.1\|808923_809391_-	universal stress protein	NA	NA	NA	NA
WP_087129098.1\|809644_810181_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_042522036.1\|810278_811325_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	4.0e-34	32.3
WP_087129333.1\|811475_812096_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_087129332.1\|812479_812776_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588966.1\|812934_814302_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_075168469.1\|814874_816224_+\|transposase	transposase	NA	NA	NA	NA
WP_011667943.1\|816645_817527_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_011667942.1\|817696_818101_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_011667941.1\|818122_818485_+	hypothetical protein	NA	NA	NA	NA
WP_011667940.1\|818568_819666_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_024525483.1\|819860_820862_+	catabolite control protein A	NA	NA	NA	NA
WP_139588642.1\|820995_821838_+	hypothetical protein	NA	NA	NA	NA
WP_042750147.1\|821894_822635_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-30	37.4
WP_021742021.1\|822627_824106_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_011667935.1\|824384_825122_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_139588643.1\|825226_826192_+	Flp pilus assembly complex ATPase component	NA	NA	NA	NA
WP_139588967.1\|826199_827180_+	Type II secretory pathway/competence component	NA	NA	NA	NA
WP_042522337.1\|827172_827484_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_081374819.1\|827455_827920_+	type II secretion system protein	NA	NA	NA	NA
WP_042522340.1\|827891_828104_+	hypothetical protein	NA	NA	NA	NA
WP_042522342.1\|828100_828523_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_035465791.1\|828812_829835_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011667926.1\|829851_831042_+	acetate kinase	NA	NA	NA	NA
WP_087129327.1\|831247_832651_+	amino acid permease	NA	NA	NA	NA
WP_011667923.1\|833634_834243_+	metallophosphatase	A0A076G7D9	Bacillus_phage	1.1e-28	38.5
WP_139588644.1\|834302_835688_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_042750156.1\|835699_836371_+	YutD family protein	NA	NA	NA	NA
WP_087129325.1\|836383_837178_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
837089:837105	attL	NA	NA	NA	NA
WP_011667919.1\|837170_837800_+	TIGR01906 family membrane protein	NA	NA	NA	NA
837089:837105	attL	NA	NA	NA	NA
WP_139588645.1\|838398_839040_+	WxL domain-containing protein	NA	NA	NA	NA
WP_087129323.1\|839279_841511_+	hypothetical protein	NA	NA	NA	NA
WP_087129322.1\|841843_843697_+	hypothetical protein	NA	NA	NA	NA
WP_087129321.1\|845532_846327_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_039105195.1\|846344_847184_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.6e-70	48.2
WP_139588646.1\|847500_848163_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_052471712.1\|848235_848589_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_011667913.1\|848669_849335_-	membrane protein	NA	NA	NA	NA
WP_011667912.1\|849434_849944_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	4.2e-37	49.4
WP_024525458.1\|850065_850659_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	5.1e-26	41.9
WP_011667910.1\|850692_851082_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_087128481.1\|858179_859382_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_011667908.1\|859488_859992_-	monooxygenase	NA	NA	NA	NA
WP_042521204.1\|860115_860856_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011667906.1\|861059_861467_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_042521206.1\|861614_862340_+	adaptor protein MecA	NA	NA	NA	NA
WP_139588647.1\|862576_864061_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_024748245.1\|864133_865057_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.7e-31	30.7
864401:864417	attR	NA	NA	NA	NA
WP_011667902.1\|865306_866056_-	hypothetical protein	NA	NA	NA	NA
864401:864417	attR	NA	NA	NA	NA
WP_139588648.1\|866115_866985_-	hypothetical protein	NA	NA	NA	NA
WP_139588628.1\|867054_868080_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-41	35.8
WP_039105853.1\|868274_868754_-	hypothetical protein	NA	NA	NA	NA
WP_075168852.1\|868757_869165_-	helix-turn-helix transcriptional regulator	E3W8B9	Leuconostoc_phage	6.6e-09	37.2
WP_042521213.1\|869428_869644_+	hypothetical protein	NA	NA	NA	NA
WP_042521215.1\|869656_870415_+	Rha family transcriptional regulator	A0A2D1GPQ2	Lactobacillus_phage	7.2e-33	42.5
WP_139588649.1\|870950_871154_+	hypothetical protein	NA	NA	NA	NA
WP_011667895.1\|871242_871521_+	hypothetical protein	NA	NA	NA	NA
WP_087128323.1\|871657_871912_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588650.1\|872004_873363_-\|transposase	transposase	NA	NA	NA	NA
WP_011667893.1\|873643_873823_+	hypothetical protein	NA	NA	NA	NA
WP_087128321.1\|873815_874709_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	6.9e-27	31.1
WP_087128320.1\|874709_875408_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	1.6e-87	73.4
WP_087128317.1\|875404_875989_+	DUF669 domain-containing protein	D2KRE3	Lactobacillus_phage	2.1e-32	46.0
WP_139588651.1\|876004_876571_+	HNH endonuclease	A0A1W6JPN8	Staphylococcus_phage	3.2e-30	43.9
WP_139588652.1\|876571_877324_+	alpha/beta hydrolase	U5U793	Lactobacillus_phage	5.4e-33	39.1
WP_087127921.1\|877324_878569_+	hypothetical protein	A0A2D1GP91	Lactobacillus_phage	4.4e-56	35.3
WP_087127924.1\|878561_878975_+	hypothetical protein	NA	NA	NA	NA
WP_087127927.1\|878975_879677_+	hypothetical protein	A0A0D4DC57	Staphylococcus_phage	1.1e-27	34.4
WP_087127930.1\|879688_880075_+	hypothetical protein	NA	NA	NA	NA
WP_087127932.1\|880067_880283_+	hypothetical protein	NA	NA	NA	NA
WP_087127935.1\|880294_880492_+	hypothetical protein	NA	NA	NA	NA
WP_087127936.1\|880660_881110_+	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	1.0e-31	53.6
WP_139588653.1\|881163_881625_+	DUF1064 domain-containing protein	A0A2P0ZKV6	Lactobacillus_phage	1.3e-24	46.2
WP_047021008.1\|881638_881845_+	hypothetical protein	NA	NA	NA	NA
WP_087127940.1\|881860_882112_+	hypothetical protein	A0A0P0IJX1	Lactobacillus_phage	3.9e-20	67.9
WP_087127942.1\|882112_882367_+	hypothetical protein	NA	NA	NA	NA
WP_139588654.1\|882366_882690_+	hypothetical protein	NA	NA	NA	NA
WP_087127946.1\|882783_883239_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	2.6e-46	58.2
WP_139588655.1\|884664_884991_+	hypothetical protein	NA	NA	NA	NA
WP_087128371.1\|885053_885494_+	hypothetical protein	NA	NA	NA	NA
WP_087128368.1\|885526_886285_+\|terminase	terminase	V5URT8	Oenococcus_phage	1.8e-60	50.6
WP_087128366.1\|886291_886879_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	7.5e-22	33.5
WP_087128363.1\|887024_888341_+\|terminase	PBSX family phage terminase large subunit	V5UQR5	Oenococcus_phage	2.4e-161	62.1
WP_139588656.1\|888337_889870_+\|portal	phage portal protein	A0A0P0IJV3	Lactobacillus_phage	3.6e-76	37.3
WP_139588657.1\|889923_890697_+	hypothetical protein	Q597V7	Lactobacillus_virus	2.0e-06	23.2
WP_087128356.1\|890898_891576_+	DUF4355 domain-containing protein	A0A0P0ID10	Lactobacillus_phage	1.2e-28	52.9
WP_087128354.1\|891587_891989_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.2e-07	32.3
WP_087128352.1\|892006_893122_+\|capsid	major capsid protein	S5MNB6	Brevibacillus_phage	5.8e-47	33.5
WP_087128350.1\|893294_893645_+	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_011667858.1\|893641_894154_+	hypothetical protein	L7TME2	Rhizobium_phage	1.8e-08	35.2
WP_011667857.1\|894168_894468_+	hypothetical protein	NA	NA	NA	NA
WP_139588658.1\|894486_894846_+	hypothetical protein	NA	NA	NA	NA
WP_011667855.1\|894852_895341_+	hypothetical protein	NA	NA	NA	NA
WP_139588659.1\|895358_896510_+	DUF3383 family protein	NA	NA	NA	NA
WP_011667853.1\|896527_897010_+	hypothetical protein	NA	NA	NA	NA
WP_139588660.1\|897141_897765_+	hypothetical protein	NA	NA	NA	NA
WP_139588661.1\|898002_903705_+\|tail	phage tail tape measure protein	Q9AZS0	Lactococcus_phage	1.1e-61	34.8
WP_087128337.1\|903716_904640_+	hypothetical protein	NA	NA	NA	NA
WP_024855727.1\|904605_905535_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_087128786.1\|905561_905744_+	hypothetical protein	NA	NA	NA	NA
WP_042521253.1\|905786_906227_+	hypothetical protein	NA	NA	NA	NA
WP_015474081.1\|906612_907017_+\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	1.7e-17	41.4

DBSCAN-SWA_7

1182135 : 1191389

Staphylococcus_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087128292.1\|1182135_1182987_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	5.8e-15	33.6
WP_042750344.1\|1183974_1184466_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.6e-22	36.5
WP_042520532.1\|1184482_1185433_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	7.7e-117	61.8
WP_139588708.1\|1185443_1187336_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.6e-49	29.5
WP_042521398.1\|1187364_1188558_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	4.1e-35	39.7
WP_011667555.1\|1188691_1189630_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.2e-52	38.8
WP_139588709.1\|1189748_1191008_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011667553.1\|1191113_1191389_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5

DBSCAN-SWA_8

1222609 : 1288701

Pseudomonas_phage(11.76%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011667527.1\|1222609_1223533_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_087128627.1\|1223819_1224602_-	DNA repair protein RecO	NA	NA	NA	NA
WP_011667525.1\|1224624_1225530_-	GTPase Era	NA	NA	NA	NA
WP_011667524.1\|1225539_1225941_-	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_011667523.1\|1225918_1226407_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_021741036.1\|1226406_1227393_-	PhoH family protein	H6X2N1	Pseudomonas_phage	2.7e-48	48.1
WP_011667521.1\|1227638_1228085_-	GatB/YqeY domain-containing protein	A0A218KC79	Bacillus_phage	2.1e-08	29.9
WP_024525194.1\|1228122_1228497_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_087128625.1\|1228675_1229704_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_011667518.1\|1229766_1229955_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_042521412.1\|1230135_1230963_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_042521414.1\|1231060_1231990_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.6e-18	28.8
WP_139588714.1\|1231986_1233210_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_087128623.1\|1233229_1234039_-	ABC transporter permease	NA	NA	NA	NA
WP_081374787.1\|1234057_1235263_-	CDP-glycerol--poly(glycerophosphate) glycerophosphotransferase	NA	NA	NA	NA
WP_021741046.1\|1235377_1236253_-	YitT family protein	M1Q1P6	Streptococcus_phage	4.7e-20	27.5
WP_024525188.1\|1236368_1236896_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_139588715.1\|1237030_1238833_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_011667509.1\|1238846_1240142_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_139588716.1\|1240449_1240980_-	hypothetical protein	NA	NA	NA	NA
WP_139588717.1\|1241160_1242012_+	SH3 domain-containing protein	A0A0N6W8I1	Bacillus_phage	7.8e-12	29.5
WP_042521436.1\|1242032_1242878_+	fructosamine kinase family protein	NA	NA	NA	NA
WP_139588718.1\|1242931_1243573_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_042521422.1\|1243685_1244129_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_042750294.1\|1244147_1246382_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	S4TRQ0	Salmonella_phage	6.2e-08	43.6
WP_024525181.1\|1246410_1246746_-	hypothetical protein	NA	NA	NA	NA
WP_039104514.1\|1247567_1248518_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_035464235.1\|1248620_1248947_-	hypothetical protein	NA	NA	NA	NA
WP_024525178.1\|1249277_1249661_+	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_087128608.1\|1249882_1250245_+	hypothetical protein	NA	NA	NA	NA
WP_139588510.1\|1250813_1251839_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_087128208.1\|1252009_1252207_+	hypothetical protein	NA	NA	NA	NA
WP_087128308.1\|1252697_1253879_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011667492.1\|1254487_1254847_+	hypothetical protein	NA	NA	NA	NA
WP_139588719.1\|1255193_1256219_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_139588509.1\|1256454_1257726_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_042522036.1\|1258367_1259414_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	4.0e-34	32.3
WP_139588720.1\|1259591_1260512_+\|transposase	IS30-like element ISLsa1 family transposase	H7BW47	unidentified_phage	7.9e-26	35.5
WP_080662450.1\|1260604_1260706_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_139588721.1\|1261746_1263579_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	8.6e-24	27.5
WP_139588722.1\|1263759_1265049_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_011667999.1\|1265052_1265286_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_139588723.1\|1265323_1266532_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	8.2e-23	28.2
WP_139588724.1\|1266531_1268058_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9L3I8	Tupanvirus	6.0e-39	28.8
WP_011668002.1\|1268096_1268246_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_021741175.1\|1268547_1269696_-	molecular chaperone DnaJ	M1PC06	Moumouvirus	1.9e-16	28.3
WP_011668004.1\|1269813_1271673_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	2.8e-131	46.2
WP_011668006.1\|1272316_1273354_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_139588725.1\|1273605_1274553_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_024525170.1\|1274573_1275485_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_011668009.1\|1275565_1275916_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_139588726.1\|1275935_1278278_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.9e-20	24.2
WP_011668011.1\|1278325_1278628_-	hypothetical protein	NA	NA	NA	NA
WP_011668012.1\|1278620_1278917_-	YlxR family protein	NA	NA	NA	NA
WP_042521478.1\|1278943_1280149_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_087128077.1\|1280172_1280646_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_011668015.1\|1280772_1281048_-	hypothetical protein	NA	NA	NA	NA
WP_139588727.1\|1281248_1285586_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.0e-19	37.6
WP_039104488.1\|1285678_1287388_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_024525166.1\|1287423_1288701_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA

DBSCAN-SWA_9

1425216 : 1494001

Staphylococcus_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015473913.1\|1425216_1425864_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_139588754.1\|1425929_1426721_-	phosphotransferase	NA	NA	NA	NA
WP_087128876.1\|1426782_1428009_-	ABC transporter permease	NA	NA	NA	NA
WP_042522165.1\|1428005_1428740_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.5e-23	28.3
WP_042522204.1\|1428958_1429408_+	HIT family protein	NA	NA	NA	NA
WP_042522166.1\|1429410_1429731_+	hypothetical protein	NA	NA	NA	NA
WP_011668209.1\|1429843_1430761_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_087128873.1\|1430825_1431800_-	HD domain-containing protein	NA	NA	NA	NA
WP_139588755.1\|1431812_1434437_-	AAA family ATPase	NA	NA	NA	NA
WP_139588756.1\|1434426_1435641_-	DNA repair exonuclease	NA	NA	NA	NA
WP_042522167.1\|1435724_1436069_-	hypothetical protein	NA	NA	NA	NA
WP_042750200.1\|1436160_1438257_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_011668215.1\|1438422_1438890_-	arginine repressor	NA	NA	NA	NA
WP_139588757.1\|1439128_1440820_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	31.8
WP_011668217.1\|1441291_1441513_-	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_139588758.1\|1441846_1443106_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	1.4e-17	40.0
WP_087129342.1\|1443166_1443700_+	dihydrofolate reductase	NA	NA	NA	NA
WP_021742195.1\|1443766_1444108_+	DUF1516 family protein	NA	NA	NA	NA
WP_139588759.1\|1444171_1446133_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_087129344.1\|1446372_1448097_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_139588760.1\|1448119_1450144_-	transketolase	NA	NA	NA	NA
WP_042522172.1\|1450185_1451553_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_021742200.1\|1451585_1451885_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_087129346.1\|1451884_1452334_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_021742202.1\|1452512_1453226_-	amino acid racemase	NA	NA	NA	NA
WP_042522174.1\|1453232_1454489_-	carboxylate--amine ligase	NA	NA	NA	NA
WP_039107568.1\|1454623_1456507_-	asparagine synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
WP_021742205.1\|1456650_1457379_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_139588761.1\|1457487_1458894_+	C69 family dipeptidase	NA	NA	NA	NA
WP_011668226.1\|1458963_1459200_+	hypothetical protein	NA	NA	NA	NA
WP_039107575.1\|1459348_1461151_-	hypothetical protein	NA	NA	NA	NA
WP_139588762.1\|1461504_1463214_-	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_004561985.1\|1463330_1464320_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_021742209.1\|1464490_1464742_-	hypothetical protein	NA	NA	NA	NA
WP_003561746.1\|1465184_1466360_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_086989537.1\|1466901_1467676_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_139588763.1\|1467774_1468176_+	hypothetical protein	NA	NA	NA	NA
WP_042521211.1\|1468294_1469155_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_087128214.1\|1469184_1471695_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-139	32.5
WP_075168782.1\|1472068_1472362_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_015473929.1\|1472352_1472871_-	VanZ family protein	NA	NA	NA	NA
WP_015473930.1\|1473426_1473903_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_035464831.1\|1474941_1475187_-	hypothetical protein	NA	NA	NA	NA
WP_139588764.1\|1475336_1476299_+	NAD(P)-binding domain-containing protein	A0A1B1IVB5	uncultured_Mediterranean_phage	5.9e-24	28.3
WP_139588765.1\|1476517_1479232_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_087128210.1\|1479244_1479916_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_021742218.1\|1479969_1480740_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011668241.1\|1480893_1481541_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	9.1e-45	45.9
WP_139588766.1\|1481649_1482639_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.4e-59	40.5
WP_011668242.1\|1482695_1483022_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_042522189.1\|1483095_1484571_-	MFS transporter	NA	NA	NA	NA
WP_015473935.1\|1484776_1485964_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.5e-149	69.4
WP_021742222.1\|1487019_1487361_+	hypothetical protein	NA	NA	NA	NA
WP_139588767.1\|1487408_1487978_-	hypothetical protein	NA	NA	NA	NA
WP_024526645.1\|1488183_1488507_+	heavy metal-binding domain-containing protein	M4STD1	Rhodobacter_phage	9.2e-06	35.6
WP_139588768.1\|1489991_1490588_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_087128950.1\|1490601_1492059_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_042750138.1\|1492073_1492760_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_139588628.1\|1492975_1494001_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-41	35.8

DBSCAN-SWA_10

1537690 : 1653618

109

Staphylococcus_phage(24.14%)

portal,terminase,tRNA,transposase,tail,head,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139588779.1\|1537690_1540357_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.2e-160	42.7
WP_011668123.1\|1540660_1541170_-	thiol peroxidase	NA	NA	NA	NA
WP_139588628.1\|1541404_1542430_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-41	35.8
WP_011668124.1\|1542527_1543745_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_139588780.1\|1543765_1544911_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_011668127.1\|1546981_1547449_+	GAF domain-containing protein	NA	NA	NA	NA
WP_021742864.1\|1547648_1548254_+	30S ribosomal protein S4	NA	NA	NA	NA
WP_011668129.1\|1548523_1548859_+	hypothetical protein	NA	NA	NA	NA
WP_042522412.1\|1548903_1549503_-	DUF1054 family protein	NA	NA	NA	NA
WP_042522410.1\|1549579_1550035_+	YueI family protein	NA	NA	NA	NA
WP_035465114.1\|1550078_1551329_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.4e-96	49.4
WP_139588510.1\|1551717_1552743_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.4e-41	35.5
WP_011668133.1\|1552925_1553213_+	hypothetical protein	NA	NA	NA	NA
WP_011668134.1\|1553309_1553789_+	universal stress protein	NA	NA	NA	NA
WP_042522408.1\|1553882_1554767_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588781.1\|1555096_1556713_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_024525518.1\|1556722_1557865_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_042522402.1\|1557939_1558911_-	DUF2785 domain-containing protein	NA	NA	NA	NA
WP_087129302.1\|1558941_1559787_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_011668140.1\|1559909_1560212_-	glycine cleavage system protein H	NA	NA	NA	NA
WP_011668141.1\|1560225_1561431_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_011668142.1\|1561526_1561751_-	DUF2969 domain-containing protein	NA	NA	NA	NA
WP_011668143.1\|1561763_1562063_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	9.7e-18	52.5
WP_021742853.1\|1562087_1563095_-	rod shape-determining protein	NA	NA	NA	NA
WP_024525522.1\|1563223_1564531_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_011668146.1\|1564557_1564788_-	DUF1146 domain-containing protein	NA	NA	NA	NA
WP_139588509.1\|1565038_1566310_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011668147.1\|1566472_1566892_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_021742850.1\|1566905_1568321_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_011668149.1\|1568343_1569243_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_011668150.1\|1569273_1570815_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_011668151.1\|1570845_1571388_-	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_021742847.1\|1571377_1571893_-	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_011668153.1\|1571943_1572156_-	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_021742844.1\|1573257_1573887_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_011668157.1\|1575299_1576316_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	2.6e-54	41.7
WP_075168822.1\|1576333_1577185_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_021742840.1\|1577177_1578263_-	peptide chain release factor 1	NA	NA	NA	NA
WP_011668160.1\|1578283_1578868_-	thymidine kinase	E0YIP8	Lactococcus_phage	2.8e-45	49.5
WP_011668161.1\|1579073_1580423_+	Mur ligase family protein	NA	NA	NA	NA
WP_011668162.1\|1580419_1581124_+	glutamine amidotransferase	NA	NA	NA	NA
WP_042750095.1\|1581179_1582199_-	serine hydrolase	NA	NA	NA	NA
WP_042522396.1\|1582321_1584163_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-55	33.2
WP_011667976.1\|1584155_1585889_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-42	26.8
WP_011667977.1\|1586057_1586387_+	hypothetical protein	NA	NA	NA	NA
WP_042522395.1\|1586433_1586640_-	hypothetical protein	NA	NA	NA	NA
WP_024525530.1\|1586717_1587842_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.1e-17	32.9
WP_087129221.1\|1588076_1588739_+	EAL domain-containing protein	NA	NA	NA	NA
WP_087129039.1\|1590049_1591015_-	VIP2 family actin-ADP-ribosylating toxin	NA	NA	NA	NA
WP_075168794.1\|1591413_1591635_-	hypothetical protein	NA	NA	NA	NA
WP_042522391.1\|1591717_1591918_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-21	74.6
WP_139588782.1\|1592036_1592408_-	hypothetical protein	NA	NA	NA	NA
WP_097547806.1\|1592528_1592804_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_139588970.1\|1592932_1594246_-\|transposase	transposase	NA	NA	NA	NA
WP_139588783.1\|1594497_1596033_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	3.7e-44	25.7
WP_047021662.1\|1596029_1597130_-\|portal	phage portal protein	H9A113	Staphylococcus_phage	8.8e-48	34.3
WP_042522387.1\|1597126_1597324_-	hypothetical protein	NA	NA	NA	NA
WP_139588784.1\|1597283_1598981_-\|terminase	terminase large subunit	J7KKD1	Streptococcus_phage	8.3e-114	38.9
WP_139588785.1\|1598977_1599451_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_139588786.1\|1600186_1600600_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	2.4e-19	44.4
WP_139588787.1\|1600802_1601144_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	1.1e-12	38.9
WP_139588788.1\|1601130_1601322_-	hypothetical protein	NA	NA	NA	NA
WP_139588789.1\|1601337_1601817_-	hypothetical protein	NA	NA	NA	NA
WP_139588790.1\|1601979_1603389_-	virulence protein	Q4ZD27	Staphylococcus_phage	3.4e-68	35.9
WP_139588791.1\|1603388_1604189_-	DNA replication protein	NA	NA	NA	NA
WP_060463201.1\|1604200_1604428_-	hypothetical protein	NA	NA	NA	NA
WP_063489188.1\|1604687_1604867_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	7.6e-18	81.0
WP_139588792.1\|1605022_1605640_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011667986.1\|1607655_1608219_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_024525554.1\|1608395_1608878_+	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_139588793.1\|1609244_1612262_-	YfhO family protein	NA	NA	NA	NA
WP_011667989.1\|1612549_1613896_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_015473496.1\|1614025_1614892_-	sugar uptake protein	NA	NA	NA	NA
WP_015473495.1\|1615074_1616223_-	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_024525557.1\|1616281_1617751_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.4e-21	30.8
WP_024525558.1\|1617747_1618482_-	response regulator transcription factor	W8CYM9	Bacillus_phage	9.7e-35	36.4
WP_042522306.1\|1619616_1620015_+	HicB family protein	NA	NA	NA	NA
WP_052471707.1\|1620579_1620861_+	hypothetical protein	NA	NA	NA	NA
WP_042522277.1\|1621072_1622185_-	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.4e-21	25.8
WP_139588794.1\|1622274_1622811_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_139588795.1\|1623029_1623299_+	hypothetical protein	NA	NA	NA	NA
WP_042521211.1\|1623406_1624267_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_139588796.1\|1624342_1624912_+	hypothetical protein	NA	NA	NA	NA
WP_042750072.1\|1625152_1626385_+	arginine deiminase	NA	NA	NA	NA
WP_087051840.1\|1626495_1627545_-	linear amide C-N hydrolase	M1HS66	Paramecium_bursaria_Chlorella_virus	5.6e-28	27.1
WP_042750071.1\|1628607_1629354_-	hypothetical protein	NA	NA	NA	NA
WP_125584215.1\|1629434_1630460_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-41	35.8
WP_011373852.1\|1630774_1631695_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_021741872.1\|1631839_1632859_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_081374834.1\|1633075_1634431_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_087127865.1\|1634606_1635524_-	hypothetical protein	NA	NA	NA	NA
WP_042522296.1\|1635516_1635999_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_139588797.1\|1636108_1637494_-	class II fumarate hydratase	NA	NA	NA	NA
WP_035464358.1\|1637628_1638123_-	alcohol dehydrogenase	A0A060QSU6	Streptococcus_phage	2.3e-08	53.7
WP_139588798.1\|1638346_1638718_+	DUF1304 family protein	NA	NA	NA	NA
WP_011667485.1\|1639190_1639370_-	hypothetical protein	NA	NA	NA	NA
WP_011667484.1\|1639735_1640185_+	OsmC family protein	NA	NA	NA	NA
WP_011667482.1\|1640474_1640918_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024525581.1\|1641051_1641624_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_042522219.1\|1641643_1642465_+	LicD family protein	A0A1V0SD50	Indivirus	1.9e-07	33.6
WP_139588799.1\|1642486_1644025_+	HD domain-containing protein	NA	NA	NA	NA
WP_087127856.1\|1644021_1646184_+	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
WP_021741399.1\|1646185_1647121_+	exopolyphosphatase	NA	NA	NA	NA
WP_139588800.1\|1647191_1647950_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	6.3e-13	28.8
WP_042522227.1\|1647930_1648899_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.3e-12	28.6
WP_024525586.1\|1648895_1649789_-	heme ABC transporter substrate-binding protein IsdE	NA	NA	NA	NA
WP_042522231.1\|1649801_1650572_-	cell surface protein	NA	NA	NA	NA
WP_042522235.1\|1651859_1652597_-	cell surface protein	NA	NA	NA	NA
WP_011373852.1\|1652697_1653618_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_11

1710464 : 1766191

Streptococcus_phage(21.05%)

protease,tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139588509.1\|1710464_1711736_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011667422.1\|1711945_1712887_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	4.2e-83	51.1
WP_021741440.1\|1712958_1713864_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.1e-71	47.8
WP_011667420.1\|1713901_1714915_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_011667419.1\|1714930_1715794_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_139588809.1\|1715799_1716735_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_015473430.1\|1716823_1717195_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_011667416.1\|1717195_1717525_-	PspC domain-containing protein	NA	NA	NA	NA
WP_087129245.1\|1717718_1718399_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_011667414.1\|1718410_1719169_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-16	29.3
WP_139588810.1\|1719184_1720009_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-15	30.0
WP_011667412.1\|1720021_1720906_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_139588811.1\|1721812_1722712_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_087129244.1\|1722963_1724307_-	PAS domain-containing protein	W8CYF6	Bacillus_phage	4.8e-24	34.1
WP_021741445.1\|1724303_1725011_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.1e-43	40.3
WP_087129243.1\|1725015_1726170_-\|protease	serine protease	NA	NA	NA	NA
WP_096109775.1\|1726279_1727396_-	peptide chain release factor 2	NA	NA	NA	NA
WP_015473424.1\|1727472_1729836_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_011667403.1\|1730037_1730598_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_139588812.1\|1730736_1731411_-	ComF family protein	NA	NA	NA	NA
WP_042521600.1\|1731407_1732727_-	DNA/RNA helicase	A0A1X9I5S6	Streptococcus_phage	7.8e-59	35.6
WP_042521598.1\|1732801_1733461_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.4e-40	43.0
WP_011667399.1\|1733514_1734609_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_080504821.1\|1735087_1735456_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_011667390.1\|1735500_1736307_+\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_015473419.1\|1736561_1738397_-	APC family permease	NA	NA	NA	NA
WP_011667388.1\|1738788_1740414_-	chaperonin GroEL	A0A240F766	uncultured_virus	7.4e-152	53.5
WP_011667387.1\|1740469_1740754_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.6e-12	43.0
WP_139588813.1\|1740934_1741573_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_087128402.1\|1741805_1743758_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.5e-53	31.6
WP_086989794.1\|1743818_1744163_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042521595.1\|1744220_1745399_+	MFS transporter	NA	NA	NA	NA
WP_011667382.1\|1745479_1746523_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	NA	NA	NA	NA
WP_087128406.1\|1746519_1747173_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011667380.1\|1747156_1747879_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_011667379.1\|1748057_1748798_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_024855139.1\|1748803_1749685_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.3e-81	57.7
WP_024525629.1\|1749696_1750035_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_042750002.1\|1750059_1751073_-	DNA polymerase III subunit delta'	A0A1U9WR94	Streptococcus_virus	6.0e-11	30.9
WP_011667375.1\|1751082_1751412_-	hypothetical protein	NA	NA	NA	NA
WP_087128409.1\|1751438_1752098_-	dTMP kinase	M1PSC7	Streptococcus_phage	5.1e-51	54.9
WP_087128413.1\|1752280_1752532_-	YaaL family protein	NA	NA	NA	NA
WP_011667372.1\|1752549_1753149_-	recombination protein RecR	NA	NA	NA	NA
WP_035464365.1\|1753170_1753488_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_087128415.1\|1753509_1755240_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.5e-59	40.6
WP_139588814.1\|1755516_1756068_-	nucleoside deaminase	NA	NA	NA	NA
WP_075168482.1\|1756084_1756696_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_042522036.1\|1756767_1757814_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	4.0e-34	32.3
WP_011667367.1\|1758139_1758367_+	glutaredoxin-like protein NrdH	A0A218MND6	uncultured_virus	1.8e-11	41.9
WP_035465819.1\|1758475_1760641_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	4.9e-252	60.8
WP_087129095.1\|1760675_1761671_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.7e-112	62.1
WP_042521580.1\|1761788_1762703_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_042521211.1\|1765330_1766191_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1960873 : 2028912

unidentified_phage(15.38%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139588855.1\|1960873_1961648_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.3e-26	52.3
WP_081374845.1\|1962294_1962822_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_021742188.1\|1968540_1969800_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	3.9e-84	42.7
WP_024748245.1\|1971076_1972000_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.7e-31	30.7
WP_035464819.1\|1972723_1972954_+	hypothetical protein	NA	NA	NA	NA
WP_024525741.1\|1973009_1973378_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588856.1\|1973438_1974812_-	DUF2252 family protein	NA	NA	NA	NA
WP_042521763.1\|1974949_1976434_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011667207.1\|1976509_1976752_-	hypothetical protein	NA	NA	NA	NA
WP_042749918.1\|1978346_1978787_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	2.7e-64	83.6
WP_087129379.1\|1979134_1979614_+	PH domain-containing protein	NA	NA	NA	NA
WP_139588857.1\|1979600_1981082_+	PH domain-containing protein	NA	NA	NA	NA
WP_087129378.1\|1981202_1982810_-	sodium:proton antiporter	NA	NA	NA	NA
WP_042521768.1\|1983015_1984155_-	glycerate kinase	W6LM47	Streptococcus_phage	3.8e-38	33.6
WP_087129377.1\|1984167_1985472_-	GntP family permease	NA	NA	NA	NA
WP_087129376.1\|1986965_1987868_-	ABC transporter permease	NA	NA	NA	NA
WP_011667198.1\|1987880_1988774_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_087129375.1\|1988770_1989145_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_087129374.1\|1989297_1990017_-	DUF975 family protein	NA	NA	NA	NA
WP_087129373.1\|1990041_1990755_-\|tRNA	tRNA ligase	NA	NA	NA	NA
WP_086989535.1\|1991992_1993024_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.4e-41	33.2
WP_011667193.1\|1993985_1994201_-	hypothetical protein	NA	NA	NA	NA
WP_087129306.1\|1994384_1995326_+	nucleoside hydrolase	NA	NA	NA	NA
WP_087129307.1\|1995395_1996325_+	DMT family transporter	NA	NA	NA	NA
WP_087128493.1\|1996369_1997230_-	triphosphoribosyl-dephospho-CoA synthase	NA	NA	NA	NA
WP_087128496.1\|1997244_1997787_-	citrate lyase holo-[acyl-carrier protein] synthase	NA	NA	NA	NA
WP_003593416.1\|1997901_1999440_-	citrate lyase subunit alpha	NA	NA	NA	NA
WP_003593414.1\|1999429_2000344_-	citrate (pro-3S)-lyase subunit beta	NA	NA	NA	NA
WP_003593412.1\|2000343_2000637_-	citrate lyase acyl carrier protein	NA	NA	NA	NA
WP_087128490.1\|2000626_2001619_-	[citrate (pro-3S)-lyase] ligase	NA	NA	NA	NA
WP_021742161.1\|2001715_2002696_-	transporter auxin efflux carrier family protein	NA	NA	NA	NA
WP_004561985.1\|2004041_2005031_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_021742159.1\|2005231_2006185_+	sugar-binding domain protein	NA	NA	NA	NA
WP_042521772.1\|2006186_2006969_-	alpha/beta hydrolase	W0LK50	Mycobacterium_phage	1.3e-05	30.2
WP_011667190.1\|2007092_2008724_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.3e-44	26.1
WP_087127968.1\|2008849_2009710_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_042521774.1\|2010162_2011353_-	tetracycline resistance MFS efflux pump	A0A2H4UVM2	Bodo_saltans_virus	4.8e-07	21.5
WP_039105412.1\|2011448_2012336_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_139588858.1\|2012445_2013477_+	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_042521776.1\|2013540_2014146_-	permease	NA	NA	NA	NA
WP_021742152.1\|2014217_2014556_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588859.1\|2014600_2016136_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_042521780.1\|2016275_2016959_+	VTT domain-containing protein	NA	NA	NA	NA
WP_139588509.1\|2017049_2018321_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_139588860.1\|2018499_2020308_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.1e-59	28.2
WP_087127962.1\|2020444_2021797_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_024525771.1\|2021982_2022387_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_042521785.1\|2022524_2022896_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_042521786.1\|2022934_2024746_-	ABC transporter permease	NA	NA	NA	NA
WP_042521787.1\|2024757_2025516_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-33	37.4
WP_011667175.1\|2025686_2026640_+	aldo/keto reductase	NA	NA	NA	NA
WP_139588861.1\|2026705_2027920_-	MFS transporter	NA	NA	NA	NA
WP_139588862.1\|2027991_2028912_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	3.2e-51	38.6

DBSCAN-SWA_13

2082019 : 2146524

Streptococcus_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004561985.1\|2082019_2083009_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_139588871.1\|2083062_2084472_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.1e-10	24.3
WP_015473215.1\|2085566_2086421_-	DegV family protein	NA	NA	NA	NA
WP_139588872.1\|2086799_2086991_+	hypothetical protein	NA	NA	NA	NA
WP_139588873.1\|2087005_2088385_+	Mn(2+) uptake NRAMP transporter MntH	NA	NA	NA	NA
WP_024525804.1\|2088494_2089244_-	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_015473211.1\|2089438_2090092_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_139588874.1\|2090115_2091072_-	sugar kinase	NA	NA	NA	NA
WP_139588875.1\|2091101_2092124_-	2-keto-3-deoxygluconate permease	NA	NA	NA	NA
WP_021742464.1\|2092203_2093019_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	5.9e-17	28.4
WP_042521839.1\|2093037_2093883_-	5-dehydro-4-deoxy-D-glucuronate isomerase	NA	NA	NA	NA
WP_024525809.1\|2094233_2094509_+	hypothetical protein	NA	NA	NA	NA
WP_041815114.1\|2094646_2095393_+	hypothetical protein	NA	NA	NA	NA
WP_015473204.1\|2095516_2096275_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_139588876.1\|2096322_2097726_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_024525812.1\|2097941_2098508_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_021742471.1\|2098801_2099320_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.6e-31	45.4
WP_011667114.1\|2099620_2100832_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011667113.1\|2101170_2101812_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_021742473.1\|2102020_2102317_-	hypothetical protein	NA	NA	NA	NA
WP_011667111.1\|2102492_2103194_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-32	33.8
WP_139588877.1\|2103174_2104548_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_011667109.1\|2104639_2104888_+	hypothetical protein	NA	NA	NA	NA
WP_087128194.1\|2105000_2105420_-	hypothetical protein	NA	NA	NA	NA
WP_021742514.1\|2105682_2107443_-	pyruvate oxidase	NA	NA	NA	NA
WP_021742513.1\|2107651_2108569_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_021742510.1\|2109720_2110191_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_139588878.1\|2111390_2112629_+\|transposase	ISL3 family transposase	A0A0A8WEF4	Clostridium_phage	9.0e-09	23.8
WP_021742507.1\|2113854_2114514_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.9e-23	35.7
WP_068222268.1\|2114868_2116092_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.6e-74	44.4
WP_024525819.1\|2116229_2117705_-	ABC transporter permease	NA	NA	NA	NA
WP_139588879.1\|2117873_2119046_-	AI-2E family transporter	NA	NA	NA	NA
WP_042521852.1\|2119347_2119989_-	hypothetical protein	NA	NA	NA	NA
WP_042521853.1\|2120001_2121351_-	glycosyl hydrolase family 25	X2JN49	Bacillus_phage	2.0e-14	33.5
WP_024525823.1\|2121837_2122857_+	glycosyltransferase family 2 protein	U5P087	Shigella_phage	4.3e-49	37.7
WP_003561746.1\|2123627_2124803_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_139588880.1\|2124918_2126514_-	hypothetical protein	NA	NA	NA	NA
WP_139588881.1\|2126789_2128160_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	2.4e-10	22.6
WP_139588882.1\|2128379_2129375_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_024748245.1\|2129580_2130504_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.7e-31	30.7
WP_139588883.1\|2130487_2132341_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	1.7e-128	42.7
WP_139588884.1\|2132362_2134249_-	DUF2264 domain-containing protein	NA	NA	NA	NA
WP_139588885.1\|2134343_2135627_-	MFS transporter	NA	NA	NA	NA
WP_139588886.1\|2135955_2141175_-	peptidase	NA	NA	NA	NA
WP_139588887.1\|2141556_2141895_-	hypothetical protein	NA	NA	NA	NA
WP_139588888.1\|2141974_2142184_-	DUF3781 domain-containing protein	NA	NA	NA	NA
WP_139588889.1\|2142326_2143583_-	hypothetical protein	NA	NA	NA	NA
WP_021742834.1\|2144834_2145314_-	RpiB/LacA/LacB family sugar-phosphate isomerase	NA	NA	NA	NA
WP_024855727.1\|2145594_2146524_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9

DBSCAN-SWA_14

2293932 : 2351121

unidentified_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062916767.1\|2293932_2294862_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_139588917.1\|2294888_2295005_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_011373852.1\|2295085_2296006_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_139588918.1\|2296427_2298071_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042520727.1\|2298260_2298761_-	hypothetical protein	NA	NA	NA	NA
WP_042520726.1\|2298781_2299270_-	hypothetical protein	NA	NA	NA	NA
WP_139588919.1\|2299505_2300504_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_042520724.1\|2300697_2302080_+	SLC45 family MFS transporter	NA	NA	NA	NA
WP_139588920.1\|2302100_2303774_+	alpha,alpha-phosphotrehalase	NA	NA	NA	NA
WP_042520718.1\|2303932_2304877_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_087127737.1\|2304999_2305653_-	hypothetical protein	NA	NA	NA	NA
WP_011668754.1\|2305822_2306245_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_139588921.1\|2306453_2307041_-	helix-turn-helix domain-containing protein	A0A0S2MVM8	Bacillus_phage	1.8e-07	48.3
WP_139588922.1\|2307118_2307310_-	hypothetical protein	NA	NA	NA	NA
WP_015473476.1\|2307336_2308266_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_042522036.1\|2308376_2309423_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	4.0e-34	32.3
WP_042520710.1\|2310380_2310833_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_087129335.1\|2310935_2311841_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_087129336.1\|2311859_2312390_+	serine acetyltransferase	NA	NA	NA	NA
WP_021742049.1\|2312448_2313639_-	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_042749623.1\|2313635_2313923_-	hypothetical protein	NA	NA	NA	NA
WP_021742051.1\|2313984_2314371_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139588923.1\|2314507_2315590_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_087129338.1\|2315594_2316527_-	ribosylpyrimidine nucleosidase	NA	NA	NA	NA
WP_042520702.1\|2316627_2317308_+	transcriptional regulator YeiL	NA	NA	NA	NA
WP_042520701.1\|2317378_2318356_-	cation transporter	NA	NA	NA	NA
WP_003593433.1\|2318671_2319844_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_123830887.1\|2319934_2320588_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_042520700.1\|2320646_2321279_-	hypothetical protein	NA	NA	NA	NA
WP_011668765.1\|2321392_2321785_+	DUF1398 family protein	NA	NA	NA	NA
WP_042520698.1\|2321843_2322380_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_021742059.1\|2322476_2323838_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_021742060.1\|2324097_2324781_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-33	37.7
WP_011668769.1\|2324792_2325851_-	ABC transporter permease	NA	NA	NA	NA
WP_039106303.1\|2325854_2326376_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042520695.1\|2326515_2327706_-	MFS transporter	NA	NA	NA	NA
WP_139588924.1\|2328204_2328654_+	DUF386 family protein	NA	NA	NA	NA
WP_015474519.1\|2328665_2329916_+	MFS transporter	NA	NA	NA	NA
WP_015474520.1\|2329930_2330398_+	YhcH/YjgK/YiaL family protein	NA	NA	NA	NA
WP_042520694.1\|2330752_2331484_-	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_042520693.1\|2331499_2332387_-	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_139588925.1\|2332383_2333916_-	carbohydrate kinase	NA	NA	NA	NA
WP_039106322.1\|2333930_2334935_-	hypothetical protein	NA	NA	NA	NA
WP_087128717.1\|2335064_2336021_-	dihydrofolate reductase	NA	NA	NA	NA
WP_021742072.1\|2336464_2337505_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_139588519.1\|2337612_2338602_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_035464796.1\|2338658_2339153_-	energy coupling factor transporter S component ThiW	NA	NA	NA	NA
WP_011668773.1\|2339341_2340313_-	malate permease	NA	NA	NA	NA
WP_021742075.1\|2340419_2342054_-	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_021742076.1\|2342189_2343077_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_021742077.1\|2343200_2344010_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_139588926.1\|2344006_2345119_-	agmatine deiminase	M1H3B1	Paramecium_bursaria_Chlorella_virus	3.4e-92	46.2
WP_065200980.1\|2345142_2346087_-	carbamate kinase	NA	NA	NA	NA
WP_021742080.1\|2346153_2347248_-	agmatine deiminase	M1I1E2	Acanthocystis_turfacea_Chlorella_virus	2.0e-113	55.7
WP_021742081.1\|2347274_2348660_-	APC family permease	NA	NA	NA	NA
WP_042520687.1\|2348704_2349748_-	putrescine carbamoyltransferase	NA	NA	NA	NA
WP_024855727.1\|2350191_2351121_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9

DBSCAN-SWA_15

2354515 : 2404145

Staphylococcus_prophage(45.45%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139588928.1\|2354515_2355376_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_087128245.1\|2357312_2358569_-\|tRNA	tyrosine--tRNA ligase	A0A1L2CUL7	Pectobacterium_phage	6.9e-81	41.1
WP_086989535.1\|2358821_2359853_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.4e-41	33.2
WP_011668786.1\|2359988_2360237_-	hypothetical protein	NA	NA	NA	NA
WP_035464774.1\|2360376_2360637_-	hypothetical protein	NA	NA	NA	NA
WP_139588929.1\|2361332_2362502_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_011668790.1\|2362552_2362744_+	hypothetical protein	NA	NA	NA	NA
WP_139588930.1\|2362813_2363713_-	EamA family transporter	NA	NA	NA	NA
WP_042520681.1\|2363887_2365393_+	alpha-N-arabinofuranosidase	NA	NA	NA	NA
WP_042520680.1\|2365446_2365713_-	CsbD family protein	NA	NA	NA	NA
WP_011668794.1\|2365726_2365978_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_035464780.1\|2366190_2366607_-	YjdF family protein	NA	NA	NA	NA
WP_081374803.1\|2366779_2367658_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_139588931.1\|2367824_2369357_+	glycosyl hydrolase family 30	NA	NA	NA	NA
WP_042520677.1\|2370794_2371001_-	hypothetical protein	NA	NA	NA	NA
WP_134787792.1\|2371024_2371426_-	hypothetical protein	NA	NA	NA	NA
WP_024526118.1\|2372236_2372983_+	peroxide stress protein YaaA	NA	NA	NA	NA
WP_087128721.1\|2373057_2373543_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_139588519.1\|2373568_2374558_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_087128715.1\|2374658_2375891_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_042520673.1\|2375923_2376457_-	hypothetical protein	NA	NA	NA	NA
WP_042520672.1\|2376480_2376963_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_095347822.1\|2377014_2377935_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-50	38.2
WP_139588975.1\|2378015_2378441_-	PTS system fructose subfamily transporter subunit IIA	NA	NA	NA	NA
WP_095347822.1\|2379158_2380079_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-50	38.2
WP_139588932.1\|2380403_2381174_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_042520669.1\|2381342_2381993_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_087128999.1\|2382018_2382915_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_042520667.1\|2382979_2383609_-	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	2.6e-28	35.1
WP_087129001.1\|2383605_2384325_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_042520665.1\|2384623_2385847_+	MFS transporter	NA	NA	NA	NA
WP_139588933.1\|2385938_2386658_-	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_139588934.1\|2387651_2388530_-	ribokinase	NA	NA	NA	NA
WP_042520662.1\|2388522_2389896_-	allantoin permease	NA	NA	NA	NA
WP_042520661.1\|2389916_2390921_-	ADP-ribosylglycohydrolase family protein	A0A172WZB4	Catopsilia_pomona_nucleopolyhedrovirus	2.4e-07	22.7
WP_042520660.1\|2390944_2391637_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_139588935.1\|2391781_2392858_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_042520658.1\|2392927_2393602_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_139588936.1\|2396400_2397390_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.2e-58	40.5
WP_139588937.1\|2397512_2398019_+	hypothetical protein	NA	NA	NA	NA
WP_011373852.1\|2398146_2399067_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_139588938.1\|2399278_2399632_+	hypothetical protein	NA	NA	NA	NA
WP_043023465.1\|2399740_2400766_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.7e-41	35.5
WP_024855727.1\|2401792_2402722_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_087127783.1\|2402748_2402850_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_003561746.1\|2402969_2404145_-\|transposase	IS256 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP031183

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031183_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031183_1

780-935

Orphan

Consensus_repeat	Method
ATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031183_1

>merge|NZ_CP031183|1|780-935|CRISPRCasFinder
ATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGGATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGACAATAGCTCTCAATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG

>NZ_CP031183|1|1|780-935|CRISPRCasFinder
ATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG	TCCGCATGACTTCGTTGGATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAGTCCGCATGACTTCGTTGACAATAGCTCTCA
ATCCCTTGCTACGAGCGGAATTTCGAAAATCGAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031183.1\|WP_046870788.1\|7808_8726_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031183.1\|WP_065868913.1\|6394_7342_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP031183.1\|WP_139588978.1\|4450_6385_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274774
NZ_CP031183.1\|WP_139588979.1\|9542_10874_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP031183.1\|WP_054712554.1\|1612_1810_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031183.1\|WP_087128394.1\|1860_2595_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NZ_CP031183.1\|WP_139588977.1\|2969_3179_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031183.1\|WP_046870789.1\|7323_7737_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|381116
NZ_CP031183.1\|WP_081036096.1\|10969_11542_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP031183.1\|WP_011178835.1\|4030_4435_-\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229

Protein	Function_ID	Function_description	E-value
NZ_CP031183.1\|WP_046870788.1\|7808_8726_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.74185e-62
NZ_CP031183.1\|WP_065868913.1\|6394_7342_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	8.15189e-80
NZ_CP031183.1\|WP_139588978.1\|4450_6385_-\|hypothetical-protein	gnl\|CDD\|274774	TIGR03766, hypothetical_protein_lp_2141, conserved hypothetical integral membrane protein. Models TIGR03110, TIGR03111, and TIGR03112 describe a three-gene system found in several Gram-positive bacteria, where TIGR03110 (XrtG) is distantly related to a putative transpeptidase, exosortase (TIGR02602). This model describes a small clade that correlates by both gene clustering and phyletic pattern, although imperfectly, to the three gene system. Both this narrow clade, and the larger set of full-length homologous integral membrane proteins, have an especially well-conserved region near the C-terminus with an invariant tyrosine. The function is unknown.	2.33934e-20
NZ_CP031183.1\|WP_139588979.1\|9542_10874_-\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	6.44248e-06
NZ_CP031183.1\|WP_087128394.1\|1860_2595_+\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	0.000949229
NZ_CP031183.1\|WP_081036096.1\|10969_11542_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	1.09175e-07
NZ_CP031183.1\|WP_046870789.1\|7323_7737_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|381116	cd17574, REC_OmpR, phosphoacceptor receiver (REC) domain of OmpR family response regulators. OmpR-like proteins are one of the most widespread transcriptional regulators. OmpR family members contain REC and winged helix-turn-helix (wHTH) DNA-binding output effector domain. They are involved in the control of environmental stress tolerance (such as the oxidative, osmotic and acid stress response), motility, virulence, outer membrane biogenesis and other processes. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.11188e-17
NZ_CP031183.1\|WP_011178835.1\|4030_4435_-\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	7.55387e-15

>NZ_CP031183.1|WP_054712554.1|1612_1810_+|hypothetical-protein
MTKPSKEIETIDQLLADPWAVNIQDIWEQAAHNPDPDKRKLFDALHTYLLDKRQEQIINEKHFVI
>NZ_CP031183.1|WP_087128394.1|1860_2595_+|Fic-family-protein
MAKTRTYMDKYKFTAAENQRFARANFTKLVHTNARFEGVNTTLPQTQTIMDGMSVAGVPVEDVLTIVNLKRGWQYITAQNSPLTLTMEKQINKIVAAEDALVPGELRQGKGGVNLGSDDFFEQPLINEKQEQSFLQKILADPRTTITDKALTVMYHNMRQQIFWDGNKRTATLSANKIMIDGGAGLINVPLDKWNQWNELIANYYRTNDMAKIKRWTYDNGIQGLQIRANLALKSVKDKTSKRI
>NZ_CP031183.1|WP_139588977.1|2969_3179_-|hypothetical-protein
MSQSNLEKQEAKLKQLNQKIKAEKNKIEQNLGKQIIRSANLDYVTLTTPQIKMIAKKVAAFLNQAQNNQ
>NZ_CP031183.1|WP_011178835.1|4030_4435_-|GtrA-family-protein
MEKPITTLYSKYDTALRYLIVGGLTTGINVVLFFGLTHLAMPWFWANIIAWVLSVLFAFIANKKVVFNSADMTFRTVVKEGASFFTLRGASLLADTAILFIGLTLMHGSPLIVKLIDQVVVIVLNYGFSKLIFA
>NZ_CP031183.1|WP_139588978.1|4450_6385_-|hypothetical-protein
MKKIKPAFLPAILILCLLIGSIGNLTSVLGVPALLVVVLLGAGLYFGAPRLDHLSTRQLRWGIGLGLLAMLIAQVVVLHVMPNTVYHDPYRVLSQADQLAAGHMTWDITYFWRYANNVPLAYLLSLWLRLTQLVGLSTNLSVHLLSILVLDSFIALALHTIWQLSQRASLLVVAFGFFALSPFAYTYYLQVFYSDLPTMLVLLIIIRSLLNWSQKTSRQRWFAGSGLVVAVMLGAMLKPNLVVLLPALLIVGLILARQHLWRQAKLTLPILLIVLGFGLSLPATKVFDVAANYQPRTAFSFPATHWILMGYNQHSNGGYSGKDVGRAIKQPSQADRQRYNLKAIPKRIKTLGVVGVIRLWVVKLGIVLNVQGIQRWYNGGFRAAPSWYSNHAGFYQGLTVIGYVAATLLMWGALMLKLLRWRPDLTDPHQILALLAVTTALGYLAFHTLLWEVEPRYGQAILPLLWVALAAIPRQASQSRPRWANQASLLNGATASLVAFGAAGVLGAQLPQKQVIAAQRSQLSVQYHAKPKTVTPGTVLAEVVDVNAPANYFSVQIHAGSQVQVTLTNLATGQHYRLTMAGSVARLHHQLAAGQYRITVQNLTTRGQQVDVTHTYHYQLAAHPLTVNGQSQPTASLIYTCMQR
>NZ_CP031183.1|WP_065868913.1|6394_7342_-|glycosyltransferase-family-2-protein
MATSKLTIVVPAYNEEEVLTSSVQKLLAVEDQIAAQTVLGQRADILIVDDGSMDHTWDIIEKLHAMNSRVRGLRFSRNFGHQSALIAGMSEAVKTADMIVTIDADLQDDPDKIGDMVNAYADGADIVYGVRNNRETDSWFKRTTAQGYYKTLKLLGVELVPNHADFRLMSKRAVETFLQYPERNIFIRGLIPKLGFKTAEVFYKRTPRMAGESKYPLKKMLAFAWDGITSLTIAPVRLILILGTLSCLLAVGMVVYAIVMKMLGLTVHGWSLLMVSLWFVGGIQMISLGVIGEYIGKLTTEVKHRPRYTVQTILD
>NZ_CP031183.1|WP_046870789.1|7323_7737_-|phosphatase-PAP2-family-protein
MKSTILLVEDEAGLADSLKTEFELENFNVFWANDGLIALDMFRQNEAQIDLIILDWMLPHIQDQETQLITVLIGIGWIAMVAISRVYLRDHYLSDVLASVCLASGWWLLVTPAEAFIQAKMRQFLPEGMLKSWPHQN
>NZ_CP031183.1|WP_046870788.1|7808_8726_+|IS30-family-transposase
MTSLSSQERTVIQTLLELNYSIRAIARFINRSPATVSVEIHQVTPYKADIAHALALKKRHLRGRHHTLTPAIAVFLNEHIGILKWSPETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIESRPKSVQARQDFGHFEVDTMQSGKKRGEVLVTITERLSRQHIVRQVSGRNSQAVTPVLIHFFQGIENAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQFAVFG
>NZ_CP031183.1|WP_139588979.1|9542_10874_-|ABC-transporter-permease
MSTIISTELKREEYQMFDVIRSKRYWLALLLVGAIIGIVSFAFIGIRNSVKVKQIPVALVNEDKGALSNKIESKLRKKFNGKDSKIKWVSPQKDGFNDQKYYGAFIIRSGFSKELQQQNESLKAQIISQKLTTLQKKEKLPDSAKSQLLQAKFKSQLLQAKFVTQKPVHPAQIKISINQGMNAQISQLLSQALPKIANALSSRISAQQQSVLSKNKINLSAKSWDLVSTPISVSTHESNKIEKNTVNGTAPMLLVALAWFSALIPSLILWREHTKRSASKFLNATTITSQLITGLVASILSATVGFLFVNVCFNLTIPNPINFIGLMSISIFVFYLIITCVLDWLGFTFYPLLLVVWLLAISVISYAPETLDPLYRKGIYSWVPMRFSMQTLTNTLYFHNGSSTTMSSLLVLLIIGFVAAILMYSSGYLKHYLFTVRPHRKIK
>NZ_CP031183.1|WP_081036096.1|10969_11542_+|TetR/AcrR-family-transcriptional-regulator
MFGEKEELMTDLRNKRTEMLIENSFIQLVRQQGFNNVSVIDISNKALINRQTFYRHYQDKYHLAAKMIQDFVSTYDSVLKKRSNLNKQNQNFLSITSILAPDIKNLLIKQREKILALRSIQLDSKDLSSEIKRVLRNNLVSMLEEKPDKFEMSLLTSLILGSFNYLIDEQELPDTSQIQHAITVILCLLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP014889	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-8, complete sequence	6174-6257	24	0.714
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP014631	Lactobacillus backii strain TMW 1.1988 plasmid L11988-7, complete sequence	25031-25114	24	0.714
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP029972	Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence	20633-20716	24	0.714
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP029972	Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence	20687-20770	24	0.714
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP031183	Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence	816-899	24	0.714
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP012279	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence	3450-3533	25	0.702
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP045730	Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence	3542-3625	25	0.702
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	16706-16789	25	0.702
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	462-545	26	0.69
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP012287	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-4, complete sequence	30312-30395	37	0.56
NZ_CP031183_1	1.1\|816\|84\|NZ_CP031183\|CRISPRCasFinder	816-899	84	NZ_CP012274	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-5, complete sequence	31520-31603	37	0.56

1. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP014889 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-8, complete sequence) position: , mismatch: 24, identity: 0.714

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

2. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP014631 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-7, complete sequence) position: , mismatch: 24, identity: 0.714

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

3. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP029972 (Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence) position: , mismatch: 24, identity: 0.714

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

4. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP029972 (Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence) position: , mismatch: 24, identity: 0.714

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

5. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP031183 (Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence) position: , mismatch: 24, identity: 0.714

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
************************************************************

6. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP012279 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence) position: , mismatch: 25, identity: 0.702

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.******************************************

7. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP045730 (Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence) position: , mismatch: 25, identity: 0.702

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.******************************************

8. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 25, identity: 0.702

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.******************************************

9. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 26, identity: 0.69

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tccgcatgacttcgttgaaacccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*****************.* ****************************************

10. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP012287 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-4, complete sequence) position: , mismatch: 37, identity: 0.56

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tggacaagaaacgccgaaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*  .** **  .  . ..******************************************

11. spacer 1.1|816|84|NZ_CP031183|CRISPRCasFinder matches to NZ_CP012274 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-5, complete sequence) position: , mismatch: 37, identity: 0.56

tccgcatgacttcgttggatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	CRISPR spacer
tggacaagaaacgccgaaatcccttgctacgagcggaatttcgaaaatcgaaagtccgca	Protospacer
*  .** **  .  . ..******************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031182

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP031183

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection