CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP031210	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_B, complete sequence	0 crisprs	NA	0	0
NZ_CP031211	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_C, complete sequence	0 crisprs	NA	0	0
NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	0 crisprs	NA	0	0
NZ_CP031212	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_D, complete sequence	0 crisprs	NA	0	0
NZ_CP031208	Lactobacillus brevis strain UCCLB521 chromosome, complete genome	2 crisprs	cas3,csa3,DEDDh,DinG	8	3
NZ_CP031213	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_E, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031208_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031208_1

1054838-1055232

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
GTATTCCCCACACATGTGGGGGTGATCCT	PILER-CR
GTATTCCCCACACATGTGGGGGTGATCCT	CRISPRCasFinder

6 spacers

The CRISPR arrays of NZ_CP031208_1

>merge|NZ_CP031208|1|1054838-1055232|PILER-CR,CRISPRCasFinder
GTATTCCCCACACGTGTGGGGGTGATCCCCATTGAATGCGGAATGACGGCTTTTTTATGAAGTATTCCCCACACATGTGGGGGTGATCCTGGACAGTACCAAGATATTCCACAAACAACTGTGTATTCCCCACACATGTGGGGGTGATCCTCTGCTGTAGCCTTATAGCCCAACAGATTTTTCGTATTCCCCACACATGTGGGGGTGATCCTAGATGGCCTTTTTCGGCTTAGCTGCCTTAGTGGTATTCCCCACACGTGTGGGGGTGATCCTATTAGTTGGTCGAATAGAAAAAAGCTAGGTATGTATTCCCCACACGTGTGGGGGTGATCCTGGCTGAAAACGAGCTTGTAGCATTTGAACCAAGTATTCCCCACATATGTAGGGGTGGTCTC

>NZ_CP031208|1|1|1054838-1055171|PILER-CR
GTATTCCCCACACGTGTGGGGGTGATCCC	CATTGAATGCGGAATGACGGCTTTTTTATGAA
GTATTCCCCACACATGTGGGGGTGATCCT	GGACAGTACCAAGATATTCCACAAACAACTGT
GTATTCCCCACACATGTGGGGGTGATCCT	CTGCTGTAGCCTTATAGCCCAACAGATTTTTC
GTATTCCCCACACATGTGGGGGTGATCCT	AGATGGCCTTTTTCGGCTTAGCTGCCTTAGTG
GTATTCCCCACACGTGTGGGGGTGATCCT	ATTAGTTGGTCGAATAGAAAAAAGCTAGGTAT
GTATTCCCCACACGTGTGGGGGTGATCCT

>NZ_CP031208|1|1|1054838-1055232|CRISPRCasFinder
GTATTCCCCACACGTGTGGGGGTGATCCC	CATTGAATGCGGAATGACGGCTTTTTTATGAA
GTATTCCCCACACATGTGGGGGTGATCCT	GGACAGTACCAAGATATTCCACAAACAACTGT
GTATTCCCCACACATGTGGGGGTGATCCT	CTGCTGTAGCCTTATAGCCCAACAGATTTTTC
GTATTCCCCACACATGTGGGGGTGATCCT	AGATGGCCTTTTTCGGCTTAGCTGCCTTAGTG
GTATTCCCCACACGTGTGGGGGTGATCCT	ATTAGTTGGTCGAATAGAAAAAAGCTAGGTAT
GTATTCCCCACACGTGTGGGGGTGATCCT	GGCTGAAAACGAGCTTGTAGCATTTGAACCAA
GTATTCCCCACATATGTAGGGGTGGTCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031208.1\|WP_011667651.1\|1048700_1049468_+\|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha	unknown	unknown	gnl\|CDD\|235580
NZ_CP031208.1\|WP_011667636.1\|1060032_1061121_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NZ_CP031208.1\|WP_011667633.1\|1062683_1063691_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP031208.1\|WP_139566433.1\|1051071_1051593_+\|BioY-family-transporter	unknown	unknown	gnl\|CDD\|224187
NZ_CP031208.1\|WP_011667649.1\|1050269_1051061_+\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|223417
NZ_CP031208.1\|WP_024855043.1\|1049498_1050257_+\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|235694
NZ_CP031208.1\|WP_080504804.1\|1053594_1054068_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP031208.1\|WP_024855042.1\|1052469_1052985_+\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496
NZ_CP031208.1\|WP_133174544.1\|1058705_1058780_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237756
NZ_CP031208.1\|WP_011667632.1\|1063797_1064862_-\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234988
NZ_CP031208.1\|WP_011667634.1\|1062218_1062572_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP031208.1\|WP_011667631.1\|1065419_1066886_+\|catalase	unknown	unknown	gnl\|CDD\|365942
NZ_CP031208.1\|WP_015473674.1\|1058366_1058597_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031208.1\|WP_011667642.1\|1054315_1054630_+\|HicB-family-protein	unknown	unknown	gnl\|CDD\|374224
NZ_CP031208.1\|WP_011667644.1\|1053139_1053598_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP031208.1\|WP_011667652.1\|1047867_1048701_+\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-beta	unknown	unknown	gnl\|CDD\|235547
NZ_CP031208.1\|WP_011667647.1\|1051837_1052158_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212133
NZ_CP031208.1\|WP_011667635.1\|1061316_1062135_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP031208.1\|WP_024855040.1\|1057030_1057996_-\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|365934
NZ_CP031208.1\|WP_107696681.1\|1059215_1059905_+\|glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153234

Protein	Function_ID	Function_description	E-value
NZ_CP031208.1\|WP_011667651.1\|1048700_1049468_+\|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha	gnl\|CDD\|235580	PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated.	2.56053e-113
NZ_CP031208.1\|WP_011667636.1\|1060032_1061121_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP031208.1\|WP_011667633.1\|1062683_1063691_+\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	2.00788e-158
NZ_CP031208.1\|WP_139566433.1\|1051071_1051593_+\|BioY-family-transporter	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	1.21635e-24
NZ_CP031208.1\|WP_011667649.1\|1050269_1051061_+\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|223417	COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism].	1.3895e-46
NZ_CP031208.1\|WP_024855043.1\|1049498_1050257_+\|enoyl-ACP-reductase-FabI	gnl\|CDD\|235694	PRK06079, PRK06079, enoyl-[acyl-carrier-protein] reductase FabI.	5.56711e-169
NZ_CP031208.1\|WP_080504804.1\|1053594_1054068_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	1.86063e-16
NZ_CP031208.1\|WP_024855042.1\|1052469_1052985_+\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.353e-41
NZ_CP031208.1\|WP_133174544.1\|1058705_1058780_-\|hypothetical-protein	gnl\|CDD\|237756	PRK14559, PRK14559, serine/threonine phosphatase.	0.00158602
NZ_CP031208.1\|WP_011667632.1\|1063797_1064862_-\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234988	PRK01889, PRK01889, GTPase RsgA; Reviewed.	7.97028e-136
NZ_CP031208.1\|WP_011667634.1\|1062218_1062572_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	5.54847e-40
NZ_CP031208.1\|WP_011667631.1\|1065419_1066886_+\|catalase	gnl\|CDD\|365942	pfam00199, Catalase, Catalase.	0
NZ_CP031208.1\|WP_011667642.1\|1054315_1054630_+\|HicB-family-protein	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	1.54624e-06
NZ_CP031208.1\|WP_011667644.1\|1053139_1053598_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	2.29851e-27
NZ_CP031208.1\|WP_011667652.1\|1047867_1048701_+\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-beta	gnl\|CDD\|235547	PRK05654, PRK05654, acetyl-CoA carboxylase carboxyltransferase subunit beta.	4.8975e-131
NZ_CP031208.1\|WP_011667647.1\|1051837_1052158_+\|hypothetical-protein	gnl\|CDD\|212133	cd11523, NTP-PPase, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily. This superfamily contains enzymes that hydrolyze the alpha-beta phosphodiester bond of all canonical NTPs into monophosphate derivatives and pyrophosphate (PPi). Divalent ions, such as Mg2+ ion(s), are essential to activate a proposed water nucleophile and stabilize the charged intermediates to facilitate catalysis. These enzymes share a conserved divalent ion-binding motif EXX[E/D] in their active sites. They also share a highly conserved four-helix bundle, where one face forms the active site, while the other participates in oligomer assembly. The four-helix bundle consists of two central antiparallel alpha-helices that can be contained within a single protomer or form upon dimerization. The superfamily members include dimeric dUTP pyrophosphatases (dUTPases; EC 3.6.1.23), the nonspecific NTP-PPase MazG proteins, HisE-encoded phosphoribosyl ATP pyrophosphohydolase (PRA-PH), fungal histidine biosynthesis trifunctional proteins, and several uncharacterized protein families.	3.85638e-12
NZ_CP031208.1\|WP_011667635.1\|1061316_1062135_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	5.2263e-17
NZ_CP031208.1\|WP_024855040.1\|1057030_1057996_-\|CAP-domain-containing-protein	gnl\|CDD\|365934	pfam00188, CAP, Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.	8.53429e-15
NZ_CP031208.1\|WP_107696681.1\|1059215_1059905_+\|glutamine-amidotransferase	gnl\|CDD\|153234	cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	5.04175e-62

>NZ_CP031208.1|WP_011667642.1|1054315_1054630_+|HicB-family-protein
MTKSNIVTYPAVFHDNEVGGYTVTFPDIEDATTSGQTLGESLVNAAIVLGQTLHDQPTVLPSATTITELMHQYPMAFIQFVAVDLNQVIARAVPTDQVDLQLIQ
>NZ_CP031208.1|WP_080504804.1|1053594_1054068_-|LytTR-family-transcriptional-regulator
MLNLSERQAVTMHVTFNLKASFIPPFITINAPAETPELQHLATNISQLTNSQLIAGISPRGTRELVPVNQIIRIHTDAKHVVMETKATSYTLTQRIYQLKQLLPSDLFLQLSSGELVNRQHIRHFSLTPSGQVLLSTGATTFVSRRCMQQIRKEFLK
>NZ_CP031208.1|WP_011667644.1|1053139_1053598_-|DUF3021-domain-containing-protein
MKRLGILTSGAFLGLSIGFICALFFSLTNHATTFMPSSPDFVAHLSSNTMATLAAAGLWAAIGLLFSLTSLIFFNEHWSIARQTIWHLGLSYLGFTPLAILAGWFPLNVTWLLLYTLIFVGIYLVIWTYSMLRARKTVQHLNDVLLPHKYTN
>NZ_CP031208.1|WP_024855042.1|1052469_1052985_+|isochorismatase-family-protein
MAQALIVIDMQQALAKIDHRNQMVATINQRIDRYREAQRPIIFIQHTEPGMEVASAGWQLFPDLHAAGSDVYYNKTRPDSFYQTGLEAFLKMNQLRTIEICGAQVEYCVDTTIRVAYHLGFQIELLMAGISTLDSDLLTATQIKQHHAHIWEHRFAEFVTADTELDGQYQK
>NZ_CP031208.1|WP_011667647.1|1051837_1052158_+|hypothetical-protein
MSISDHQQWLVDFYRQRNWYQYSPFVHLNFLTEEVGEVSRAIRAEEIGRDHPGERPATTAEKRANLKEELADALDQVLVISSLYDIDAADLLTASEQKLTQRFKQK
>NZ_CP031208.1|WP_139566433.1|1051071_1051593_+|BioY-family-transporter
MQERQSIPLVGLFIAIIVIFGFFPAIPLAISPVPLVLQNMGVMVVTLLLPTRQSLAAIGLFLLLVLVGLPVLASRQAGPAVFLGPNGGYLVGWLIMPLMLQGLTYGRVPRLVAILLSAMGVDILGALWLSTVTTMSLPQALVATLAFIPGDSLKAVGAWWLAQRLRKWAPKMI
>NZ_CP031208.1|WP_011667649.1|1050269_1051061_+|biotin--[acetyl-CoA-carboxylase]-ligase
MQPKGNQLAVDRIRELRQTTCPIAIQLRSTVDSTNAWAKRVPAASDSPMQAFLAEQQTAGYGKRQRAFFSPAFQGVYLTVRTAVTAPVNPGRLTTAVGVMVVRCLAATYPKQTFQLKWVNDILLHQRKCGGILIENLLDRQEVLIGIGLNVTTRFSTELANKATSIVGGNWVDRNGLVAGLLDELVMGLPHYQDAQFLADYQQLCTTLGQAVRVQVGPDWVQGVAVTLTDQGALVIQLASGERRIVASSEAIKVMTPVGDYRG
>NZ_CP031208.1|WP_024855043.1|1049498_1050257_+|enoyl-ACP-reductase-FabI
MNGILTDKVIVVMGVANQRSIAWGCVQAILAQGGTPVLTYQNERLKKSIQRFVPEDIQLVACDVAEDAAIQQAFQQIGERYGNIDGVIHAIAYADPETLKQGLVETRRTGYNLAQEISAYSFIAVARYARPWLTKPASLITLTYFGATRAIPNYNMMGVAKAALESSVRYLATDLGTEQIRVNAISAGAVKTLAVTGIKGHGDLLKMSTSLTVDQQSVTTSEIGNVAAFLLSDLSTGMTGDILYVDKGVHLM
>NZ_CP031208.1|WP_011667651.1|1048700_1049468_+|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha
MVKSAYQTVQAARSQDKITTEALIDGLVTDFFECHGDRVDGDDPTIIGGIGRLNGQPITVIGTRKGRNLTENVARHFGSPMPQGYRKVQRLLQQAEKFGRPVLTLINTPGAYPDVASEFHGQGEAIAQCLYQGMQLKVPYISLIFGEGGSGGALALACGDRVYMTVDSIYSVLSPEGYASIMWKDASRVREAAAALALTPQDLKREKVIDDILPEVHTATELSQLTDFLHEQFKILGKLPISTLIDQRQTRFDQY
>NZ_CP031208.1|WP_011667652.1|1047867_1048701_+|acetyl-CoA-carboxylase-carboxyltransferase-subunit-beta
MLPAKFKTPSQKSLNRRMASIPDGLVRRCPVCHTTFLTDHWEPTRLCPACGYGFRLTAMQRIKLTMDTFQETNAQLTVPDRYTDAAYQAKVARGRQLTGLNESVLTGFGTIDHQSTAIGVMDAFFVMGSLGTATGEKITRLFDEATAKRLPVILFTASGGARMQEGIHSLMQMAKVSAAVARHSQAGLLYIVVLCDPTTGGVTASFAMQGDLILAEPHALVGFAGRRVIEQTIHQTPPADFQRAETVLQHGFIDAIVARPQLKQRLADLLRLHKGES
>NZ_CP031208.1|WP_024855040.1|1057030_1057996_-|CAP-domain-containing-protein
MSKKARKLLCIAFSALVGFSITAAIPTTSQAAKRKPGKVVRTMKYKAMKVKAKKGYVYTSTKLTKRGVHLTKYKNKVMTTKKAYLIKVPGKPAVWYDRVSSKNKKLNGYVYNNYLKVIKKSSTNGKTSTKTTNKIPVDPDANVPLKDLYSYGTNSKTNPGQKTGHDGDQSYFDSDLFSKYPANLEDYKTIFVELLNQERQMRGISPVSADSALMQIADKRAEDTKAINYLEHRDGNGNLIAGNYLKEAGINVSNYAECLCFETEAPARMAVRDSLRGYIYQDADHNWGHRDSLLNPAFAHIGVGAVKSSDGNFIDNAVVLY
>NZ_CP031208.1|WP_015473674.1|1058366_1058597_-|hypothetical-protein
MSIETAHDSIVLWENKAVELQDHIDDLCIILESHDDPEIEKMVHRAMQEKARYNKKIQKAQNELDSAIGSILSGIN
>NZ_CP031208.1|WP_133174544.1|1058705_1058780_-|hypothetical-protein
MECPYCGQPVSVSDTQCPYCHRDL
>NZ_CP031208.1|WP_107696681.1|1059215_1059905_+|glutamine-amidotransferase
MLTSSYILNLSQFERRLSLMKQAIFVMMDQYADWEGAHLSSQLNQMTDWTVKTASNQPEVTSIGGWTTRVDYQISELNPEMTLLVLIGGNAWQHDDPRLTALIQQCLQRKVIVGAICGAVDYLARNGLLTGYRHTGNAQFSWQSFPKYQNPTDFELQQVVVDRQLVTANGTAALSFTSAVLKASGQLTIAAKQALDLQQLGYYDNTETHLNCRGDRSWIRLVLKKVTDC
>NZ_CP031208.1|WP_011667636.1|1060032_1061121_-|NAD(P)-dependent-alcohol-dehydrogenase
MQIKTAFSDGTSEQLKIIDATLDEPKANEVLIKMVATGVCHTDTAGRDGLTTPLPVSLGHEGAGIVEQVGSSVMDLQPGDHVVLSFAYCGRCQHCLTGHPGMCEHFNELNFAGHNFDGSHRIHTLDGQPISTFFGQSSFSTHTVVDQHNVIKVDPTVDLRLLGPLGCGIQTGAGTILNYLQPKFGESLVIFGTGAVGLSAIMAAKITGANHIIAIDIFDNRLALAKELGATEVINSHQADVEATLKEILPTGADYAIDTTGVSPVVMNALHALKPGGECAVVGMGRGLTFNLMDDLMAEGKKISGVIEGDAIPQLFIPKLVDYYKQGRFPFDKLIKFYDFDQINDGFAASKDGSVLKPVITF
>NZ_CP031208.1|WP_011667635.1|1061316_1062135_+|LysR-family-transcriptional-regulator
MSQRAVSKRISALEAEIGATLFDRQKNKINLTAAGKHFLTRATELLNTMRMTTYEVQQFTQQAKEQFSVGYFSPFEGALLRMALLDLPTTTNFLIEEAGIEHLISDVLLKKIDCAVIIDNPLFNAKIDQTNLDSVTLVTDHMTLGLSPDLISDQTDSPADYLAKFPVIYYSSEESTYLEEVFKSSIGQLADTFNARRVNSYEQMQLLVGMGKAISFYPTELIKYMATPYDHIAYLSLDGVTTAHSEFKLIYHHDNHQPLIKQIQRYFDTHQF
>NZ_CP031208.1|WP_011667634.1|1062218_1062572_-|MerR-family-transcriptional-regulator
MKIETVAQRYHISTSAIRYYEQQGLIGPINRINGIRDFNTTDLERMDFILCVKQCGMTIKQMKQFIATYEQGDSTLRERLTILQTQLSASEEQLTTLTQSISHLKQKIGDIHIRLAE
>NZ_CP031208.1|WP_011667633.1|1062683_1063691_+|aldo/keto-reductase
MQYTKLGHTEIMASKICVGAMSFGQPGTMHDWTLDYPASERVISHALSLGINFFDTAKGYSAGTSETYLGRALKAQRVARDQVVLASKVYFNPGRLSAKAIHHEIDGTLKRLETDYLDLYIIHRFDYDTPIEETMAALNELVTAGKVRAIGASAMYGYQFNNMQQVAKDRGWAQFQTMGNRYNLLYREDERELIPICQQQGVSLTPYSPLAAGHLSHSAWQVDTLRSQTDRVAMGKYDRTETEDQRIVARVAELAHKYQVSMTQIALAWQWAKGVAAPIVGSTKTSHLDEAVAALSVKLTTADIDYLEDLYRPHPIVGALDHTPAAGTILIDQKK
>NZ_CP031208.1|WP_011667632.1|1063797_1064862_-|ribosome-small-subunit-dependent-GTPase-A
MSNSNLLSYGVTSTLIHQFADISDRQVGHIVRQERQQYQVITAVGVVSAQTSGRFNHHVLDTSDFPVIGDFVGIQLTPTKDAAIIHQELPRNSLFVRQAAGTTHQVQSVAANVDVALICMSLNHDFNPHRLERYLTVCWDSGATPVVVLTKSDLCSDTEAKLAVIAPMTLGVTVLTTTTTTANGLAPLQTFLQAGQTFALLGSSDVGKSILINRLLGKTIITTDGLRNDDKGHHTTTSRELYQLSSGALMIDTPGMRALGLWGADTGLAQNFSDVADLIRHCRFRNCHHQTEPGCAVKAALATGQLTTERGQSYQKLQAENAYSHDTQAYLAQKQRTEVANAKQIRQIYHPKHY
>NZ_CP031208.1|WP_011667631.1|1065419_1066886_+|catalase
MREDLKNSAGQPWGDNEHSLTAGQRGPVLIQDYNLLEKLAHFNRERIPERVVHAKGAGAEGTFRLTKDMHQYTKAKIFTEMGKSVPMRIRFSQVAGEMGSADTVRDVRGFALRFYTDDGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHERSQDMQWDFWAHSPESVHQVTILMSDRGIPASYRKMHGYGSHTFKWVNEAGEVFWVKYHFRTAQGIQNLSNDVAQRLAGENPDYLQADLYHAIEAGDFPTWKVCVQVIPEQAGLDYPADIFDVTQVVSQKDYPLIEIGEFTLNKNPDNYFEGVEEAAFSPANLVPGIEPSPDKLLQGRLFAYKDAARYRLGVNYEQLPANRPLNHPNNYERDGFMQTDNHGDQVNYEPNSQGGPQEDPAGRLTPYTVSGKAGNYAYQTDYGRAAGKLYRLLPADERQRLIETIVMNLGQVKSHDVKRLETAQFYEADHDYGLAVAKGLGLKLDEIKDYPFDTTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031208_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031208_2

2224414-2224746

Orphan

I-E,II-B

Consensus_repeat	Method
GGATCACCCCCACACCTGTGGGGAATAC	CRISPRCasFinder
GGATCACCCCCACACCTGTGGGGAATAC	CRT
GTATTCCCCACAGGTGTGGGGGTGATCC	PILER-CR

5 spacers

The CRISPR arrays of NZ_CP031208_2

>merge|NZ_CP031208|2|2224414-2224746|CRISPRCasFinder,CRT,PILER-CR
GAAATGCCCCCACACCTGTGGGGAATACTGACAACCAAAAAATATACGACTTTAACTTCTGGGATCACCCCCACACCTGTGGGGAATACCGGAAAGTTTAAATCTATTAAAGACGCACAATAGGATCACCCCCACACCTGTGGGGAATACCCGGTATGCGTATCGAAGAAGTCCCAACCAATGGGATCACCCCCACACCTGTGGGGAATACGATGAATAAGAAAAGAAAACAAAATAATACGCAGGATCACCCCCACACCTGTGGGGAATACCGCCCACGCGTTCTTCATTTAAGCTATATTCAGGGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP031208|2|2|2224414-2224746|CRISPRCasFinder
GAAATGCCCCCACACCTGTGGGGAATAC	TGACAACCAAAAAATATACGACTTTAACTTCTG
GGATCACCCCCACACCTGTGGGGAATAC	CGGAAAGTTTAAATCTATTAAAGACGCACAATA
GGATCACCCCCACACCTGTGGGGAATAC	CCGGTATGCGTATCGAAGAAGTCCCAACCAATG
GGATCACCCCCACACCTGTGGGGAATAC	GATGAATAAGAAAAGAAAACAAAATAATACGCA
GGATCACCCCCACACCTGTGGGGAATAC	CGCCCACGCGTTCTTCATTTAAGCTATATTCAG
GGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP031208|2|1|2224414-2224746|CRT
GAAATGCCCCCACACCTGTGGGGAATAC	TGACAACCAAAAAATATACGACTTTAACTTCTG
GGATCACCCCCACACCTGTGGGGAATAC	CGGAAAGTTTAAATCTATTAAAGACGCACAATA
GGATCACCCCCACACCTGTGGGGAATAC	CCGGTATGCGTATCGAAGAAGTCCCAACCAATG
GGATCACCCCCACACCTGTGGGGAATAC	GATGAATAAGAAAAGAAAACAAAATAATACGCA
GGATCACCCCCACACCTGTGGGGAATAC	CGCCCACGCGTTCTTCATTTAAGCTATATTCAG
GGATCACCCCCACACCTGTGGGGAATAC

>NZ_CP031208|2|2|2224475-2224746|PILER-CR
GGATCACCCCCACACCTGTGGGGAATAC	CGGAAAGTTTAAATCTATTAAAGACGCACAATA
GGATCACCCCCACACCTGTGGGGAATAC	CCGGTATGCGTATCGAAGAAGTCCCAACCAATG
GGATCACCCCCACACCTGTGGGGAATAC	GATGAATAAGAAAAGAAAACAAAATAATACGCA
GGATCACCCCCACACCTGTGGGGAATAC	CGCCCACGCGTTCTTCATTTAAGCTATATTCAG
GGATCACCCCCACACCTGTGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031208.1\|WP_011668934.1\|2218104_2219247_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_CP031208.1\|WP_011668939.1\|2222942_2224253_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NZ_CP031208.1\|WP_107696507.1\|2234080_2235961_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP031208.1\|WP_139566507.1\|2214204_2217810_-\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|213736
NZ_CP031208.1\|WP_021742666.1\|2208259_2209072_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP031208.1\|WP_011668950.1\|2236639_2238262_-\|glycoside-hydrolase-family-43-protein	unknown	unknown	gnl\|CDD\|226038
NZ_CP031208.1\|WP_011668945.1\|2231836_2232358_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NZ_CP031208.1\|WP_011668834.1\|2209435_2210341_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031208.1\|WP_011668937.1\|2220936_2221536_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|379199
NZ_CP031208.1\|WP_011668938.1\|2221678_2222662_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381309
NZ_CP031208.1\|WP_011668943.1\|2227445_2228360_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|260125
NZ_CP031208.1\|WP_015474590.1\|2238281_2239757_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225121
NZ_CP031208.1\|WP_139566508.1\|2226511_2227288_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|272861
NZ_CP031208.1\|WP_042255273.1\|2210432_2214221_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NZ_CP031208.1\|WP_011668936.1\|2220494_2220860_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031208.1\|WP_107696508.1\|2233059_2233767_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031208.1\|WP_011668935.1\|2219349_2220363_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200578
NZ_CP031208.1\|WP_011668944.1\|2228461_2231578_-\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|370572
NZ_CP031208.1\|WP_041815768.1\|2225561_2226497_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NZ_CP031208.1\|WP_011668940.1\|2224885_2225416_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670

Protein	Function_ID	Function_description	E-value
NZ_CP031208.1\|WP_011668934.1\|2218104_2219247_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP031208.1\|WP_011668939.1\|2222942_2224253_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	4.97728e-143
NZ_CP031208.1\|WP_107696507.1\|2234080_2235961_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	3.06907e-110
NZ_CP031208.1\|WP_139566507.1\|2214204_2217810_-\|ATP-dependent-helicase	gnl\|CDD\|213736	TIGR02773, ATP-dependent_helicase/deoxyribonuclease_subunit_B, helicase-exonuclease AddAB, AddB subunit. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RexAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. Nevertheless, the partner is designated AddB in both systems. This model describes the AddB protein as found Bacillus subtilis and related species. Although the RexB protein of Streptococcus and Lactococcus is considered to be orthologous, functionally equivalent, and merely named differently, all members of this protein family have a P-loop nucleotide binding motif GxxGxGK[ST] at the N-terminus, unlike RexB proteins, and a CxxCxxxxxC motif at the C-terminus, both of which may be relevant to function. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP031208.1\|WP_139566508.1\|2226511_2227288_+\|ABC-transporter-permease	gnl\|CDD\|272861	TIGR00025, Mtu_efflux, ABC transporter efflux protein, DrrB family. The seed members for this model are a paralogous family of Mycobacterium tuberculosis. Nearly all proteins scoring above the noise cutoff are from high-GC Gram-positive organisms. The members of this paralogous family of efflux proteins are all found in operons with ATP-binding chain partners. They are related to a putative daunorubicin resistance efflux protein of Streptomyces peucetius. This model represents a branch of a larger superfamily that also includes NodJ, a part of the NodIJ pair of nodulation-triggering signal efflux proteins. The members of this branch may all act in antibiotic resistance.	1.44936e-17
NZ_CP031208.1\|WP_011668950.1\|2236639_2238262_-\|glycoside-hydrolase-family-43-protein	gnl\|CDD\|226038	COG3507, XynB, Beta-xylosidase [Carbohydrate transport and metabolism].	0
NZ_CP031208.1\|WP_011668945.1\|2231836_2232358_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	2.03886e-36
NZ_CP031208.1\|WP_011668937.1\|2220936_2221536_-\|SDR-family-oxidoreductase	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	8.82255e-28
NZ_CP031208.1\|WP_011668938.1\|2221678_2222662_+\|aldo/keto-reductase	gnl\|CDD\|381309	cd19083, AKR_AKR11A1_11D1, AKR11A and AKR11D families of aldo-keto reductase (AKR). Bacillus subtilis aldo-keto reductase IolS, also called vegetative protein 147 (VEG147), is a founding member of aldo-keto reductase family 11 member A1 (AKR11A1). It is able to reduce the standard aldo-keto reductase (AKR) substrates DL-glyceraldehyde, D-erythrose, and methylglyoxal in the presence of NADPH, albeit with poor efficiency in vitro. Bacillus aryabhattai aldo keto reductase is a founding member of aldo-keto reductase family 11 member D1 (AKR11D1).	1.4297e-166
NZ_CP031208.1\|WP_011668943.1\|2227445_2228360_-\|prenyltransferase	gnl\|CDD\|260125	cd13962, PT_UbiA_UBIAD1, 1,4-Dihydroxy-2-naphthoate octaprenyltransferase. Human UBIAD1 is an enzyme involved in the synthesis of MK-4. Menaquinones (MKs, also called bacterial forms) are one of the two forms of natural vitamin K, the other being the plant form, phylloquinone (PK). All forms of vitamin K have a 2-methyl-1,4-naphthoquinone (menadione; K3) ring structure in common. At the 3-position of the ring, PK has a phytyl side chain while MKs have several repeating prenyl units. Prenyltransferases (PTs) catalyze the regioselective transfer of prenyl moieties onto a wide variety of substrates and play an important role in many biosynthetic pathways.	1.05209e-57
NZ_CP031208.1\|WP_015474590.1\|2238281_2239757_-\|MFS-transporter	gnl\|CDD\|225121	COG2211, MelB, Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism].	1.79677e-117
NZ_CP031208.1\|WP_021742666.1\|2208259_2209072_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	1.24988e-19
NZ_CP031208.1\|WP_042255273.1\|2210432_2214221_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP031208.1\|WP_011668935.1\|2219349_2220363_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200578	cd10954, CE4_CtAXE_like, Catalytic NodB homology domain of Clostridium thermocellum acetylxylan esterase and its bacterial homologs. This family is represented by Clostridium thermocellum acetylxylan esterase (CtAXE, EC 3.1.1.72), a member of the carbohydrate esterase 4 (CE4) superfamily. CtAXE deacetylates O-acetylated xylan, a key component of plant cell walls. It shows no detectable activity on generic esterase substrates including para-nitrophenyl acetate. It is specific for sugar-based substrates and will precipitate acetylxylan, as a consequence of deacetylation. CtAXE is a monomeric protein containing a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold as other CE4 esterases. However, due to differences in the topography of the substrate-binding groove, the chemistry of the active center, and metal ion coordination, CtAXE has different metal ion preference and lacks activity on N-acetyl substrates. It is significantly activated by Co2+. Moreover, CtAXE displays distinctly different ligand coordination to the metal ion, utilizing an aspartate, a histidine, and four water molecules, as opposed to the conserved His-His-Asp zinc-binding triad of other CE4 esterases.	1.66375e-79
NZ_CP031208.1\|WP_011668944.1\|2228461_2231578_-\|YfhO-family-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	3.69128e-73
NZ_CP031208.1\|WP_041815768.1\|2225561_2226497_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	6.47864e-106
NZ_CP031208.1\|WP_011668940.1\|2224885_2225416_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.64201e-15

>NZ_CP031208.1|WP_011668939.1|2222942_2224253_+|NCS2-family-permease
MQRIANFFHFEELGTNYKTEILAGLTTFVSMAYILFVNPQVLGASGISQGAVFTATAFASAFGCMLMGILANYPIAISASLGINAFFAYSVVIGMKVPWQTALAGVFVASILFMILTAFKLREKVVDAIPRDLKMAISAGIGLFIAFIGLSQGGLVAADKSTIVSLGSLQVGSTWLTIFGLLVTVLLMSARVPGAIFIGMVANSILGLVTGLIPMPSHIVAAVPSISSTFMVGLTHVGSINSLQMIVVVLTFLLVTFFDTTGTLVGLAEQAGLVKNNKLPRIGKALMADSSTMVVGSLLGTSPMGAFVESSAGIAVGGRTGFTAIVTGILFIFGAFFSPLLAVVTDQVTAPALIIVGVLMAQSLKNIHWEKFEVAAPAFLIVLGMPLTYSISDGIALGFITYPLTMLAAKRGKEVGAMMYGLAVVFVLFLWILNAA
>NZ_CP031208.1|WP_011668938.1|2221678_2222662_+|aldo/keto-reductase
MTHELVTLGKTDVRTTPLGLGTNAVGGYNLFPNLKDDDGLNLVKAGLNHGIQLLDTAFVYGLGHSEELVGQAMHDFDRHSFTLATKGAQDFSSGEQVINNDPAFLTAQVDASLKRLNTDYLDIYYIHFPDKQTPKAEAVGALQRLREQGKIRAIGLSNFSLVQVKEANADGYVDVVEDEFSLLHRDHETDLMPYLADHQISFVPYFPLASGLLTGKYDQSVQFPADDIRSQISDFQEPRYSQALTAIDQVRPIAQAHQATVAQTILAWYMQNPLVSVVIPGAKRAAQVEANAQALEVTLTAAEYQTIDTAFAGFKATANGKSLADPD
>NZ_CP031208.1|WP_011668937.1|2220936_2221536_-|SDR-family-oxidoreductase
MTTYLIIGANRVGQLVARQLATESATVRLLHDGKETLPSDLATQVTELTGDLTQEATYTAALQDQPIIFSALTGMDVDLAFEALFDAQYHQRLTFQRFVMLSTAGVDQEVTGDLAYPGITDVAEYLKQQRYAAKLVDEAEFPYTILRPVTLADSPRRDPQIIKEGAAVPAGTVSRETVAQVAVSLLQAGGADYQSLAIC
>NZ_CP031208.1|WP_011668936.1|2220494_2220860_-|hypothetical-protein
MALQIDEQQLQAIRERMDEANQRAHFVIFQSVERESGKVLRLITDIDSFRAIQEQHQDDSDMVIIQDIVPITDTLARWAVAENMAAQQGDNAEVLADLERYTNEVLKENHQTVNPPESTDD
>NZ_CP031208.1|WP_011668935.1|2219349_2220363_-|polysaccharide-deacetylase-family-protein
MVKIGKVLGVLVATVALGVGSVPVTGQAKSTNKTVTFGQLTNKNTHRLAAIRQAARQEILTTTKAKSSRVAAVYQVKLPTHMTKTATLTKSGLRMNLLKNSFKVKQITIPYAQLKGKVLNRYLPKANRTSTIKTSKLVALTFDDGPDPTLTSRLLKTLKKYHAHATFFEVGQSVSRYPKISRAVLAGGNEIGNHSWNHPNFNSIGTAQTVSQVTRTNRAIYQATGTLPQYVRPPYGNITAAEGRAIEQPIIRWSVDSRDWAYLNSSKDINEVMHDTHGGDIILMHDIHAQSVAAAPTIIKRLQAKGYKLVTVSQLLNSQALPGLQYFGAHDYRTVGK
>NZ_CP031208.1|WP_011668934.1|2218104_2219247_+|ArgE/DapE-family-deacylase
MEDSEQIQILQHLISINSVNDHEADVAAYIQQLFADHGITSQVIPYADGRANIIAEIGDTTSDQVFALAGHLDTVATGDVADWKFDPFSAHIVDNQLYGRGAADMKSGLAAMVITLINLADQQTPLTGRLRFIGTVGEENGAMGSRMLTEKGVADDLTAMVIGEPTGGNLVYAHNGSLNYHVYSRGVGAHSSMPEKGINAITNLIKYVTAEATAFDDAPVSPELGPLVHSVTVFNGGEQVNSIPAKAELQGNIRPIPEFDNTAVIHRLHETVDRLNQEPGVDLALHVDYSFKPIISAKDSPLVQTTKAIADQEFGHAIDLQVIHGATDASEFTKSSHDFPVIVYGAGKWDAAHALNESVDLDEFRHVQHVYQQLVEKFLS
>NZ_CP031208.1|WP_139566507.1|2214204_2217810_-|ATP-dependent-helicase
MSLQFILGSAGQDHRTPMVTALAQQVTAHPTDQSYYLVPNHIKFETEVDVLSALKEQIAPEQALFAQTQVQVFSFTRLAWFFMKNEPIYQLPRISPAGLNMLIYQIIQTHADELTIFRGEVDRPGFVSQLATQLAEFKVGQVTAADLMSAIEQLDTTNTDLQAKLHDLMIIYEAFETQMMGKFVENTDLLNQLATYLEQQVDLQHAHFYLEGFSQLSAQERQLVAILIQRSASVTVALNLDHGYPQKLPDKTTLFFQSAKLYQQLYMVAQANRVPVLIDQQAKTARVSADLQALDTYWQASQTLSPQPSAVEKPTHIQIVQAANRYVEVSRVATQIRQLVATGNYRYRDFLVLTRHLDAYQTVIDPIFQAQAVPYFDDADIRMADHPFVELLNALFDVQRRNYRYADVFRVLKSELLLPRDADGELMAVPAYRQALALTENFVLKNGLEGQHWWTQDKDWVYNRFAVGDGGVQTTRDDQISAQINRIRRFVKQTLPPFFARLKVAATYTDAAAVLYQFVANAGVSERLMTWRDQAIAAGDLTKAGQPEQTWAAFCDILDEFHTILGDLPTVLPDFQALLQAGFAGAKFSQIPSTLDQVVISESGIVQANNRKITFIMGATADTMPDNQIPTTLLADNDRQDLSARLQQVDDGTYLRDDAATQLAGEPYLNYLAFMSGSERLIFSYPAMSDDARSGLQLSPYVARIKDYFGLSIDIAAANPVAEDEAILPFVGTRRTTLRHLVQASHDSQLREVPLSRSWLYVLNLLRTDPTYGELTTKLLGSLSYRNVPTQLTPDIVTQLYGTKINTSISKLEEYYANPYAYFLNYGLNLQERDVFALSPASTGEFFHATLDGLMKLVNDQKLNLAALDDQQLREMTDEVMAKLLDTTENPQFAILESSHRMGYIRQQLMKTMRQMAKTLQEQSKRTKLRPKRTEVQFGLGDERGLAALSFDVGKRRQVTVRGRIDRLDAVQVKDKTYLGIVDYKSSEHKFSYQEAYYGRAMQMLTYLDAVKQNLPTLLDAPTAKDAELAGAVYLHLQNPILKAAEVLGEDPLTSLLKAEQYQGLLLDDPDLLTNLDTLFGTPDYSGSSLLFRGLRRTKTGKITSYGKLLVNSNELDLLLTHTERLIKRAATDIFDGRVDLAPFREQNRTALQYSPYKSVMQFDPLLKENNYRDLPSLNKDDVMARIAAEQEQEATDEHEI
>NZ_CP031208.1|WP_042255273.1|2210432_2214221_-|helicase-exonuclease-AddAB-subunit-AddA
MSTKFSFTPSQDQAIHQTGNNLLVSASAGSGKTRVLVQRVIERLKTGVGIDQILIVTFTKAAAAEMRERIQTALRQELAVSQGDSAQQQFYLRQLNQLPVADISTLDAFCLRLLQRYYYVIDLDPVFRLLADETENGLLRDEVWADLREDLYANDDSGLFARLTENFSGDRNDQGLADLVQQTYTFANATPNPTAWLAELPQPYQLDSDQLMTTSFYQQRLRPFFQSQLQQLQADLTSAQALANQAGLDKQAAHVTAVLENVAAVQQLVTGDSWNALRAAIQDFAWGRMPAVRKTNEDYPIYNELKTTYYDPARKQLDSLKKTYLIQDEQQAMTTIRRSGELVGELSRVVTAFRTAYRQEKQRRHVLDFADVEHAALAILTQDSDQSRQVAAQLRHQFAEIMVDEYQDTNGLQEAILTAIAEPAPQGNLFMVGDVKQSIYRFRQADPTLFMTKTDQYAADAAAGELIVLAENFRSMKNVDDFTNLIFKQLMDRELGEIDYTGAAQLKFGASYYPDTVTSTAELLVYLTEDAPESAGDADSEAMDATFQVDNKHQGEVLMVGQKIQQLIADQTPIYDREAKQVRPMTYGDITLLTPTRTNNLIITDELRRLGIPVVVNDAQNYFKTTEIQIMMALLQIIDNPYQDIPLAAVLRSPIVGLNENELALLRINQRTGDYYQAVLHFQRSFVPNQASDFQQAVYQKVSHFLEQLQEFRDIAQQDELVTLIWRIYQETGFLDYVGGMPAGEQRQANLHALYERAKSYEQSSFKGLFQFVRFVERLQERDDDLAGAPVQAADDAVSVMTIHGSKGLEFPVVFIMDASRQFNKQDQQGNYVMSGKTGIGIDYLDPDSRVKAPSLQKLVTAQAISRASLAEEMRKLYVALTRAESRVYIVGSHKTQEAAISAWEQAYQSPNLVLNATLREKNTLANYLDWIGMCLVRDPKFAAELRQGTTTFSGLAGDPATFAVHFVTAHDLGPTQGVNETAVDWLQAASETAAKVTTPPVDTEQLHQIMDFRYPHQAATATTAYQSVSEAKRLFEDPDNATIGEYQASATGQVGGHRFVTHDFARPDFLQTVREPLATEIGSATHLVLQQLDVTVTPTLDRVQGVIDQLVADQVLTAEVAQRIQPELILRFFSSSVGQQVLAAPDQLHREVPFSLLMPARSLFQDFQETDSQVLVHGIIDGYLTTPAGVILFDYKTDHVNAQNQAASIEKIVERYGGQVNLYAAALKQMTGQPIVGQYLYLLAIGELVAVPEQQVRRLSE
>NZ_CP031208.1|WP_011668834.1|2209435_2210341_+|hypothetical-protein
MTIITRIIKGCLCLLALGTVTVGSLSGRAQTEKPSALVKVGDYRASTDFLNLSAYYQTIRPVTVKVAYVSTYKTQHTIMQKLTLPAGLTVAGNLTTTKHGSYLVPSLQLYLARLSYPALQNSAKANYTLDPGTSAYSPQATISDTTKLRAFKRVAAPDYMPGYSHGDLYIGGAKAALSPVEPTTKSIRITPDGYVEVLKYDTKANAGLGFYQKPVSLAKIVKTRFHDPNRTLYLNHPLASVKTKAITQNGQTRYRLTLKNLHTPQHIAGDPETGTAGTFDSLYSIGGTTYYTFIGYDGVSN
>NZ_CP031208.1|WP_021742666.1|2208259_2209072_-|helix-turn-helix-transcriptional-regulator
MAYLGIITENFTRRFGIMGWDLQFTHYLDDMQTYRSRDQTAKALILLGYVERDFIRFYRAGRIAEGIQFAKENLARSRLLLNELPPQQKRAQLHGLVDILAFEGVQNHAFIYEFIQLRDDYHRQIKTLPVTTARYVPWIIEIVQDFGNLAAKDGLPYDDHLESTLDIIYYVSAHLRDKLTVKQVVDHVNQRCNPVGVQRAFSDEMQMSIRDYINVKKIREAQRALLTTTVSVKQIAQELGFYDTSDFSKRFKREIGQTPLEYRQINSQKD
>NZ_CP031208.1|WP_011668940.1|2224885_2225416_-|MarR-family-transcriptional-regulator
MSDLFKQETTASKLIEFGMLRHVADDIADRDDDHPERQMIFQGQGKILLALMQEDHLAQKELAERLNLTAQSTAEFVRKLEKKGFVTRMKSPTDQRVTVVSITDAGRKETTKNVQQIPPFLTILDDTELDQLAHILDKVNQHMYEEVNAANPTWFNKFHQVIMNRMLSQLHSGEDR
>NZ_CP031208.1|WP_041815768.1|2225561_2226497_+|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MQPSTAITVSHLSKTFGVKTVVDDLSFAVKPGEVFGLLGPNGAGKTTTLRMMTTLLKATSGTVTIFGHDVRKESRLARAMFGLTGQYASIDEDISARENLMIFSRLNGLSRTAAKQRTTELLEEFSLTASANKALSDFSGGMRRRLDLAVSLITRPGLIFLDEPTTGLDPRTRSQMWTTIRQLVAHGSTIVLTTQYLDEADALADRIAVIDHGKLIKLGTPTALKQQIGGATLTLSLAKATQGPLAQRLLAQALHAQPTLHGAQLTAHLENPNQITDLLVQLQAADISLANIAVQEPSLDDVFFALTTGKN
>NZ_CP031208.1|WP_139566508.1|2226511_2227288_+|ABC-transporter-permease
MEIQTQHGNLIGNTLTMAYRNLLKTLHNPDRFMDVIIQPVMFMLLFGYLFGGAIAGGVQAYLPTIVPGILIQTLLSAASGSGAQIREDLDSGVFDRFKSLPMAHIAPLAGQLFADILRLLVATVVSLLTGYAMGWRPTLGFGWIIVIAALAIFIGWAISWVFALFGLLAKSSSMVQSVSMMVMMLLSFLSNAFIPLKTLPHFMRVIADANPITYVITAIRQILAQGAWNNNAWIVLIFGIGIVVLFAPLTVWAYNHNN
>NZ_CP031208.1|WP_011668943.1|2227445_2228360_-|prenyltransferase
MPKWLNWSVFYELTEIYTAPLNVMWFILGAAIVQYHVHTVDWINVGLCLAVVFIFDLAVNVADNYYDYLHAHDREDYAQKTNPIGRLHLPAKGVFWLAWVLYAVAAIPGIVLVMRTGWSVAVFGVVGYLIGIFYTAGPHPINATPVSAAVVALAIAFGIQLTCVYVSIYGQQPLSWSIVGTTFLLCMPLTLIFFTVQLANDTSDRDEDIANHRYTLAVYLGKRRSVRLIQLFLVIGTLWTLVNVGLGLAPLVTALAVILLPVMWRGMRPFFAIQDKRKTFMAMVKSASLFFIAYPVLFALGTWL
>NZ_CP031208.1|WP_011668944.1|2228461_2231578_-|YfhO-family-protein
MRIAHHRWPLWVLYTLAFAVIAAISFGIFGVANRTLIWNMDGITQHYPLIREFHQLLMKSGLAGVTGWSWTFGLGADKLTTLAYYVLGDPFAYALALLPTRLLEVGYGWAIVLRLYAAGLAFLVLAKRYAFKPGSQLVGAVTYAFTGYSLMVGVHHPFFLLPMVWLPLLFVGIDRILQGKGWGFLAAVTGITILSNFYFAYILGLGSLIYALIRYFSCRERGQLAVSWLVATARFLAAAVTGLLISGVLLLPSLLMMLKSTRTVSIFANGLWLYPLNYYLTLSNTILTTGNTLNYWAVLGITGFGFLGCVYTLVHWRQHRWLAITLLAVIVGLLFPAVAAFFNVLSTPSNRWILLAAVPFGLALMTLMDHLTALSLPDRWWLLGSSFGLLGVIYLSNGFTFSNPARDLLTYGLLLATTLLVVVALPRRWTFGGIGILIGLNLINNAWGYYDPNLSNQATQQLRVSDATRYIQDYFDGAQSAVQSDHAFSRVSATRNYNLFRTVGNNMTMSHGLHGIMSYFSVQNGYVGQFSRDLGNAEYAMNAPMGQADDRTTLTQLLGVKYLFARTDQVTNHAALPYGYRAAKKIYPEQPVYGLSNGVGTQVLTTNLAFPLVYTQPQVLTTKAWHRLSLVDRERSLTQAAVTSQPVAGVKAAHYQSPKRTLAYTVTPDTIPVIDSTNKVIQYRLKQAAAGQKTGLNDKQLATYGTTIQTPQLTVDKNGLLSKQEVQQYGPMVQLNRDQAALQRVLTHNQQIIQRTTQANQTGLHQLTSDAQGQPIKYTVTLKHPQQAQGTELYLELDGISSQQLTTKDQLQTADNTSVLGNTPRSNLTKLNAWRTAISNPDLGDYWVTAKTRNATKTFSQFGLDNLSDYEPKHQVLLNLGYSQQLRKTIDVTFNATKQLNIKSAKLIAVPFGARYDQQVHAVQRRGLQHAQIRDNAVTGELTTPQASVMTTSIPYSSGWRLTVDGRPTATTVVNEGFVGARLAAGTHRIRLTYRTPGLIGGLILTIVGLVVWLGEMSWWHWRHPQAKTRATKSKSDA
>NZ_CP031208.1|WP_011668945.1|2231836_2232358_+|QueT-transporter-family-protein
MNSKKRVSGVSDTRSMVLAALIAALYVVLTTVLSALSFGPFQIRLSEMFNHLVVFNKRYIAAVTLGVFIANIIASPFGFLDIATGTIQTLLALLVMYWLSKFVHNRIAQMAINTVVAVFFMCMIAWEIAIVSKTAFWPTFWANWLSIGWGELVSMIFGGVVIYLLSLKIDFTK
>NZ_CP031208.1|WP_107696508.1|2233059_2233767_-|hypothetical-protein
MRTKHAMDIGAREKTKSGYKPIYIKKNKLLSISAMNIRGKYPHFKTYVAVTLGDIHYAKINKVVYMKKFIRYTTANFTPVKTLRAPIRTQLLRQGTGFVMSSTHINQPTYSSALFVTLDNYIQTYSQARMTKINDKWMNADVDSDFAKLKPTDSVKVTKLVKTGTAYKIDYARPLKSFSDKKIGPHHYRLTIKQLGRQYQNYTPIDDTYDTAASWTNFTINTKPYFSGFADWGLD
>NZ_CP031208.1|WP_107696507.1|2234080_2235961_-|DUF2207-domain-containing-protein
MVVFRGYATLKPNRIGGGVLMRYRQGVWWLLGLILALIGGCQMTTINAAASYTIKPFRMNVDVTRRGDANVTETMTYHFDDDYHGVYNVQDLRGIQGGRLTGVSTRLNDGGMRPARAVDSGDSRYQVSQSNQRLKVKVYRAVSAGDRLQVTYRFHLTGVVTNYADTAELNWKLIGAGWDEPLHNVRLTIQLPTQPVKQLQAWTHGPLTGHTAVQSKTGRVVMTIPENPANTFVESHLLFPTQVTAANPNTCTQKRRAAAQKQEAKLAADANAKRQQQRWLVVGGYAALTVGLVALLAGSYHWMRHHPANRYPHPIPVDHFFDVPGVAPAVAVALLNFRSPDTDALSGELMMAASRHEIKLEPVREKKHDTVRLTKTGTVTNIFLQRAFERLGSLDSFTLRDLKQFAKKDKGSRVSHWFKEWQNQVDEAAEVYQDGDNIAIRQRLLGIAWGLTFVIAAWIGVSALVDPLVFKLSAGLGLVVLFGSWTYISRQRRQVDRNTAEGLVLINEIGGFRRMLKDIGHFNTAKIGDLILWEQILPYAAAFGLAKQVADKLAIDFGKDVVAGALVAYPLYYPGAFNLSLGDMVQTSIAGAIDTSANFSSPSGGSGGFSGGSSGGFGGGSGGGAF
>NZ_CP031208.1|WP_011668950.1|2236639_2238262_-|glycoside-hydrolase-family-43-protein
MKIQNPVLPGFNADPSMIRVGDTYYIANSTFEWFPGVRLHESKDLVHWNLLPSPLSTTTLLDMKGNPASGGIWAPDLSYADGKFWLIYTDVKITEGPFKDMTNYLTTATDIRGPWTDPIAVNGVGFDASLFHDENGRKYLVQQTWDHREYHHPFNGITLTEFDTATMQLKPETARNIYNGTDVKLVEGPHLYQINGYYYLFAAEGGTVFTHQEVVARSKTLDELSFESEPDGPFITNMDTPDFYLQKQGHGALTSTPSGEWYYASLVSRPWNHTNESSHDPRGWSTLGRETSIQKVEWDDAGWPRVVGGHGGQVEVDAPKDAIETTAPKDHSQHDDFDQPTLDLNWNTLRQPFTAQMGSVGNGELKLIGQQTMSSNFDVSLIARRWQAFNFDAETKVKFDPFTYQQMAGLANIYNDKHYSWIFITWDEKKGHVIEVAQNDNNNYTSYLKDDAIKIPDGTDYVWFRTKVRKQSYTYEYSFDGQNWETVPVELDAAILSDDYVLQNYGGFFTGAFVGLMAADYAGYKRVATFDYFDYQELPD
>NZ_CP031208.1|WP_015474590.1|2238281_2239757_-|MFS-transporter
MASNTQATAQPAANDEFAKLSWRERISYGAGDLAQNLIFGTVGSMLLFYLTTVYGISAAVGATIFLVVRWVNVFWDPWVGAFVDKHGFKRGKYRPYLIYGGIPLTIMAALLFLPIDAVRGNVFYAFIAYLATALIYSFVNIPYGALNASLTRDNDEISTLTTVRMTEANIGNLLVYTFLPLFVQLASPNPQSKDIGFFGIHMNLGDYTSPKSGGAYFMVMAIYMIIGFIMLMCTYFGIKERVLPTEKESSAVKYADLWVEFKQNKPLQILGLFFLIGFTFMFFGNTVWPFYMQYNIGHSEWVASINLIGSIPGIFLVFLWPIVRKKIGKRQFFYAFLTLFIIGTLVLWVWSFPAFKNSVALGYIGRFLMQWGITAATGYMWSLVPEVVSYGEYHSKKRVAGIINAIMGLFFKIGLALGGIIPGYINAFFKFDGTKTTQSAGALAGIQWSMIWLPIILAFVAMWVMSRYTLTDSDVNKMNEELTAERKANQV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	26272-26303	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	41504-41535	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP018327	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence	14223-14254	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP014624	Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence	2807-2838	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP018212	Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence	3699-3730	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035157	Lactobacillus plantarum strain SRCM103362 plasmid unnamed1	14176-14207	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	18656-18687	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NC_005952	Lactobacillus brevis plasmid pRH45II, complete sequence	20354-20385	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	42351-42382	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP028277	Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence	36436-36467	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP014893	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence	18266-18297	0	1.0
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP032754	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence	198-229	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP028228	Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence	12578-12609	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP012296	Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence	32889-32920	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP053341	Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence	33191-33222	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035559	Lactobacillus plantarum strain SRCM103297 plasmid unnamed3	30140-30171	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	27890-27921	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	96451-96482	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP032758	Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence	41923-41954	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP012280	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence	9955-9986	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP014887	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence	1562-1593	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	9725-9756	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035116	Lactobacillus plantarum strain SRCM103295 plasmid unnamed3	103057-103088	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	53323-53354	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP023302	Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence	16481-16512	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	8945-8976	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	50559-50590	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP017958	Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence	33330-33361	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP032660	Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence	51969-52000	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP025415	Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence	18630-18661	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP028237	Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence	26410-26441	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP028263	Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence	9562-9593	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	26558-26589	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NC_020823	Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence	901-932	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP032655	Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence	59779-59810	1	0.969
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	28178-28209	1	0.969
NZ_CP031208_2	2.1\|2224442\|33\|NZ_CP031208\|CRISPRCasFinder,CRT	2224442-2224474	33	MN830254	Lactobacillus phage JNU_P2, complete genome	17234-17266	1	0.97
NZ_CP031208_2	2.1\|2224442\|33\|NZ_CP031208\|CRISPRCasFinder,CRT	2224442-2224474	33	MN830255	Lactobacillus phage JNU_P4, complete genome	3757-3789	1	0.97
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	5729-5761	1	0.97
NZ_CP031208_2	2.5\|2224686\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224686-2224718	33	NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	23455-23487	1	0.97
NZ_CP031208_2	2.5\|2224686\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224686-2224718	33	NC_047983	Lactobacillus phage Lb, complete genome	17182-17214	1	0.97
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP025588	Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence	4082-4113	2	0.938
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP035568	Lactobacillus plantarum strain SRCM103300 plasmid unnamed2	23742-23773	2	0.938
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP012285	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence	7341-7372	2	0.938
NZ_CP031208_1	1.1\|1054867\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054867-1054898	32	NZ_CP012272	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence	22047-22078	2	0.938
NZ_CP031208_2	2.2\|2224503\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224503-2224535	33	NZ_CP014917	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence	23424-23456	2	0.939
NZ_CP031208_2	2.5\|2224686\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224686-2224718	33	NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	36123-36155	2	0.939
NZ_CP031208_2	2.5\|2224686\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224686-2224718	33	NZ_CP014917	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence	18359-18391	3	0.909
NZ_CP031208_1	1.6\|1055172\|32\|NZ_CP031208\|CRISPRCasFinder	1055172-1055203	32	MN657132	Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence	4497-4528	7	0.781
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	MK496698	Capybara microvirus Cap1_SP_87, complete genome	2934-2966	7	0.788
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NC_017296	Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence	62340-62372	7	0.788
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NC_015686	Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence	62340-62372	7	0.788
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NC_001988	Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence	62340-62372	7	0.788
NZ_CP031208_1	1.2\|1054928\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1054928-1054959	32	NZ_CP020932	Marinobacter salarius strain SMR5 plasmid pSMR5, complete sequence	219578-219609	8	0.75
NZ_CP031208_1	1.4\|1055050\|32\|NZ_CP031208\|PILER-CR,CRISPRCasFinder	1055050-1055081	32	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	127714-127745	9	0.719
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NZ_CP047434	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6	89325-89357	10	0.697
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NZ_CP047434	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6	98643-98675	10	0.697
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NZ_LR214978	Mycoplasma cynos strain NCTC10142 plasmid 5	6-38	10	0.697
NZ_CP031208_2	2.4\|2224625\|33\|NZ_CP031208\|CRISPRCasFinder,CRT,PILER-CR	2224625-2224657	33	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	771862-771894	10	0.697

1. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

2. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

3. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP018327 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

4. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP014624 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

5. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP018212 (Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

6. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035157 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

7. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NC_021904 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

8. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NC_005952 (Lactobacillus brevis plasmid pRH45II, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

9. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

10. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP028277 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

11. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP014893 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence) position: , mismatch: 0, identity: 1.0

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
cattgaatgcggaatgacggcttttttatgaa	Protospacer
********************************

12. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP032754 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

13. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP028228 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

14. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP012296 (Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

15. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP053341 (Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

16. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035559 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed3) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

17. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

18. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

19. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP032758 (Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

20. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP012280 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

21. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP014887 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

22. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP014878 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

23. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035116 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed3) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

24. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

25. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP023302 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

26. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

27. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

28. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP017958 (Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

29. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP032660 (Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

30. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP025415 (Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

31. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP028237 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

32. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP028263 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

33. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP014904 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

34. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NC_020823 (Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

35. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP032655 (Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

36. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 1, identity: 0.969

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggcttttttatgaa	Protospacer
 *******************************

37. spacer 2.1|2224442|33|NZ_CP031208|CRISPRCasFinder,CRT matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 1, identity: 0.97

tgacaaccaaaaaatatacgactttaacttctg	CRISPR spacer
tggcaaccaaaaaatatacgactttaacttctg	Protospacer
**.******************************

38. spacer 2.1|2224442|33|NZ_CP031208|CRISPRCasFinder,CRT matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 1, identity: 0.97

tgacaaccaaaaaatatacgactttaacttctg	CRISPR spacer
tggcaaccaaaaaatatacgactttaacttctg	Protospacer
**.******************************

39. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 1, identity: 0.97

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gatgaataagaaaagaaaacaagataatacgca	Protospacer
**********************.**********

40. spacer 2.5|2224686|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016798 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence) position: , mismatch: 1, identity: 0.97

cgcccacgcgttcttcatttaagctatattcag	CRISPR spacer
cgcccacgcgttcttcatttaagctgtattcag	Protospacer
*************************.*******

41. spacer 2.5|2224686|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NC_047983 (Lactobacillus phage Lb, complete genome) position: , mismatch: 1, identity: 0.97

cgcccacgcgttcttcatttaagctatattcag	CRISPR spacer
cgcccacgcgttcttcatttaaactatattcag	Protospacer
**********************.**********

42. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP025588 (Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggctttttaatgaa	Protospacer
 ************************* *****

43. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP035568 (Lactobacillus plantarum strain SRCM103300 plasmid unnamed2) position: , mismatch: 2, identity: 0.938

cattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
aatttaatgcggaatgacggcttttttatgaa	Protospacer
 *** ***************************

44. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP012285 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence) position: , mismatch: 2, identity: 0.938

cattgaatgcggaatgacggc-ttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggctttttttatga-	Protospacer
 ******************** **********

45. spacer 1.1|1054867|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP012272 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence) position: , mismatch: 2, identity: 0.938

cattgaatgcggaatgacggc-ttttttatgaa	CRISPR spacer
aattgaatgcggaatgacggctttttttatga-	Protospacer
 ******************** **********

46. spacer 2.2|2224503|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014917 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence) position: , mismatch: 2, identity: 0.939

cggaaagtttaaatctattaaagacgcacaata	CRISPR spacer
cggaaagttcaaatctattaaggacgcacaata	Protospacer
*********.***********.***********

47. spacer 2.5|2224686|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019739 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence) position: , mismatch: 2, identity: 0.939

cgcccacgcgttcttcatttaagctatattcag	CRISPR spacer
cgcccacacgttcttcatttaagctgtattcag	Protospacer
*******.*****************.*******

48. spacer 2.5|2224686|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014917 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence) position: , mismatch: 3, identity: 0.909

cgcccacgcgttcttcatttaagctatattcag	CRISPR spacer
tgcccacacgttcttcatttaagccatattcag	Protospacer
.******.****************.********

49. spacer 1.6|1055172|32|NZ_CP031208|CRISPRCasFinder matches to MN657132 (Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgaaaacgagcttgtagcatttgaaccaa	CRISPR spacer
ggccaaaaacgagcttgtagcattagctcaag	Protospacer
***..******************* *  * *.

50. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to MK496698 (Capybara microvirus Cap1_SP_87, complete genome) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gatgaataataaaagaaaataaaataaactaaa	Protospacer
********* *********.*******  .. *

51. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NC_017296 (Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gaataataagaaaagaaaaacaaataatataaa	Protospacer
**  ***************  ********.. *

52. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NC_015686 (Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gaataataagaaaagaaaaacaaataatataaa	Protospacer
**  ***************  ********.. *

53. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NC_001988 (Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gaataataagaaaagaaaaacaaataatataaa	Protospacer
**  ***************  ********.. *

54. spacer 1.2|1054928|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NZ_CP020932 (Marinobacter salarius strain SMR5 plasmid pSMR5, complete sequence) position: , mismatch: 8, identity: 0.75

ggacagtaccaagatattccacaaacaactgt	CRISPR spacer
cgatcgtcccaagatattccgcaaacaattcc	Protospacer
 **. ** ************.*******.* .

55. spacer 1.4|1055050|32|NZ_CP031208|PILER-CR,CRISPRCasFinder matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 9, identity: 0.719

agatggcctttttcggcttagctgccttagtg	CRISPR spacer
acgcggccttttttggcttaggtgcctacgga	Protospacer
* ..*********.******* *****  * .

56. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047434 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gtattataagaaaagaaaaaagaataataaaag	Protospacer
*    ************** *.******* . .

57. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047434 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gtattataagaaaagaaaaaagaataataaaag	Protospacer
*    ************** *.******* . .

58. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214978 (Mycoplasma cynos strain NCTC10142 plasmid 5) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
atagaataagaaaagaaaacaacaaaaacatta	Protospacer
.  ******************* * **    .*

59. spacer 2.4|2224625|33|NZ_CP031208|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
atagaataagaaaagaaaacaacaaaaacatta	Protospacer
.  ******************* * **    .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1181880 : 1191111

Staphylococcus_phage(42.86%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015473763.1\|1181880_1182732_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.7e-14	33.6
WP_024855006.1\|1182900_1183542_+	hemolysin III family protein	NA	NA	NA	NA
WP_024855005.1\|1183697_1184189_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.5e-23	37.8
WP_015473768.1\|1184205_1185156_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.0e-117	62.1
WP_011667557.1\|1185167_1187060_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	6.1e-49	29.3
WP_024855004.1\|1187088_1188282_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	1.9e-35	40.2
WP_011667555.1\|1188415_1189354_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.2e-52	38.8
WP_011667553.1\|1190835_1191111_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5

DBSCAN-SWA_2

1293805 : 1302110

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047021650.1\|1293805_1295599_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.3e-44	26.2
WP_024855600.1\|1295588_1297349_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.7e-48	28.2
WP_011668031.1\|1297479_1297704_-	YneF family protein	NA	NA	NA	NA
WP_096110514.1\|1297803_1298037_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_024855599.1\|1298234_1298864_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	1.6e-14	50.7
WP_011668033.1\|1298903_1299344_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	1.3e-18	37.2
WP_043023465.1\|1299987_1301013_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.7e-41	35.5
WP_047021150.1\|1301084_1302110_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-45	36.6

DBSCAN-SWA_3

1416142 : 1486081

Staphylococcus_phage(15.38%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015473913.1\|1416142_1416790_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_011668204.1\|1416855_1417647_-	phosphotransferase family protein	NA	NA	NA	NA
WP_011668205.1\|1417708_1418935_-	ABC transporter permease	NA	NA	NA	NA
WP_139566445.1\|1418931_1419666_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	28.3
WP_024855560.1\|1419884_1420334_+	HIT family protein	NA	NA	NA	NA
WP_139566446.1\|1420768_1421686_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_024855559.1\|1421749_1422724_-	HD domain-containing protein	NA	NA	NA	NA
WP_024855558.1\|1422736_1425361_-	AAA family ATPase	NA	NA	NA	NA
WP_024855557.1\|1425350_1426565_-	DNA repair exonuclease	NA	NA	NA	NA
WP_011668213.1\|1426648_1426993_-	hypothetical protein	NA	NA	NA	NA
WP_011668215.1\|1429344_1429812_-	arginine repressor	NA	NA	NA	NA
WP_011668216.1\|1430046_1431738_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.6e-75	32.0
WP_011668217.1\|1432209_1432431_-	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_011668218.1\|1432764_1434024_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	1.8e-17	40.0
WP_011668219.1\|1434084_1434618_+	dihydrofolate reductase	NA	NA	NA	NA
WP_011668220.1\|1434684_1435026_+	YisL family protein	NA	NA	NA	NA
WP_011668221.1\|1435239_1435953_-	amino acid racemase	NA	NA	NA	NA
WP_011668222.1\|1435959_1437216_-	carboxylate--amine ligase	NA	NA	NA	NA
WP_011668223.1\|1437350_1439234_-	asparagine synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
WP_021742205.1\|1439377_1440106_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_011668225.1\|1440214_1441624_+	C69 family dipeptidase	NA	NA	NA	NA
WP_011668226.1\|1441693_1441930_+	hypothetical protein	NA	NA	NA	NA
WP_011668227.1\|1442077_1443880_-	hypothetical protein	NA	NA	NA	NA
WP_139566447.1\|1444302_1445226_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.1e-30	30.1
WP_011668228.1\|1445489_1445741_-	hypothetical protein	NA	NA	NA	NA
WP_139566448.1\|1446476_1448987_-	ATP-binding cassette domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	2.2e-139	32.4
WP_011668231.1\|1449192_1449846_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	7.1e-13	47.6
WP_011668232.1\|1450124_1450418_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_015473929.1\|1450408_1450927_-	VanZ family protein	NA	NA	NA	NA
WP_087612984.1\|1451286_1452210_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.7e-31	31.0
WP_011668234.1\|1452540_1453017_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_107696657.1\|1453068_1453692_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011668236.1\|1454057_1454303_-	hypothetical protein	NA	NA	NA	NA
WP_011668237.1\|1454452_1455415_+	NAD(P)-binding domain-containing protein	A0A1B1IVB5	uncultured_Mediterranean_phage	8.2e-26	29.0
WP_011668238.1\|1455634_1458349_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_011668239.1\|1458361_1459033_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_011668240.1\|1459087_1459858_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011668241.1\|1460011_1460659_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	9.1e-45	45.9
WP_011668242.1\|1460706_1461033_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_011668243.1\|1461106_1462582_-	MFS transporter	NA	NA	NA	NA
WP_011668244.1\|1462787_1463975_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.5e-149	69.4
WP_011668245.1\|1464218_1464926_+	hypothetical protein	NA	NA	NA	NA
WP_011668247.1\|1465422_1465992_-	hypothetical protein	NA	NA	NA	NA
WP_011668248.1\|1466198_1466522_+	heavy metal-binding domain-containing protein	M4STD1	Rhodobacter_phage	1.2e-05	35.6
WP_011668249.1\|1466893_1467463_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011668250.1\|1467700_1468168_+	universal stress protein	NA	NA	NA	NA
WP_011668251.1\|1475228_1477286_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.2e-151	47.0
WP_024855553.1\|1477422_1477659_-	YkuJ family protein	NA	NA	NA	NA
WP_011668253.1\|1477736_1478771_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_011668254.1\|1478775_1479798_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011668255.1\|1479810_1480989_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_139566449.1\|1481173_1482910_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_011668257.1\|1482909_1483176_-	phosphocarrier protein HPr	NA	NA	NA	NA
WP_011668258.1\|1483343_1483544_-	hypothetical protein	NA	NA	NA	NA
WP_011668259.1\|1483843_1486081_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.6e-126	40.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031208

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection