CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040887	Serinicoccus chungangensis strain CCUG 59777 chromosome, complete genome	5 crisprs	csa3,cas3,DinG,DEDDh,WYL,cas4	1	3	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040887_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040887_1

272466-272554

Orphan

Consensus_repeat	Method
GCGCAGCTGACCGTGGAAGTGCGGCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040887_1

>merge|NZ_CP040887|1|272466-272554|CRISPRCasFinder
GCGCAGCTGACCGTGGAAGTGCGGCCCGGGCGACGATTCGCCGGTCGGGCGCGGGTGGCGCGGCGCTGCTGACCGTGGAAGTGCGGCCC

>NZ_CP040887|1|1|272466-272554|CRISPRCasFinder
GCGCAGCTGACCGTGGAAGTGCGGCCC	GGGCGACGATTCGCCGGTCGGGCGCGGGTGGCGCG
GCGCTGCTGACCGTGGAAGTGCGGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040887.1\|WP_139719432.1\|268693_269557_-\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320685
NZ_CP040887.1\|WP_139719450.1\|281401_281950_+\|SigE-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132028
NZ_CP040887.1\|WP_139719446.1\|276812_277562_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139719454.1\|284141_284666_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139722911.1\|262623_263313_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP040887.1\|WP_139719448.1\|277540_281179_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|274576
NZ_CP040887.1\|WP_139722913.1\|282773_284081_-\|phenylacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|131210
NZ_CP040887.1\|WP_139719452.1\|281946_282732_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139719435.1\|270174_271191_-\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|187558
NZ_CP040887.1\|WP_139719438.1\|271943_272435_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|238612
NZ_CP040887.1\|WP_139719431.1\|267155_268619_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP040887.1\|WP_158296677.1\|271250_271664_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP040887.1\|WP_139719444.1\|274738_276334_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|376899
NZ_CP040887.1\|WP_139719440.1\|272589_272883_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377101
NZ_CP040887.1\|WP_139719429.1\|266062_267142_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP040887.1\|WP_139722912.1\|273737_274652_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP040887.1\|WP_139719426.1\|261623_262211_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139719443.1\|273025_273745_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP040887.1\|WP_139719433.1\|269572_269962_-\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP040887.1\|WP_139719427.1\|262274_262613_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040887.1\|WP_139719432.1\|268693_269557_-\|M48-family-metalloprotease	gnl\|CDD\|320685	cd07326, M56_BlaR1_MecR1_like, Peptidase M56-like including those in BlaR1 and MecR1, integral membrane metallopeptidase. This family contains peptidase M56, which includes zinc metalloprotease domain in MecR1 as well as BlaR1. MecR1 is a transmembrane beta-lactam sensor/signal transducer protein that regulates the expression of an altered penicillin-binding protein PBP2a, which resists inactivation by beta-lactam antibiotics, in methicillin-resistant Staphylococcus aureus (MRSA). BlaR1 regulates the inducible expression of a class A beta-lactamase that hydrolytically destroys certain ?-lactam antibiotics in MRSA. Both, MecR1 and BlaR1, are transmembrane proteins that consist of four transmembrane helices, a cytoplasmic zinc protease domain, and the soluble C-terminal extracellular sensor domain, and are highly similar in sequence and function. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. All members contain the zinc metalloprotease motif (HEXXH). Homologs of this peptidase domain are also found in a number of other bacterial genome sequences, most of which are as yet uncharacterized.	9.16795e-22
NZ_CP040887.1\|WP_139719450.1\|281401_281950_+\|SigE-family-RNA-polymerase-sigma-factor	gnl\|CDD\|132028	TIGR02983, putative_RNA_polymerase_ECF-subfamily_sigma_factor, RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.	1.94641e-41
NZ_CP040887.1\|WP_139722911.1\|262623_263313_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	7.6596e-44
NZ_CP040887.1\|WP_139719444.1\|274738_276334_-\|FtsX-like-permease-family-protein	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	0.00176945
NZ_CP040887.1\|WP_139722913.1\|282773_284081_-\|phenylacetate--CoA-ligase	gnl\|CDD\|131210	TIGR02155, Phenylacetate-coenzyme_A_ligase, phenylacetate-CoA ligase. Phenylacetate-CoA ligase (PA-CoA ligase) catalyzes the first step in aromatic catabolism of phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Often located in a conserved gene cluster with enzymes involved in phenylacetic acid activation (paaG/H/I/J), phenylacetate-CoA ligase has been found among the proteobacteria as well as in gram positive prokaryotes. In the B-subclass proteobacterium Azoarcus evansii, phenylacetate-CoA ligase has been shown to be induced under aerobic and anaerobic growth conditions. It remains unclear however, whether this induction is due to the same enzyme or to another isoenzyme restricted to specific anaerobic growth conditions. [Energy metabolism, Other].	0
NZ_CP040887.1\|WP_139719435.1\|270174_271191_-\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP040887.1\|WP_139719448.1\|277540_281179_-\|FtsX-like-permease-family-protein	gnl\|CDD\|274576	TIGR03434, ADOP, Acidobacterial duplicated orphan permease. Members of this protein family are found, so far, only in three species of Acidobacteria, namely Acidobacteria bacterium Ellin345, Acidobacterium capsulatum ATCC 51196, and Solibacter usitatus Ellin6076, where they form large paralogous families. Each protein contains two copies of a domain called the efflux ABC transporter permease protein (pfam02687). However, unlike other members of that family (including LolC, FtsX, and MacB), genes for these proteins are essentially never found fused or adjacent to ABC transporter ATP-binding protein (pfam00005) genes. We name this family ADOP, for Acidobacterial Duplicated Orphan Permease, to reflect the restricted lineage, internal duplication, lack of associated ATP-binding cassette proteins, and permease homology. The function is unknown.	1.11798e-07
NZ_CP040887.1\|WP_139719438.1\|271943_272435_+\|nucleoside-deaminase	gnl\|CDD\|238612	cd01285, nucleoside_deaminase, Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. The functional enzyme is a homodimer. Cytosine deaminase catalyzes the deamination of cytosine to uracil and ammonia and is a member of the pyrimidine salvage pathway. Cytosine deaminase is found in bacteria and fungi but is not present in mammals; for this reason, the enzyme is currently of interest for antimicrobial drug design and gene therapy applications against tumors. Some members of this family are tRNA-specific adenosine deaminases that generate inosine at the first position of their anticodon (position 34) of specific tRNAs; this modification is thought to enlarge the codon recognition capacity during protein synthesis. Other members of the family are guanine deaminases which deaminate guanine to xanthine as part of the utilization of guanine as a nitrogen source.	1.7753e-30
NZ_CP040887.1\|WP_139719443.1\|273025_273745_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.5529e-96
NZ_CP040887.1\|WP_158296677.1\|271250_271664_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	1.96961e-08
NZ_CP040887.1\|WP_139719431.1\|267155_268619_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP040887.1\|WP_139719440.1\|272589_272883_-\|hypothetical-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.00294976
NZ_CP040887.1\|WP_139719429.1\|266062_267142_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	6.94205e-104
NZ_CP040887.1\|WP_139722912.1\|273737_274652_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	2.22503e-93
NZ_CP040887.1\|WP_139719433.1\|269572_269962_-\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	1.96665e-27

>NZ_CP040887.1|WP_139719438.1|271943_272435_+|nucleoside-deaminase
MTDPTSISEDDRAHLSRAVALAEAALDAGDEPFGSLLVSADGDVLLEDHNHVSGGDHTQHPELAIARWAAQHLSPQERAASTVYTSGEHCPMCAAAHGWVGLGRIVYASSTEQLSAWSAELGVPPGAVAPLPITALVPGAVVAGPDPELAERVRALHARKAAS
>NZ_CP040887.1|WP_158296677.1|271250_271664_-|RDD-family-protein
MAATTIDAGLVFGLLMALALMSAVVDPLEDLAGAVWVGAVGYLGWLNGSTGQSPGKAVLGLKVLRDADGTCLGGVVGVLRTAVLGFLSIMTVFVFLVVNSLWPLRDRQHRAVHDLMFGAVVVSGYPKARPSLRLLRP
>NZ_CP040887.1|WP_139719435.1|270174_271191_-|UDP-glucose-4-epimerase-GalE
MRVLVTGGAGYIGSHTVIALARAGHEVVVVDDFSNSKPSVTPRLEELSGIPVPVHAFDLADGDKLDSLLSQERFDAVIHFAAFKAVGESVEKPIDYYRNNIGATLRLVEAMVAHDVPHLVFSSSATVYGEDAPVPMTEGLPTSATNPYGWTKVMNEQILRDVTHAYPQLKVALLRYFNPVGAHPSGRIGEDPSDIPNNLMPFVAQVAVGRRDRLSVFGDDYDTVDGTGVRDYIHVEDLAEGHVAALEWISSHDRPLSVWNLGTGRGTSVLELVSAFERASGQQIPYEIVARRPGDIASSYADPSLAEAELGWRATRSVEDMCADTWRWQQANPQGYPD
>NZ_CP040887.1|WP_139719433.1|269572_269962_-|BlaI/MecI/CopY-family-transcriptional-regulator
MPLRSTSLGDLERAVMDILWSEGPGLSVRDVLDHLERREHHKELAYTTIMTVLDRLAKKGVAERTREGRAWQYSAAASREELAAGALRSALEAVQADRTAAMLHFLDDASPGELDDLRAALVEVERRRA
>NZ_CP040887.1|WP_139719432.1|268693_269557_-|M48-family-metalloprotease
MGGPLLTAAVVLTALVLVLLAPRVLPGWTALRGMPGPGLLLWQSVSVAGVLCALLAAPTAVLTTGLSQPLLLGLALLLSGGMLVRLLASGHRVGTDLRRRRTRHRELVDLVGEQLDDALARGTAGITRPDVTVLAEGNPSAYCLPGRGHRIVLTRSALDRLGATELRAVLAHEQGHLDARHDLLLELFTVLHEAVPRSLRVPAALTEVQLLTEALADRIAEQRTGHADLARALVAMAAAATPEVTARVRLLSRPPAPRHTRLGVTALAVAVLAIPVAVTVTLLTLGG
>NZ_CP040887.1|WP_139719431.1|267155_268619_-|cytochrome-ubiquinol-oxidase-subunit-I
MDALDLARWQFGITTVYHYFFVPITIGLSLLVAIMQTQWMRTRNPQWLRLTKFFGKLFTINFALGLVTGIVQEFQFGMNWSDYSRFVGDIFGAPLAIEALLAFFLESTFLGLWIFGWGRIPEKLHAAAIWLVHVGTLLSAYFILAANSFMQNPVGYRLNPETGRAELTDFLAVLTNPVQLVTFPHVIAAAYMTGGGFVLAFALWHLWRDATPGTDKPMYRKAAKLGAVTVLVASLGVIVSGDLQGKVMTEVQPMKMAAAEALYEDVPEGEGAPFSIVTVGTLDGTEEVWALTVPKLLSYLATGTLDGAVEGIDHIQERYELTYAGSELTAVEDYRPVIPVTYWTFRLMMGLGFAAMAIAAAVLWVLRGRGSETDEQRLGHRAWGWAGLLVLLLPLLANTFGWMFTEMGRQPWLVMGLMTTQTGVSPGTTAAEVLTSMTVFTLLYGVLAVVEVGLLLRYGRAGAEQVPEDASYDPRNRDDDDAFVFTY
>NZ_CP040887.1|WP_139719429.1|266062_267142_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MELTTIWFILIAVLWVGYFCLEGFDYGVGMLLPVLGRDETRGEAPHTGETRKRQMLSAIGPFWDGNEVWLLTAGGAIFAAFPHWYATLFSGFYLPLLLILVGLILRGVGLEYRGKVDSPAWRARMDAMVVAGSFVPALLWGVAFTNIVLGVPIDADMEYVGGFWNLLGPVALLGGLTTLALFLTHGALFVALKTDGQLRHDARALALRLGAASAVLAVVWLAVVHLRTGTTASWLVAGVAAAGLVGGLLAAARGREGWAFTGTFVAIGLATTSLFLALFPDVMPSSLDPAWSLTAQNASSTPKTLGIMTVVALVFTPVMLLYTAWSYWTFRKRVSGHHIPTEVHHAAVVDTDAQTRAGR
>NZ_CP040887.1|WP_139722911.1|262623_263313_-|ATP-binding-cassette-domain-containing-protein
MVRAAGRATQSPDLPALDLEVRPGDRLRLVGPNGAGKSTALAVLARHLDPEQGHYVVSGSDEDDDPGAAQDVRGLDLDQTRALLAVVDDEPHAFAGSVRANLVLASPGATDAEVIDALEAVDLGGWCATLPDGLDTALTGLSGGERSRLALARALLSRRPVVLLDEPTAHLDDATAQRCLGGLLDRMDSGKAVVLVSHGPPVTGHWAERRVDHAGEAAADDRAVPLHIG
>NZ_CP040887.1|WP_139719427.1|262274_262613_-|hypothetical-protein
MDTSTIVWIVVIALVVVAALIVWAMVARNKRLAAARQEAAGLREKAQSGESYAQSAEERAKELQGKAREAQLHADKLHREAEEATRIAREHRDRVTGDYVNADEIDPDAKKR
>NZ_CP040887.1|WP_139719426.1|261623_262211_+|hypothetical-protein
MTGSRATADDDLGADGDLAARIGHLILEEGPDDPHAALEGPDHLRLVRRAALAHEASSALLQQSVTAARAHGVSWAVLGQELGLSRQGAQQRFGTRAEDAVPGTGEERADERWLGPVTAFDELGELDLAGELGWHTVEAGMFRHRMVRTATRWEHRRVLWARTTSSYLTDGWQVGARAFPWLYLVRDTGLPVEGR
>NZ_CP040887.1|WP_139719440.1|272589_272883_-|hypothetical-protein
MPEEEHPSDQPQGESLLGPRPGGSSTRTPPSRLLLVGCAALAVVVLVVGFLTGWSISAIGLAVVASVGLVLLAVLIRRPPPTRLETREKNRTRRDRW
>NZ_CP040887.1|WP_139719443.1|273025_273745_-|ATP-binding-cassette-domain-containing-protein
MSEPTAYRADEAVGARRPVLRAVGLHRTFGSGATQVHAVAGVDLEVGAGRLTVVRGPSGSGKTTLLNLLGGLDRPDDGQVLLDDGRVLSALPEKEVLAVRRERIGYVFQSFGLVPVLSAAENVEVPLRLQRTAVGERARRVEEALELVGLARHSRQRPYELSGGQQQRVGIARALVGEPDILVADEPTGQLDSDTGAMVMDLLVRLTHERGIASVVSTHDPVLMERADQVVELHDGRRV
>NZ_CP040887.1|WP_139722912.1|273737_274652_-|ATP-binding-cassette-domain-containing-protein
MREHQGPDIWCEDLVRIYSTEGVEVQALQGLNLVVDPGDVVALVGASGSGKSTLLGILSGLDRPTGGRARVAGVDLLTMGRAQRVDYQRHTVGFVWQQTSRNLLPFLSAAENVALPMVISGRRERARRVEELLDLLGLADCAERRPTELSGGQQQRVAIATALANSPAVLLADEPTGELDDAASAQVLEVMREAAGSLGTTVLVVTHDPTVSDHVRRTVAIRDGRTSTEVLRYVVTDESGEQRQVAREYTVIDRAGRIQLPKAHVEGLGLRDRVRLEHESTHVQVWPDDEEHRAHGRQAGGRDE
>NZ_CP040887.1|WP_139719444.1|274738_276334_-|FtsX-like-permease-family-protein
MIAAEGLLLGVPAAALGHLGAMLLVPGPTPWWQWAVSGAVALVPSLALAASVDDASLLTRRQDLGGRSRSRWRWVVEVAVVALAGVATWRLLGRGARGDDAAATGIDLLAAATPVLLALAACVLTLRLYPLPLAALTRVLRGRPTLTPFLGAARALRDPAGGLVPTLAVVLGTAVALISAVLLSTVSQGAQVAAWQDNGAPVRLNGPVLTDELRASLEDIPGVGAVGGVADSGATQDLVVDGERTAVRVWVAEPQVEQVYAASPLIEGPPPAFWSEDGTPGVVTLRSADEAAPGSAGEVAVSGLGQVEVLGHLDEVPGVLVTGAGVLVDGDRWVAAGETLPRVSTTLIGLEEGADPEVVAQAVTDLVGSGGVVTTVSTRLDTFTEAPVTVGLRQLFVGATLVSALLTVLAVVVVQLMGSVARTRLLATLRTLGLAPGQTRALTAWELAPLLATSLVVGSVLGLAVPWVLLRGLDLTGLTGGTAQPALHLDPPLLAAVLGAVVLTVLTAVTTSAWLPGRTNLAQALRVGEDR
>NZ_CP040887.1|WP_139719446.1|276812_277562_+|hypothetical-protein
MLPPRVVRVTRDVGAADDEVGLRHRVAHLQAQLLRGLLEDHDRHLRGVLGLGLLRPFLPRSVRRPADAHQGRGPDDQLGPVTLHELDVLAQVGIDGEAEGRGVVAGLDVRGELDLRLQPGQELRRAQDVAQRLGLLTADPLRALDEGRPAIDPGRTVVIGRRAEQHRPLPVAAQVALRRGQSPDLLLELAALHVDETARRRREQQRDQADEGGQTEGHPRVGGELATGQPGRARSPGYAVPRAHRISSR
>NZ_CP040887.1|WP_139719448.1|277540_281179_-|FtsX-like-permease-family-protein
MTWASFARARARSSRGLLLTLLALVTVTTAIIAGTVGYSAAAASTAARGALTEGEPTQTGVQVQTRLAEDPRRQDARARSTITEAFAPAPVSIGRLVVTEPRPARVAGAEVEVEGELVLVGGPELAPGEAPGDLVTVLEGTWPTGDEGAGEDAPAPGALHVGAARALGLSVGDTLVVGERTVEVTALWQPVDPADAFWFGDELVRTGVGEEKATLGPLVVEEALAQQVGAPFVRWPVRPDADRITPEDLGVLAAGAASLRSDLRDAPGVAVRGVQVEGDLAPTAGQASTNLATARALGVVPLSVLVLVTGLAVTQLARLLAATREPQAQLLVARGASRRQVLLTGLVESVLVAALGAVLGTLLAWAAVRAVPGGEGLLGRLVVTALLTLAGITLTLGLVAALQARRLSGGAAVADRSGRVRAATTLAAVVLVLGAAALSWWQLRRAGSPVTRAEDGALGTDLVAAAAPALLLAAAAVLATALLGPLTRAVELLTRPTRTTAAHLSSAQVSRRLPVYAVPVVLTVLAVGSTTLAALYAGTSAQLRDDLAAVREGAPLRADLVRPPATVEPGVVPAPPPDLAALPEVDAAALVWSDPDARVGEVDVPLTLAPTGTDGGGLGAVANVPEGIPGGLVPAGLDRAVGADGEPLADSAVTVPEDVDAIDVELVVERGTDAWELARLEQLPDAQESLVEGLEAVGWDPAQTEAAGGSFIYALDDSPAAIQRSLDSEVVAAAVPVELRVTLLVEDVATGLTSSVTSEAVRAEGPQLSYDRQALGDWSSTSERTTADLRFALPEGREHRVRSVTVSTPGTADDVPPDLFSGYSSTTLDLDLSLTAGGEDLLSGTDGWGSSSAASRDQAAPLLEEAAAVEDPSFQTAIEVVERSRGTGLPFIDPEVTTDEVDVPPWVDTTTPTWHLQVPDLRQEPIEVAVAPDVTYRGDAVLGQDPGTGATGEEAPAATVPVALTRQTAAAAALTVGDPVTLRLVGTTVPAEVAQVVAALPGQQGETAALADSRVASRVLAEQQRSLTWPDEVWATPSAGAQAAVEALTARADLRAVTGPGTVSVTDATSAARLVFWVASAGAVLLALTGVAAVAATLLTARRPEVAVLRALGMPPAAQARSRALELAGVVLVAAVFGLAAGWLVGGAVVPELASSTTAPGRLRLPAALRLEALPWAVLLAVTLTTAGLLVALVARRVRAQALDRGYREEIR
>NZ_CP040887.1|WP_139719450.1|281401_281950_+|SigE-family-RNA-polymerase-sigma-factor
MPGRAGDDYVAFVTARQGALLRAAYLVCGDEHLAHDLLQDALVKLASRWERLRDEAPEAYVRQILYRDAVSRWRRTRRERLVDHQDPGGDLARFRTREPVEGWVEGAAVRQALMLLPPRQRAVVVLRYYEDLSEADIATTLGISRGTVKSQASDAMRTLRSLLPDLDGWVPRVVRDEERGSA
>NZ_CP040887.1|WP_139719452.1|281946_282732_+|hypothetical-protein
MRSQDLPRLLHLAGDEVLEPDLARSTWERGRRSRRRRLALRGTGALGVVALAVSALSLSWSEPAPLTAGPAAGEDVGPTDAEAIELPLTAAATLPGEQARSVWRELYSACLTDLGYEVSVVPGDGDGGGGLAATRQGVQAGERDRDLQRCRAQLVLDSPVTAAPAEEVRETPPQEGRAQPADPLGPGLDRSSRLQLTARYQEYLVADSCLRDAGLPTSDPPPAEDFIQALVRDQLPPWHPHLEAAEQGRYKQARTACPLSR
>NZ_CP040887.1|WP_139722913.1|282773_284081_-|phenylacetate--CoA-ligase
MPEIEPRPDLHDEAETWSVDQLRSTQLQRLQDGVRRAYEGVGHYRRRLDERGVHPDDIRTLDDIRLLPFTTKADLRENYPFGMFAVPREQCVRVHASSGTTGRPTVVGYTRGDIDTWAGLVARSLRAAGTRPGDLVHVAYGYGLFTGGLGAHYGAERLGCTVVPMSGGQTEKQLQLIEDFGPRVIMVTPSYFLALVDAMTERGTDPADTSLQIGVFGAEPWTEAMRAEIEQRCGMHATDIFGLSEMMGPGVAQECVETKDGLTLWEDHFYPEVVDPLTDEPVPDGEEGELVLTAMTREAMPVLRYRTRDLTRLLPGTARPGMRRLAKITGRSDDLMIVRGVNVFPTQIEELVLALPGLTPHFQCVLSRPGRMDQLTINVEGEPGLGADARDRLAGELARQVKDRIGTTAQVVVLAEGGVERSVGKARRIVDQREG
>NZ_CP040887.1|WP_139719454.1|284141_284666_-|hypothetical-protein
MTATAPLGRPQREALRRRLLSLGLGELSAATVFVLLAVSVVGPRWTDDQAATLWWALGPLTVVLVQAGAYWLLARSWVGRGTMRRPVARTYRVVRVLDPVLLALGLVMILVHGGPDPGPWLLTLGVWAFAALEYANYFLVRLSYPPTTWAREVTSWRTPRLVRDLRATDRAGGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040887_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040887_2

2200137-2200238

Orphan

Consensus_repeat	Method
CGTGTGCAGTCGTGGCCCCAGGAGGGCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040887_2

>merge|NZ_CP040887|2|2200137-2200238|CRISPRCasFinder
CGTGTGCAGTCGTGGCCCCAGGAGGGCCATCGGCGCGCACAGAGCAGGCCACGCGGGCGACACCGCCGCCCAGCGTGTGCAGTCGTGGCCCCTGGAGGGCCA

>NZ_CP040887|2|2|2200137-2200238|CRISPRCasFinder
CGTGTGCAGTCGTGGCCCCAGGAGGGCCA	TCGGCGCGCACAGAGCAGGCCACGCGGGCGACACCGCCGCCCAG
CGTGTGCAGTCGTGGCCCCTGGAGGGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040887.1\|WP_139721930.1\|2190766_2191690_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|225088
NZ_CP040887.1\|WP_158296749.1\|2205836_2209637_+\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|274860
NZ_CP040887.1\|WP_139723089.1\|2203528_2204395_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP040887.1\|WP_139721929.1\|2189026_2190751_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|366703
NZ_CP040887.1\|WP_139721939.1\|2201985_2202372_-\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296
NZ_CP040887.1\|WP_139721940.1\|2202373_2202577_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139723088.1\|2201551_2201962_-\|pilus-assembly-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_158296748.1\|2188070_2188505_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139721942.1\|2204394_2205627_-\|Flp-pilus-assembly-complex-ATPase-component-TadA	unknown	unknown	gnl\|CDD\|227297
NZ_CP040887.1\|WP_139721931.1\|2191686_2192382_-\|cell-division-ATP-binding-protein-FtsE	unknown	unknown	gnl\|CDD\|225438
NZ_CP040887.1\|WP_139721936.1\|2198378_2199887_-\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
NZ_CP040887.1\|WP_139721934.1\|2196307_2196865_-\|DUF664-domain-containing-protein	unknown	unknown	gnl\|CDD\|368218
NZ_CP040887.1\|WP_139721941.1\|2202602_2203532_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP040887.1\|WP_139721944.1\|2209643_2209880_-\|DUF1059-domain-containing-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139721937.1\|2200261_2200921_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319829
NZ_CP040887.1\|WP_139721932.1\|2192644_2195062_+\|ExeM/NucH-family-extracellular-endonuclease	unknown	unknown	gnl\|CDD\|225249
NZ_CP040887.1\|WP_139721928.1\|2188488_2188965_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NZ_CP040887.1\|WP_139721935.1\|2196936_2198262_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP040887.1\|WP_139721933.1\|2195139_2196252_-\|peptide-chain-release-factor-2	unknown	unknown	gnl\|CDD\|234799
NZ_CP040887.1\|WP_139721938.1\|2201027_2201450_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040887.1\|WP_139721930.1\|2190766_2191690_-\|FtsX-like-permease-family-protein	gnl\|CDD\|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	3.30271e-47
NZ_CP040887.1\|WP_139723089.1\|2203528_2204395_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	1.94133e-11
NZ_CP040887.1\|WP_139721929.1\|2189026_2190751_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	5.99743e-42
NZ_CP040887.1\|WP_139721937.1\|2200261_2200921_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319829	cd07527, HAD_ScGPP-like, subfamily of beta-phosphoglucomutase-like family, similar to Saccharomyces cerevisiae DL-glycerol-3-phosphate phosphatase (GPP1p/ Rhr2p and GPP2p/HOR2p) and 2-deoxyglucose-6-phosphate phosphatase (DOG1p and DOG2p). This subfamily includes Saccharomyces cerevisiae DL-glycerol-3-phosphate phosphatase (GPP1p/ Rhr2p and GPP2p/HOR2p) and 2-deoxyglucose-6-phosphate phosphatase (DOG1p and DOG2p). GPP1p and GPP2p are involved in glycerol biosynthesis, GPP1 is induced in response to both anaerobic and hyperosmotic stress, GPP2 is induced in response to hyperosmotic or oxidative stress, and during diauxic shift; overexpression of DOG1 or DOG2 confers 2-deoxyglucose resistance. These belong to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), and Escherichia coli 6-phosphogluconate phosphatase YieH. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	7.17489e-53
NZ_CP040887.1\|WP_139721942.1\|2204394_2205627_-\|Flp-pilus-assembly-complex-ATPase-component-TadA	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	1.53742e-89
NZ_CP040887.1\|WP_139721931.1\|2191686_2192382_-\|cell-division-ATP-binding-protein-FtsE	gnl\|CDD\|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	9.20527e-111
NZ_CP040887.1\|WP_139721936.1\|2198378_2199887_-\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	9.46019e-15
NZ_CP040887.1\|WP_139721934.1\|2196307_2196865_-\|DUF664-domain-containing-protein	gnl\|CDD\|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	9.72323e-34
NZ_CP040887.1\|WP_139721941.1\|2202602_2203532_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	4.26355e-11
NZ_CP040887.1\|WP_139721939.1\|2201985_2202372_-\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	0.000381047
NZ_CP040887.1\|WP_139721932.1\|2192644_2195062_+\|ExeM/NucH-family-extracellular-endonuclease	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	1.3498e-147
NZ_CP040887.1\|WP_139721928.1\|2188488_2188965_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	2.08508e-85
NZ_CP040887.1\|WP_139721935.1\|2196936_2198262_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.96277e-165
NZ_CP040887.1\|WP_139721933.1\|2195139_2196252_-\|peptide-chain-release-factor-2	gnl\|CDD\|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0
NZ_CP040887.1\|WP_158296749.1\|2205836_2209637_+\|FHA-domain-containing-protein	gnl\|CDD\|274860	TIGR03928, T7_EssCb_Firm, type VII secretion protein EssC, C-terminal domain. This model describes the C-terminal domain, or longer subunit, of the Firmicutes type VII secretion protein EssC. This protein (homologous to EccC in Actinobacteria) and the WXG100 target proteins are the only homologous parts of type VII secretion between Firmicutes and Actinobacteria. [Protein fate, Protein and peptide secretion and trafficking].	1.0006e-67

>NZ_CP040887.1|WP_139721936.1|2198378_2199887_-|nitronate-monooxygenase
MAALPATPIDLPTQTDRPRPTIIQGGMGVAVSGWRLARQVARAGHLGVVSGTAMDAVISRVLQDGDPGGHYRRAMAAFPSQAMAQRVLDKYFIEGGKEPGASYKPIPKLTLETARAGQELGVVGNFAEVWLAKEGLSEHSTEGAVGINCLEKIQMANPTAILGAMLAGVDYVLMGAGIPREIPQLLRSLAAGEPGSISADVAGGSLRRHVTVDPADLLGEDLPSVSKPDFLAIISVDQLANYLNRDPEIRPDGFVVERPPAGGHSAPPRGKMQLDDAGEPVYGARDEADLAKMTQIGLPFWMAGAYSTPDKVAEALAAGAVGVQVGTLFALSHDSGLADTPREQLLGRLRTGELAVRNDPRASPTGFPFKVATLEGTASQVEVYEARPRLCDLSYLRQPYEREDGEVGYRCASEPVHMYLKKGGEEADTVGRKCLCNGLMANIGLGQERKDGYAEDTLVTLGQDLAGATALIERHPEGWSALEALDYLQEQVAAGLRLRHTA
>NZ_CP040887.1|WP_139721935.1|2196936_2198262_-|MFS-transporter
MTGVSSRQTERSREERKVLAGTLVGTTIEWYDFFIYAQAAALVLGQLFFAPMGEGGAQLAAWASLGISFLVRPLGAVVAGHLGDRFGRKVVLVFTLVGMGGATAIIGLLPTYAQIGVAAPVLLILMRLLQGFSAGGEWGGAALMSVEHAPRGRRGLFGAYPQIGVPIGMILATLFMFGLSTFMTDEQFLTWGWRIPFLFSILLIGVGYWIRRAVEESPVFAEMARLRQKESAPLGELFRHHRKNVLLAALIFAANNAAGYLVIAYFNGYGVNALGMERTETLVASLIGGVGWLVFTLYGGHISDRIGRVLTFQIGYGIIILWAIPMWFLLDTASLPLFTLAILVLTLGLGPSYGPQSALYAEMFPARVRYSGVSIGYALGSIVGGAFAPLIAELLLQRTGQSWSIGVYIAVLAIISFAAVSMVPKSLQDSDLHLQEEPARH
>NZ_CP040887.1|WP_139721934.1|2196307_2196865_-|DUF664-domain-containing-protein
MSEITIDDVGRPEPPLAAGEAATLAGFLDYQRATLEWKTRDLAADGLRLRLPGHPSGMTLGGLLKHLAWVEDHWFTQVVSRAAMPDPWDTVDWSADEDWEWSSAAEDDPDALRQVWARSVERSRAVLAEALAVEGADPLGATHPAWGGQAEVSVRWVLAHMVEEYARHNGHADVLRELADGQTGE
>NZ_CP040887.1|WP_139721933.1|2195139_2196252_-|peptide-chain-release-factor-2
MAVDFETEIKQLRTTMASVREVTDLERLGAQIADLEAEASAPDLWDDVERAQKLTSKLSRAKAEHDKITGMDARIDDLEALVELGREENDAETMQEAEKELAGLRKAVQLLEVRTLLNGEYDIREAVVTIRSGAGGVDAADFAEMLLRMYLRWAERHDYPTAVLDTSYAEEAGLKSATFEVKVPYAFGTLAVEAGTHRLVRISPFDNQGRRQTSFAAVEVVPLIESTDTIEIPEADLKIDVFRSSGPGGQSVNTTDSAVRMTHLPTGTVVSMQNEKSQIQNRAAALRVLQSRLLLLKKAEEDAARKEMAGDVKASWGDQMRSYVLHPYQMVKDLRTGHEVGSTAAVLDGDIDDFIDAGIRWKRSADRQDA
>NZ_CP040887.1|WP_139721932.1|2192644_2195062_+|ExeM/NucH-family-extracellular-endonuclease
MQNVPRRAVAAASTAALAVTGLVALSPAVQAAGPGLVVNEVYGGGGNSGAVYTHDFVELVNSTDAPVDLDGYAVSYYSSSGNLGKACPLSGTVEPGASYLIQQNPGSGGTTPLPDPDIECGASMSGSNGIVELSLDGEVVDLVGYGSATRFEGSGAAPGLSNTTSASRSDAVDTDDNAADFTRGEPTPTGSGGGTDPEPEPDPEPVDATIAQIQGTGATSPLEGQPVNTSGVVTAAYPTGGFNGVYLQTAGSGGAAKAPGDASDGVFLYSSWAADNLEIGDCVEVEDGEVVEYNGLTEISGGFVTVVDSCEAVVPTVLSSLPATDAEKEVYEGMLVQPEGTYTITNNYQLNQYGQLGLAVGDEPLYQATDQVLPGPEAEAYEAANQEKYITLDDGSSWDYIRNSTAQDSPLPYLSAEEPHRTGSQVTFEQPVVLDYRFQWNYQPVGQVVGSDSPVDPISSENDREYAAPEVGGNIQIGAFNVLNYFSDLGQDEEGCDFFADRFGNPVATDFCEVRGAWSEQAFADQQAKLVTAINGTDAEVLALMEIENSAALSYVDHPRDKALADLVAALNAEAGEQRWAYAPSPTVTPPNEDVIRTAFIYDPDQVQLLGPSMIQLDDAFANARYPLAQKFKATGTGKPFVAVANHFKSKGSGEDDGTGQGNANPSRIAQAEALTAWSEEMFEDEAIFLMGDFNAYSREDPVRIIEDAGYTNLARADEPDSMTYQFSGRLGSLDHVFANEKAQRLVTGAGVWDINADESIAFQYSRRNYNVVDFHSDDQFASSDHDPVLVGLDTGNRGKGKGKN
>NZ_CP040887.1|WP_139721931.1|2191686_2192382_-|cell-division-ATP-binding-protein-FtsE
MITMERVSLRYAKADPWALDEVDLDVRRGEFCFVVGESGSGKSSLLRLVILEQRPSRGRVLVAGHDLGELAPRRVHLLRRQIGTVFQDFRLLSGKTVHQNVAYVLQVLGASRHEIRQRVPETLDLVGLQGKGRRLPHELSGGEQQRVAIARAMVNKPPILLADEPTGNLDPDTSEEIVAILDRINRAGTTVLMATHDTTIVDHFRKRVVQLQDGQVVRDQAEGGYRQVALP
>NZ_CP040887.1|WP_139721930.1|2190766_2191690_-|FtsX-like-permease-family-protein
MRPGFLLGEVGNGLRRNFSMFVSVVLVTMVSLFFLGVGLLAQAQVSTAKGEWYDRVQVSIFLCTPDSTDAPGCTAGAVTPEQRDQIESDLQGLEPLVTEYFYESNAEAYERFTEQFRNSSALESVPQESIPASFRVNLSDPSQYDVIRAAFEQAPGVDSVEDQREVVDRLFAFLGALSWGALALAVAMVVCAVLLISTTIRLTAWTRRKETAIQRMVGASAFSIRLPFILETVVAALLGAALAVALLWATVRFGISGFLSELLAGESGLVSLVGERDLWLITPFLVGGAVLLAVVTAWTALRRHVRV
>NZ_CP040887.1|WP_139721929.1|2189026_2190751_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MVRTPRPGPGRDGATPARRVAAYRPRVRRALALALVGAIGVATPALASGELDDIRDRLSSVEDERQRASADRESSAEQVHELGEELEHTSAELVAADQRLQEITAQVDEARIVLEEAELDLADAEAETARIEGELALARENEAQIEDSLEQVADDRADTSATVGAIARQSYKQGGMGSLATTLDLLSGEADAVDQMSMARTVLRVQDQQIRQLATQEAEQVAEQDRLAGVRSDIAYLLAKAEANVVAKEQARATADAAKAALEQREAEQEQAKADLETEKAKVEESLAAEQERSEALEDELAELARTKDGLEQQEQAELERIEEARRKAEEEARRKAEEEARRQAAAEAAAKRAAEEEAARQRAAEREAQRQREAEAEAQRLRDEAAAAEAARRAEAAEAEAAAAAQAAQEAAAREAAERQAAEERASRQAEEERQAAAAASSGILSAPSAGPITSEFGNRFHPVFQTWRLHAGIDFGPGCGTPVTAAADGVVYSSGFDAGGGNMVIIDHGVLRGVNLTTSYLHMQSAAVVSAGQAVSRGQLLGYVGSTGASTGCHLHFETRENGTPVNPRTWL
>NZ_CP040887.1|WP_139721928.1|2188488_2188965_-|SsrA-binding-protein-SmpB
MPKETGRKLIASNKKARHEYLIEDTVEAGLVLTGTEVKSLRMGRASLVDGYATQYQGELWLEGVHIPEYTQGTWTNHAARRRRKLLLHREQIDKLVAKAEQAGHTIVPLSLYFVDGRAKVEIALAKGKKLHDKRQTLRERQDRREAERAMSAHLKKHG
>NZ_CP040887.1|WP_158296748.1|2188070_2188505_+|hypothetical-protein
MSFPGAPVDEGHRQALRPLAVVVAAMAGGLVMLAVVLVLVGARLETPDTWQLVVVGLATLGSWGLALAAPLPRPSGPPTPAQVQTSVVLRAAILEAPAMIGLVLAFVSQPLNLLVYLLPALFSLGGLWLFARPSVVARRLSRAS
>NZ_CP040887.1|WP_139721937.1|2200261_2200921_-|HAD-IA-family-hydrolase
MRDITQETFDAVLFDNDGTLTDSSGPVERSWRSWAADHGVDFARFGNFHGVTSRGIVERVAPHLDADAATADIDRRELEDLDGIVALPGAVDALAAVGSRAAIVTSAGRELAVLRIDAAGLSAPAVVVTADDITRGKPDPEPYLIGARHLDADPARCLVVEDAVAGLESGRAAGAATLAVLTTHTREELEGQADLAVDSLADVRLEVTDAGVRVHLRGR
>NZ_CP040887.1|WP_139721938.1|2201027_2201450_-|hypothetical-protein
MSILLIGMVAITLTIIMAVVGVTSVQLSRIQLLDAADAAALDASDALAEAQVYEGGIGSGPPLSDATVVEAASAHLERRVMPTRVVSWAVGSGTGTPDGRTAVVTVTGQAEVPVVTAVLRAVGGGVSITVTSTARSDIDP
>NZ_CP040887.1|WP_139723088.1|2201551_2201962_-|pilus-assembly-protein
MTVEVAFLLVLLVVPLFYLVGTVGRIQAGAYAVTAAAREAGRAFVTAEDAAEASARAQVAAGLVYRAHGFEPRAGTVQLSCGQSGCLTPGGSVRADSQVSVELPLVPDFMRDRLPTTVTLTASHLETVDEFRAGTP
>NZ_CP040887.1|WP_139721939.1|2201985_2202372_-|pilus-assembly-protein
MSGGSAERGAAAAEFAMLAGLVSVLMLAVVQLAFGLHLHNTATAHVVEGARAGARADASPADGARRAQELLSSSLTGGGPGVTVSARRTVVDGVAVVEVSATMPLPIFGPLGPGESMTVVGHAYAEDQ
>NZ_CP040887.1|WP_139721940.1|2202373_2202577_-|hypothetical-protein
MIRRFVTASAVLSQRVRRWREEPERGDVPGWVLITIMTAGLVAALWLVAEPLLTGLFTNAVSAVTGP
>NZ_CP040887.1|WP_139721941.1|2202602_2203532_-|type-II-secretion-system-F-family-protein
MTGAWWGALLGLVLACGLLLAWAGLPVARRVRLADRIEPYLDRPPRQSRLLVLDDSRPWRAGELLAPVAARAARLLDRVLGGEESVRTRLHRSGRTADVEAFRVQQVVWGVLCAAVAVLLGVLLWFTRGTSPGVVLLLVGCAFLAGVMLRDHLLSRAAARRERQIMAEFPAVAELLALSVTAGEGTAQALERVARLSRGELAAELDLCLAQARTGASLPEALHGLSRRTGIGPIIRFVDGLVVALQRGTPLGEVLRAQAADAREAARQELIEEGGKREISMMVPVVFLILPVTVLFAVFPGVTMLRLAM
>NZ_CP040887.1|WP_139723089.1|2203528_2204395_-|type-II-secretion-system-F-family-protein
MQGAGWGLLLGLGLASIWWSFWPRTVRVGRRPGARRLERLQDQIVLAGVRGLGARTLLVLCVTAGLLVLLLMFAVTRVWTVSVCFAVMASWLPVAVVAARARRRRTRLRTVWPDAVDHVQSAVRAGLALPEALVQLAERGPEELRPAFEEFAHDYRATGRFSESLDLLKDRMADPVADRLVEALRIARDVGGTDLGRVLRTLSSFLRDDARARAELEARQSWTVNAARLAMAAPWAVLLLLATRGSTLQAYGTPAGAVVLAVGAGLTLVAYRVMVAIGRLPEETRVLR
>NZ_CP040887.1|WP_139721942.1|2204394_2205627_-|Flp-pilus-assembly-complex-ATPase-component-TadA
MSATALQLLEDDVRELIRRRRLDPSRDDEAVRDLIGEVLDDYDDRSLVGGLVPLADRKEAHRALLESVAGFGPLQPYLDDPSVEEIWVNEPTKVFVARNGRSELTPTLLTEQQVHDLVERMLRSSGRRVDLSSPFVDASLPDGSRLHVAIPDITRRHWAVNIRKFVVAADELSDLVRLGTLTEQAARFLEAAVAAGLNVLVAGGTQAGKTTMLNCLTAAIPAGERVVTCEEVFELKVNLRDVAALQCRQPSLEGTGEIPLRRLVKEALRMRPGRIIVGEVRQEESLDLLIALNSGLPGMCTIHANSAREAVTKMCTLPLLAGSNVSSSFVVPTVASSVDIVVHLALEVQGARQVREIVALPGRTEGEIVEIADLFVRSGADLVRADGFPPHVDRFARAGFDLATLLGSRP
>NZ_CP040887.1|WP_158296749.1|2205836_2209637_+|FHA-domain-containing-protein
MRVIVTRVVAGQVRFLAVQAPDDATVDQLVLRLGAGRAGQPETEHPRDRSGPVAPIPLVHGTELDGPSWPDPEQAPSGLPRLVVATGPDAGGSVPLPPGRWVTLGRDPRCDLTIADPGLSRRHVRVRQDRDGVRVEDLGSTNGMTWEGGQEGGQEGGQDGGQEDRESLWPPGGRLLVGGSGVVLVPRPPAPIRQAVSGGRREVEPWPRPTTAVQPREFSTPAAPDRRPVRAPSVWTWTLPLVVALAVAVVLRMPWLLLFGLLGPAMMLGHHLGDRRAARLEHEEGLAAREALGAAHRAQAEGCLRQELELLRRQHPGLVGVVTSLVPYPSLGLWQRAAEPLSVTLGEHPCDSTVRLEGRALRHEAAPLPLALDGPLVLAGDRVTRDGLARALLLQLATAYPPGTWTLVVDPDRPPGPAWDLLAWLPHTRTSGERVDGTPVVWGRDLVLVDDLSQAPAGATRVHVLDPTHGVLQLPGRPDLPFRPTTLGLARARSLALTLAPLRGRQAVDADDGTPVLPGESPPLGAVLPWPTTPDEAAAGWSRPGTDVPIGTDAAGSVVGLDLVRDGPHALVAGTTGAGKSELLRTLVTGLALRSSPADLALLLVDFKGGSSLGDCARLPHVTGLVTDLDPHLAARVLTSLQAELTRREARLAEAGVKDARDLPGLPRLVVVVDEFRVLAEEVPEVMSGLVRLAAVGRSLGVHLVLATQRPAGVVGADLRANVNLRIALRVRDSTDSQDVIETPAAALLPEGRPGLALWRTGADAPRAVQVARVGPPLPAGGSAWRVTTAHDVWAARRLLDPAEEQQESEDGLVSLAEVLPAAARRLGAEPPVVWHPPLPARVEAVPDAPGAWGLADLPARQRREPLSWSAEEHLAVIGAARSGRSTTLRSVLSRTAGAWAVVLDLGRSLAATELRHHPGLLGWVEPDDLAHGLRVLDRLDELVRARQAAGAGDRPPVVLAVDGWDRLVDLFEGLERGRGVEVALRILREGPAAGVVGLVTGDRGLLLGTIASLLPHTWAHRLNDPGDLLLTGLRPHQIPVDQPPGRLVDLRDGVEAHVALPAGAVLGPPPAGPPPLVCRPLPRRWSPSGDDLSAWAVGGDEARPLGRPDGSVVVLGPPGSGRSHALALLRRGRPSLVVDPADPPGDDQVDALVAGLGPDGVVVVDDADLLFHTPVEDVLVRAVTAYRPALVVAADIDAAASAFRGLVPLAARHRTGLLLQPGAPSQGSLLGVAVPVGDLPLPGRGVLVQRGRCTRVQLAAPDPDR
>NZ_CP040887.1|WP_139721944.1|2209643_2209880_-|DUF1059-domain-containing-protein
MKTMTCRQLGGPCDLAHRGENADEVINAQDQHLKDAVAAGDAAHEQANADMRGRWKRPATSLGWYLGMKKQFAALPED

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040887_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040887_3

2513008-2513140

Orphan

Consensus_repeat	Method
GGCCCGTCGGCGCCGGGGCCGGCCG	CRISPRCasFinder

2 spacers

WYL

The CRISPR arrays of NZ_CP040887_3

>merge|NZ_CP040887|3|2513008-2513140|CRISPRCasFinder
GGCCCGTCGGCGCCGGGGCCGGCCGGGCCCTGCGGCGACCCGTCGGCGCCGGGGCCGGCCGGGCCCTCGGGCGGCCCGTCGGCGCCGGCGCCGGCCGCTGACGACGGCGCCCGCTCGGCGGGCGGGCCGGGGG

>NZ_CP040887|3|3|2513008-2513140|CRISPRCasFinder
GGCCCGTCGGCGCCGGGGCCGGCCG	GGCCCTGCGGCGACCCGTCGGCGCCGG
GGCCGGCCGGGCCCTCGGGCGGCCC	GTCGGCGCCGGCGCCGGCCGCTGACGACGGC
GCCCGCTCGGCGGGCGGGCCGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040887.1\|WP_139722187.1\|2521394_2522300_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP040887.1\|WP_139722183.1\|2517092_2519138_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173839
NZ_CP040887.1\|WP_139722181.1\|2515046_2516333_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|236440
NZ_CP040887.1\|WP_139722174.1\|2505325_2506210_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139723107.1\|2510026_2511109_-\|UDP-N-acetylmuramate-dehydrogenase	unknown	unknown	gnl\|CDD\|237552
NZ_CP040887.1\|WP_139722176.1\|2508666_2509335_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|197775
NZ_CP040887.1\|WP_139722186.1\|2520714_2521398_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139722184.1\|2519143_2519710_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP040887.1\|WP_139722188.1\|2522299_2522677_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224639
NZ_CP040887.1\|WP_139722179.1\|2511602_2512049_-\|MaoC-family-dehydratase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|379194
NZ_CP040887.1\|WP_139722180.1\|2513623_2515045_-\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|236207
NZ_CP040887.1\|WP_139723108.1\|2512664_2512991_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366711
NZ_CP040887.1\|WP_139722178.1\|2511198_2511603_-\|MaoC-family-dehydratase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|239537
NZ_CP040887.1\|WP_139722177.1\|2509516_2509957_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139722175.1\|2507228_2508275_+\|adenosine-deaminase	unknown	unknown	gnl\|CDD\|236480
NZ_CP040887.1\|WP_139722185.1\|2519770_2520745_+\|WYL-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP040887.1\|WP_010148718.1\|2512156_2512324_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP040887.1\|WP_139723106.1\|2506206_2507157_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP040887.1\|WP_158296767.1\|2522766_2523489_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP040887.1\|WP_139722182.1\|2516421_2517096_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228

Protein	Function_ID	Function_description	E-value
NZ_CP040887.1\|WP_139722187.1\|2521394_2522300_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	9.55525e-57
NZ_CP040887.1\|WP_139722183.1\|2517092_2519138_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173839	cd01150, AXO, Peroxisomal acyl-CoA oxidase. Peroxisomal acyl-CoA oxidases (AXO) catalyze the first set in the peroxisomal fatty acid beta-oxidation, the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. In a second oxidative half-reaction, the reduced FAD is reoxidized by molecular oxygen. AXO is generally a homodimer, but it has been reported to form a different type of oligomer in yeast. There are several subtypes of AXO's, based on substrate specificity. Palmitoyl-CoA oxidase acts on straight-chain fatty acids and prostanoids; whereas, the closely related Trihydroxycoprostanoly-CoA oxidase has the greatest activity for 2-methyl branched side chains of bile precursors. Pristanoyl-CoA oxidase, acts on 2-methyl branched fatty acids. AXO has an additional domain, C-terminal to the region with similarity to acyl-CoA dehydrogenases, which is included in this alignment.	1.67313e-169
NZ_CP040887.1\|WP_139722181.1\|2515046_2516333_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|236440	PRK09268, PRK09268, acetyl-CoA C-acetyltransferase.	0
NZ_CP040887.1\|WP_139722184.1\|2519143_2519710_-\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	1.69663e-08
NZ_CP040887.1\|WP_139723107.1\|2510026_2511109_-\|UDP-N-acetylmuramate-dehydrogenase	gnl\|CDD\|237552	PRK13903, murB, UDP-N-acetylmuramate dehydrogenase.	2.64814e-161
NZ_CP040887.1\|WP_139722176.1\|2508666_2509335_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	6.88715e-06
NZ_CP040887.1\|WP_139722188.1\|2522299_2522677_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224639	COG1725, COG1725, Predicted transcriptional regulators [Transcription].	6.06919e-28
NZ_CP040887.1\|WP_139722179.1\|2511602_2512049_-\|MaoC-family-dehydratase-N-terminal-domain-containing-protein	gnl\|CDD\|379194	pfam13452, MaoC_dehydrat_N, N-terminal half of MaoC dehydratase. It is clear from the structures of bacterial members of MaoC dehydratase, pfam01575, that the full-length functional dehydratase enzyme is made up of two structures that dimerize to form a whole. Divergence of the N- and C- monomers in higher eukaryotes has led to two distinct domains, this one and MaoC_dehydratas. However, in order to function as an enzyme both are required together.	1.20288e-24
NZ_CP040887.1\|WP_139722180.1\|2513623_2515045_-\|3-oxoacyl-ACP-reductase	gnl\|CDD\|236207	PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	0
NZ_CP040887.1\|WP_139723108.1\|2512664_2512991_-\|hypothetical-protein	gnl\|CDD\|366711	pfam01575, MaoC_dehydratas, MaoC like domain. The maoC gene is part of a operon with maoA which is involved in the synthesis of monoamine oxidase. The MaoC protein is found to share similarity with a wide variety of enzymes; estradiol 17 beta-dehydrogenase 4, peroxisomal hydratase-dehydrogenase-epimerase, fatty acid synthase beta subunit. Several bacterial proteins that are composed solely of this domain have (R)-specific enoyl-CoA hydratase activity. This domain is also present in the NodN nodulation protein N.	2.29703e-12
NZ_CP040887.1\|WP_139722178.1\|2511198_2511603_-\|MaoC-family-dehydratase-N-terminal-domain-containing-protein	gnl\|CDD\|239537	cd03453, SAV4209_like, SAV4209_like. Similar in sequence to the Streptomyces avermitilis SAV4209 protein, with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.	7.85029e-42
NZ_CP040887.1\|WP_139722185.1\|2519770_2520745_+\|WYL-domain-containing-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	3.32535e-53
NZ_CP040887.1\|WP_139722175.1\|2507228_2508275_+\|adenosine-deaminase	gnl\|CDD\|236480	PRK09358, PRK09358, adenosine deaminase; Provisional.	1.28252e-127
NZ_CP040887.1\|WP_010148718.1\|2512156_2512324_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	7.89374e-21
NZ_CP040887.1\|WP_139723106.1\|2506206_2507157_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.78311e-77
NZ_CP040887.1\|WP_158296767.1\|2522766_2523489_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.08288e-21
NZ_CP040887.1\|WP_139722182.1\|2516421_2517096_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.70337e-10

>NZ_CP040887.1|WP_139723108.1|2512664_2512991_-|hypothetical-protein
MWRLPADLGRSYARVAGDANPIHLSALSAKAFGFPRAIAHGMWTHARVLAAVQPRLPQRYAVSATFVKPILLPSTVVLRTGAEGLGDLAVTDRDGSRTHLSMQVDGRV
>NZ_CP040887.1|WP_010148718.1|2512156_2512324_-|50S-ribosomal-protein-L33
MAKSTDVRPKITMACTECKERNYITKKNRRNNPDRLDMAKFCPRCGKHTAHRETR
>NZ_CP040887.1|WP_139722179.1|2511602_2512049_-|MaoC-family-dehydratase-N-terminal-domain-containing-protein
MPVNPDYAGREYPPAGPFEVTREQLAAFADAVGASSPAHRDPEAARAMGHADVVAPPTFAVRLAQACEAQLVEDPGAGIDFSRVVHGQEGFVHHRPITAGDSLTGTLHVDTMREAGGHGMVATRVELVDAAGAAVTTVTSTIVVRGEG
>NZ_CP040887.1|WP_139722178.1|2511198_2511603_-|MaoC-family-dehydratase-N-terminal-domain-containing-protein
MSDLTRTVTVDRARLVAYADASGDHNPIHQDADVARRVGLPDVIAHGMWTMGAALEVVTDYVGGDPARILSCQTRFTGMVVVPEGETVEVLVTGVVKKVDEAAGTQTLELSATCAGEKVLGRCQAVVRPLGAQA
>NZ_CP040887.1|WP_139723107.1|2510026_2511109_-|UDP-N-acetylmuramate-dehydrogenase
MRVGGAPRRLVTARTEAELIEAVRGCDEAGEPLLVVGGGSNLVVADAGFPGTVVLVRTRGIEVPHDSACGGVSVTVAAGEDWDELVARACAQGWSGIEALSGIPGSTGATPVQNVGAYGQEVAQTVARVRVWDRVEQRVRTMFAGDLGFAYRHSVLKESMLGPEAAPGTVTPRYVVLTVTFSLRPTELSQPVGYAALADGLGVALGERVPLARAREAVLEQRRRRGMVLDAQDHDTWSCGSFFTNPVLSREELQQVRLRAEESVGQDRRSAVPPTYPTDREQLVKTSAAWLIEHAGFGRGFGSRSGRPAGLSTKHTLAVTNRGQASAADVLAIAREVRDGVEQTLGVRLVNEPVLVGLTL
>NZ_CP040887.1|WP_139722177.1|2509516_2509957_-|hypothetical-protein
MRRHRQPVALLSALLGVGLAVSGCGTEGTDPAGGAVTQTSTPGADAEEVVGTGIVMQRSADAPPELCVGPIAESMPPQCRGPVLAGEFDWEDVEARQQGEVRWTDETYYGVGTYAPDGGEQGTFTLTRPLTAEQPQGYPPLRVDGG
>NZ_CP040887.1|WP_139722176.1|2508666_2509335_+|helix-turn-helix-domain-containing-protein
MAAIDAGGAQPDDSEAQPGEARAQPGDGGTQPDEGRAQPGGGEARPDGAADDPGGLVSLARADVAGPPSPGPVEQVGLALRAFRRERGWSQRALAESWGIPQSLVARAERHAEQLSLDACLALLRRAGVGLAVLGPDGMPVVRWEETDLLATDRSGRRFPAHRAVRPSTYGPRWWWFHDYFGGRSPGPAPRWTAEGFAIPPGTRYGRRPRPDAPDESPRWPG
>NZ_CP040887.1|WP_139722175.1|2507228_2508275_+|adenosine-deaminase
MPGRTRSLLALPKAHLHLHFTGSMRVDTVRDLADKHGLHLPHALTSQWPPRLSGHDERGWFRFQRLYDAARAVVRDEADMRRIVREAAEDDAAEGSRWLEIQVDPTSYAPFVGGLTPALEIVLDEARAVSAAGPTQVAVVVAASRMRHPLDARALARLAARHAGDAAGTVVGFGLSNDERRGWTGDFEPAFRIAAKAGLASVPHAGELLGADHVAVALDHLLPDRLGHGIRAVEDESVLARVVEEQVTLEVCPGSNVALGVYAHLAAVPLRRLLEVGARVALGADDPLLFGTRLADQYVSARVDHGLDDGALALLARGSIEGSVASPATRRRLLAEVDAWLDTPAPPT
>NZ_CP040887.1|WP_139723106.1|2506206_2507157_-|ATP-binding-cassette-domain-containing-protein
MIQTTALTKRYGSAQVPALDDLSIEVGDGVTGLVGANGAGKSTLIKILLGLLAPSSGSASVLGHDIQGSGEQIRRAVGYMPEHDCLPPDMRCIDFVVHMGRMSGLPPAPARERAADVLRHVGLAEERYRLMGGYSTGMKQRAKLAQALVHDPELVMLDEPTNGLDPAARDDMLALVHRIGHDFGIPVLVTSHLLGELERISDHVVVLDGGRLLRSEATRSFLADTGTVLVEVTGEGDAQQRMGEALAARGLSCRPHGGLIEIDPAAVGEDGEAAAAAHDRLRDLVRDTAADLDLGLVRVQARTGRLEDVFRDEVPA
>NZ_CP040887.1|WP_139722174.1|2505325_2506210_-|hypothetical-protein
MSAHDSAGVIHDIGYRRYAGERTSRAGIIRALLASGVLAVFGFGRSGKAKVLPFALLGMTLVPAVIQVGIMSIIGLSADLLNYSAYNAGSSFLVVLFVAAQAPVLFSRDLRSGVISLYLARPLGATAFALTRWASLVLAILAFVLTPLLVLFIGGLAAGASLQEELPRVAVALAGAVLLAMLVATVASLVASWTLRRGLAIAGSIMVLLVGLGVTAGLQEVASTEGATSLAHWAALLSPFVLVDSVQVALGDATSQFPAPADTVTTGLLLLASALALMLLGIALLVRRYRSKGA
>NZ_CP040887.1|WP_139722180.1|2513623_2515045_-|3-oxoacyl-ACP-reductase
MADLMQLLTTNPLAKQLGVPQATRLRRGRELPSGPVAVGAVGGGTLAVRTLELLGVPTRVALVDRPETRVSETTDDGRTREVPEAYPGSIGALVVDATGATSIPDLEVVRGLLRPAMKGLERSGRVVVLGLEPETAGAPTAVATQQALEGVVRSVGKELRGGATANLVRVDLLTAEPTSPSELASTLLFLLQGRSAYVSGQVLHVGHGARDPQVEEVLAERPYEGRVVVVTGAGRGIGAGIARTLARDGALVVAVDVPAGGQGLAEVANSIGGTALQLDITAPDAGARIAAHVAQRFGDMGRIHAIVHNAGITRDKLLANTDEERWGSVLEVNLAAQIRINQVLLDAGLPGGLDDGGRIVGVASTSGIAGNRGQANYAASKAGVIGLVRAMGADPRLAARRITVNAVAPGFIETEMTGRMPVATREVARRINSLQQGGRPVDVAEAIGYLADPASSAVTGEVLRVCGQSQIGA
>NZ_CP040887.1|WP_139722181.1|2515046_2516333_-|acetyl-CoA-C-acetyltransferase
MPDQLTDAVILGGNRIPFGKAGGAYADASNQAMLTSTLDGLVARFGLAGERLGEVAAGAVLKHARDFNLTREAVLGSALAATTPAYDLQQACGTGLETVIQVANKIRLGQVDSGVAGGVDSASDAPIAVGEGLRKALLGASRARTPMARVKALASVRPGDLAPETPRNAEPRTGLSMGEHQALTAREWGITREAQDELAAASHHQLAAAWDSGFFDDLATGFLRLSRDEGLRPDTSVDKLAGLSPVFGKGEGATMTAGNSTPLSDGAALVLLGSPQWAAEHRLPALARFVDAEVAAVDYVSGDEGLLMAPAYAVPRLLARQGLTLDDIDRFEIHEAFASTVLATLAAWESEEFCTGRLGLDGPLGRVDRSRLNVHGSSLAAGHPFAATGGRIVATLAKMLHDLGPGSRGLISVCAAGGQGVVAILEGC
>NZ_CP040887.1|WP_139722182.1|2516421_2517096_+|TetR-family-transcriptional-regulator
MTIQTDGAGRTVAEPRDGRDSRWEAHRTRRRRQLVEAALKAIRRHGAGVGMDEIAAQAGTSKTVLYRHLGDRAGLYGAVVQAVDENVLTDLEAAQQHGGDVVTRIEAMVRSYLALVQRDPEIYRFVMTRPLETTEGDPDDPVHRLTDRVGEQIAVAIRGHLLDTGRADEADTLALAWGHGIVGLVRASADHFLTGRSTTQLSVDAATHAVVELIRPALAGGPRP
>NZ_CP040887.1|WP_139722183.1|2517092_2519138_+|acyl-CoA-dehydrogenase-family-protein
MTTSAQPQTHTPQPDTDVSMPASADAAATRPQSDEELTDLGEALRRATGGRYGPVRDLARATVPASTMVRDPELTMPEAREWTTDALRRLIELGMAGSGFPVAQGGLDDVGRSCVDFEMTAHGDLSLTVKSGVHFGLYGGAVTALGTQWHHETFLPPILSMEQVGCYAMTEFGHGSDVASLETTHTYDAATDEIVVHSPTPSSTKTYIGAAAHDAHVAAVYGQLVVDGESHGVHVVVVPIRDEDGRPAPGVTLGDNGAKGGLAGVDNGTITFDQVRVPRSHLLNRYGGIDDEGRYVSDIDSDGKRFFTMLGTLVRGRICVAAGAATASRKALSIATRYALRRRQFSAPGHDGEVLLLDYLAHQRKLIPGIATAYAHMFAVNELTDRLQELHEMPTKDQEAQRELETRAAGLKAVTTRFSNDTIQMCREACGGAGYLAENGLTTLRGDADVFATFEGDNTVLLQLVAKGLLSGYKEMWGDLDMRGMVQFAARAFGGQFVEATAARPLVERLRSAAARKGEDDTLLDRGWHLAMFADRERHVLETLATRLRRRADDRDSFEAFNSAQDHVLLAARTHMDRVVLEAFVTGVEACEDEQVREVLERLCTLYALSSIDADAGWFQAHNRMSAGRAKAVIAQINTLCAELRPQALELVEGLGIPEPWLNSQMLRDETAARWTPGAAV
>NZ_CP040887.1|WP_139722184.1|2519143_2519710_-|DinB-family-protein
MDALTRDLVEQLDWHWTQQARPRLDGLTDEEYLWEPVPGTWTARPRAAAPPPSVTARAGGGDWQLDWADPEPEPAPVTSIAWRLGHVVVGVLGTRAHSHFGGPPADLLGWDYAGTADGALDQLDAAYAAWSAGVRGLDAEALRRPVGPAEGPWADAPMIALVLHINREVIHHLAEVALLRDLWAHGAR
>NZ_CP040887.1|WP_139722185.1|2519770_2520745_+|WYL-domain-containing-protein
MTDPTTRVLRLLGLFQTRALWTSEELAERLGVTTRSIRRDIDRLRELGYPVRASSGTGGGYQLGAGGSLPPLLLAEDEAVAIAVCLRLAAGGSVAGVADSAVRILAKLDQVMPASAREQVSALHDSLVTVGTPAAVVDPSILMAASRACRDRLRATLRYVARDGEESRRRIEPASLVAVSYRWYLLAFDLDRDDWRSFRLDRVRELSVGTLRGAVREVPDPAAYITRSVTRSPYRHVATARVRMSLADLADRVSPLAGEIRDLGEGWCELVTGGESLDYLVVELLMLGVEVEVVDPPELVEHLRTVLDRLGGAVGQGSARRSSP
>NZ_CP040887.1|WP_139722186.1|2520714_2521398_-|hypothetical-protein
MNRTLSVVRLQLVNTQTYVWVPLLVLGGAFLVTMTIFALLPVDGIVGGGAQAPMWYFLVVGVQSLTLTFPFSQALSVTRREFYLGTVLTALLASAVLAVIYVLGGLLEEATGGFGTGSVFFQVPGVWSDGWAVAGLLYLVLSFAFFKVGFFCAVVYKRFGTLVLTAGLIVLALLVLVGLWVVTRLEAWSQVAGWVADTGVLGLTLWSLPVLALLALASYGLLRRALP
>NZ_CP040887.1|WP_139722187.1|2521394_2522300_-|ATP-binding-cassette-domain-containing-protein
MGSVIEVQNLTKRYRETTALDDVSFSLQQDAIYGLLGRNGAGKTTAMSIITAQNFATSGEVRVFGQAPFENPGVLSRMCFVRESQKYPDDATGRHALRMARLFFPRWDEDLAQELVEEFALPVRRRIKKLSRGQLSAVGVIIGLASRAEITFFDEPYLGLDAVARQLFYDRLLQDYAEHPRTVVLSSHLIDEVAPLLERVLVIDQGRILIDEDTDALRGRASAVVGPSAAVEDFVAGREVIHTERLGRVTSATVLGGLSELDRQRLRDADLDVVPVSLQQLVVRLARRAEESVPEHQELVS
>NZ_CP040887.1|WP_139722188.1|2522299_2522677_-|GntR-family-transcriptional-regulator
MMEEGRPIFLQIAESIEASIVDGSLSEEERAPSINELAAFHRINPATAAKGVNQLVDDGVLYKRRGVGMFVADGARARLLARRTQDFAAAYVDPLLAEARRLGLGPRDVADIIAERSATTRKEPS
>NZ_CP040887.1|WP_158296767.1|2522766_2523489_-|YdcF-family-protein
MLLAYAAGPVAVGTATGLLLLAAWPGFVTLLLLAVRWRLCRPGAAARCGAVVVLGMPVPDGVVGPELAARLRGGLATVASLGGGVARADGAGQGGAGLEAGGHVVPLVLTGGRGTRARPAEAVAMQRWVRGVEPAAAVLLEDRATTTVENLLLSTALLRDRGAEPPYAVVTSAYHAPRTRWLVQRLRLPFRVVGVPVPLESATGAYLRELLIVLKQARWAHVVAAALLVVVALLAGLAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040887_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040887_4

2561841-2561905

Orphan

Consensus_repeat	Method
GAGGTGGCCCAGGGCGAGGAGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040887_4

>merge|NZ_CP040887|4|2561841-2561905|CRISPRCasFinder
CAGGACGGCCAGGACGAGCTGGACGCGCAGGCCGCCACCCTGGAGGAGTCGCAGGCCGAGCTGGA

>NZ_CP040887|4|4|2561841-2561905|CRISPRCasFinder
CAGGACGGCCAGGACGAGCTGGA	CGCGCAGGCCGCCACCCTG
GAGGAGTCGCAGGCCGAGCTGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040887.1\|WP_139722215.1\|2573423_2573723_-\|NADH-quinone-oxidoreductase-subunit-NuoK	unknown	unknown	gnl\|CDD\|180218
NZ_CP040887.1\|WP_158296768.1\|2560664_2561333_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP040887.1\|WP_139722216.1\|2573722_2574595_-\|NADH-quinone-oxidoreductase-subunit-J	unknown	unknown	gnl\|CDD\|235844
NZ_CP040887.1\|WP_139722212.1\|2565278_2567252_+\|DUF839-domain-containing-protein	unknown	unknown	gnl\|CDD\|225752
NZ_CP040887.1\|WP_170215603.1\|2574591_2575302_-\|NADH-quinone-oxidoreductase-subunit-NuoI	unknown	unknown	gnl\|CDD\|235637
NZ_CP040887.1\|WP_139722200.1\|2551266_2552760_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|379138
NZ_CP040887.1\|WP_139723111.1\|2571431_2573408_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP040887.1\|WP_139722201.1\|2552832_2553582_-\|fructosamine-kinase-family-protein	unknown	unknown	gnl\|CDD\|225547
NZ_CP040887.1\|WP_139722217.1\|2575294_2576725_-\|NADH-quinone-oxidoreductase-subunit-NuoH	unknown	unknown	gnl\|CDD\|235692
NZ_CP040887.1\|WP_170215602.1\|2569875_2571432_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP040887.1\|WP_139722208.1\|2559628_2560600_+\|EamA-family-transporter-RarD	unknown	unknown	gnl\|CDD\|225510
NZ_CP040887.1\|WP_139722205.1\|2556133_2556454_+\|TraR/DksA-C4-type-zinc-finger-protein	unknown	unknown	gnl\|CDD\|274340
NZ_CP040887.1\|WP_139722214.1\|2568328_2569876_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP040887.1\|WP_139722206.1\|2556515_2558411_+\|2-oxoacid:acceptor-oxidoreductase-subunit-alpha	unknown	unknown	gnl\|CDD\|274738
NZ_CP040887.1\|WP_139722211.1\|2564098_2565094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139722202.1\|2553623_2554130_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
NZ_CP040887.1\|WP_139722203.1\|2554132_2554930_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP040887.1\|WP_139722213.1\|2567324_2568332_-\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_CP040887.1\|WP_139722204.1\|2555001_2556096_+\|peptidoglycan-bridge-formation-glycyltransferase-FemA/FemB-family-protein	unknown	unknown	gnl\|CDD\|225224
NZ_CP040887.1\|WP_139722207.1\|2558407_2559619_+\|2-oxoacid:ferredoxin-oxidoreductase-subunit-beta	unknown	unknown	gnl\|CDD\|237006

Protein	Function_ID	Function_description	E-value
NZ_CP040887.1\|WP_139722215.1\|2573423_2573723_-\|NADH-quinone-oxidoreductase-subunit-NuoK	gnl\|CDD\|180218	PRK05715, PRK05715, NADH-quinone oxidoreductase subunit NuoK.	1.91897e-37
NZ_CP040887.1\|WP_158296768.1\|2560664_2561333_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.45391e-09
NZ_CP040887.1\|WP_139722206.1\|2556515_2558411_+\|2-oxoacid:acceptor-oxidoreductase-subunit-alpha	gnl\|CDD\|274738	TIGR03710, OAFO_sf, 2-oxoacid:acceptor oxidoreductase, alpha subunit. This family of proteins contains a C-terminal thiamine diphosphate (TPP) binding domain typical of flavodoxin/ferredoxin oxidoreductases (pfam01855) as well as an N-terminal domain similar to the gamma subunit of the same group of oxidoreductases (pfam01558). The genes represented by this model are always found in association with a neighboring gene for a beta subunit (TIGR02177) which also occurs in a 4-subunit (alpha/beta/gamma/ferredoxin) version of the system. This alpha/gamma plus beta structure was used to define the set of sequences to include in this model. This pair of genes is not consistantly observed in proximity to any electron acceptor genes, but is found next to putative ferredoxins or ferredoxin-domain proteins in Azoarcus sp. EbN1, Bradyrhizobium japonicum USDA 110, Frankia sp. CcI3, Rhodoferax ferrireducens DSM 15236, Rhodopseudomonas palustris BisB5, Os, Sphingomonas wittichii RW1 and Streptomyces clavuligerus. Other potential acceptors are also sporadically observed in close proximity including ferritin-like proteins, reberythrin, peroxiredoxin and a variety of other flavin and iron-sulfur cluster-containing proteins. The phylogenetic distribution of this family encompasses archaea, a number of deeply-branching bacterial clades and only a small number of firmicutes and proteobacteria. The enzyme from Sulfolobus has been characterized with respect to its substrate specificity, which is described as wide, encompassing various 2-oxoacids such as 2-oxoglutarate, 2-oxobutyrate and pyruvate. The enzyme from Hydrogenobacter thermophilus has been shown to have a high specificity towards 2-oxoglutarate and is one of the key enzymes in the reverse TCA cycle in this organism. Furthermore, considering its binding of coenzyme A, it can be reasonably inferred that the product of the reaction is succinyl-CoA. The genes for this enzyme in Prevotella intermedia 17, Persephonella marina EX-H1 and Picrophilus torridus DSM 9790 are in close proximity to a variety of TCA cycle genes. Persephonella marina and P. torridus are believed to encode complete TCA cycles, and none of these contains the lipoate-based 2-oxoglutarate dehydrogenase (E1/E2/E3) system. That system is presumed to be replaced by this one. In fact, the lipoate system is absent in most organisms possessing a member of this family, providing additional circumstantial evidence that many of these enzymes are capable of acting as 2-oxoglutarate dehydrogenases and.	0
NZ_CP040887.1\|WP_139722216.1\|2573722_2574595_-\|NADH-quinone-oxidoreductase-subunit-J	gnl\|CDD\|235844	PRK06638, PRK06638, NADH-quinone oxidoreductase subunit J.	1.26462e-54
NZ_CP040887.1\|WP_170215603.1\|2574591_2575302_-\|NADH-quinone-oxidoreductase-subunit-NuoI	gnl\|CDD\|235637	PRK05888, PRK05888, NADH-quinone oxidoreductase subunit NuoI.	1.59348e-73
NZ_CP040887.1\|WP_139722200.1\|2551266_2552760_-\|serine-hydrolase	gnl\|CDD\|379138	pfam13354, Beta-lactamase2, Beta-lactamase enzyme family. This family is closely related to Beta-lactamase, pfam00144, the serine beta-lactamase-like superfamily, which contains the distantly related pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	6.95561e-23
NZ_CP040887.1\|WP_139723111.1\|2571431_2573408_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP040887.1\|WP_139722201.1\|2552832_2553582_-\|fructosamine-kinase-family-protein	gnl\|CDD\|225547	COG3001, COG3001, Uncharacterized protein conserved in bacteria [Function unknown].	1.37817e-39
NZ_CP040887.1\|WP_139722217.1\|2575294_2576725_-\|NADH-quinone-oxidoreductase-subunit-NuoH	gnl\|CDD\|235692	PRK06076, PRK06076, NADH-quinone oxidoreductase subunit NuoH.	1.82245e-159
NZ_CP040887.1\|WP_170215602.1\|2569875_2571432_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	0
NZ_CP040887.1\|WP_139722208.1\|2559628_2560600_+\|EamA-family-transporter-RarD	gnl\|CDD\|225510	COG2962, RarD, Predicted permeases [General function prediction only].	1.16265e-86
NZ_CP040887.1\|WP_139722205.1\|2556133_2556454_+\|TraR/DksA-C4-type-zinc-finger-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	3.29364e-17
NZ_CP040887.1\|WP_139722214.1\|2568328_2569876_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	5.84947e-167
NZ_CP040887.1\|WP_139722212.1\|2565278_2567252_+\|DUF839-domain-containing-protein	gnl\|CDD\|225752	COG3211, PhoX, Predicted phosphatase [General function prediction only].	1.28647e-178
NZ_CP040887.1\|WP_139722202.1\|2553623_2554130_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	4.91585e-53
NZ_CP040887.1\|WP_139722203.1\|2554132_2554930_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.05572e-34
NZ_CP040887.1\|WP_139722213.1\|2567324_2568332_-\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	1.96171e-85
NZ_CP040887.1\|WP_139722204.1\|2555001_2556096_+\|peptidoglycan-bridge-formation-glycyltransferase-FemA/FemB-family-protein	gnl\|CDD\|225224	COG2348, COG2348, Peptidoglycan interpeptide bridge formation enzyme [Cell wall/membrane/envelope biogenesis].	2.96622e-45
NZ_CP040887.1\|WP_139722207.1\|2558407_2559619_+\|2-oxoacid:ferredoxin-oxidoreductase-subunit-beta	gnl\|CDD\|237006	PRK11867, PRK11867, 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed.	3.42165e-171

>NZ_CP040887.1|WP_158296768.1|2560664_2561333_+|TetR-family-transcriptional-regulator
MTVRPDSVASRGPDPAAPGRRELNKVRTREAIVGALLELVAELPAADVTVDQVAERAGVSRRTFFNYFGSIPAVLSAVFADHADAMITRLDPGVIGDDPVTALRVLARTHGIPEDLLGWFVALNRHGADTDATVLLERTVWADMAAWLRERLHDVLPGSDPLFVATLASAVMSCFQATEEAWLKDLQVDRPEQLSPADVTAFHDHLDRALGLLADGWRSPSA
>NZ_CP040887.1|WP_139722208.1|2559628_2560600_+|EamA-family-transporter-RarD
MTDEAERRRQRGTAYGFLAYLLWGVFPLYFAALRPAGPWEIVAHRIVWTLVLCLAVLLLTRDLRWMVDLARAPRRLAGVMLAGLFITTNWGIYTYAVLTGHVTEAALGYFLNPLVTVALGVLVLRERLRRLQWVAVGIGAAAAVYLSVDYGSPPWISLALACSFASYSLLKNRLGVSLSPLRSLVGETATVLPLALLILWWLDRAGETTWGGHGELHTVLLMSTGLATAVPLLLFAAAASRVPLSTVGLLQFLTPFLQLLTGVLLLGEVVPASRWVGFALVWVALVVLSADMVRQVRRSRAQRRARARDAREERPDLADPAPC
>NZ_CP040887.1|WP_139722207.1|2558407_2559619_+|2-oxoacid:ferredoxin-oxidoreductase-subunit-beta
MTTPLGLPTRRGTEGVPTLGDGEKQTKKDFTSDQEVRWCPGCGDYAVLAAVQGFLPDLGLRRENIVFISGIGCSSRFPYYLDTYGMHSIHGRAPAIATGLATSREDLSVWVVTGDGDALSIGGNHLIHAMRRNVNLTILLFNNKIYGLTKGQYSPTSDVGAVTKSTPSGSVDHPFNPVSLALGSEATFVARTMDSDRAHLTEVLKAAAAHRGTSLVEIYQNCPIFNDGAFQLLKDRDEATGRVAHLRAHEPVRIGAEGSPDATVVVRDPQGRLQVVPEQAVPEGHTVVVHDPSDPDPTNAFGLSRLDDPSMQTVPMGIFRQVQRPTYDDGVRQQVQEATAGTTRDTASLDALLHGRDTWTVDGTRPGQVEQLLEGETTEGPTAAAGEVLAEEGEEVYEDEGTP
>NZ_CP040887.1|WP_139722206.1|2556515_2558411_+|2-oxoacid:acceptor-oxidoreductase-subunit-alpha
MSSTPLHQLERVVIRFAGDSGDGMQLTGDRFTSDTAALGNDLSTLPNFPAEIRAPQGTLPGVSSFQVHFADHDIATPGDAPDVLVAMNPAALKANLPDLPRGATVIANADEFTRRNLAKVGYAANPLEDDSLADAGYHVHALPLTSMTVEALAGFDGLTRKEKERAKNMLALGLLSWLYSRDTASTEAFLRAKFAQAPEILEANLTALRTGHAYGETTEDFAVRYQVAPAPMAPGTYRTITGNQALALGLVASAYRTGLPLVLGSYPITPASDVLHQLSTLKAHGVTTLQAEDEIAAVGMALGASFGGSLGVTTTSGPGLALKSETIGLAVATELPLLVIDIQRGGPSTGLPTKTEQADLLQALHGRNGESPVAVVAAQSPTDCFDAALEAVRIATTYRTPVILLSDGYLGNGSEPWQIPAAAQLPDLTVQHATEPNATDERGEPVFHPYLRDDQTLARPWAVPGTPGLEHRIGGIEKADVTGNISYDPANHDRMVRLRQAKIGAIADSIPPLEVDDPSGEARVLVLGWGSTYGPIGAATRLVRATGAKVARAHLRHLNPFPADLGDVLRRYDRVVVPEMNLGQLALLLRGTYLVDVRSHTQVRGLPFTAGELAQVVHENLMEVQSQEVTV
>NZ_CP040887.1|WP_139722205.1|2556133_2556454_+|TraR/DksA-C4-type-zinc-finger-protein
MDDHARTELEAKRAEVVAQMEQLSAPIQDQGSISFGKRVGDGTAMAVDRLTAVGAHDNLQGLLDEIGTALEAVEDGSYGRCRVCGEAIPEGRLEARPWATTCVRHG
>NZ_CP040887.1|WP_139722204.1|2555001_2556096_+|peptidoglycan-bridge-formation-glycyltransferase-FemA/FemB-family-protein
MTLTLETATDRASYMAALLDQPVSSPLQGWGYGEARRTLGQEPVRYLVRQGGRTVGAVQLMRKSLAPGVSTLYAPRGPVLADRSLLPEFARAVRQVARRTDHFLTIEPPEPLVAGDSPEQEDLAAEQAVIPDRIGPFRRARTEQPEHTILIDTSQEPDTVFAGLHKMARRNVRTAERMGVQAGRDDSFEDFWEIFTATNERSSLGAFPRHYYETLLREADQDGAEAYLLLSRHEGRALAGGFFLGLGDTTAYLYGGSVRDDRPPSEGEKRKDAKAPDAFYWSAITDAHEHGYSRLDLWGIPRLLDEKKHSFGVLRMKLKFGSHRYWFPAYDLALSPLSTPLRTALKVRRSYLNYRSFGTTDDIL
>NZ_CP040887.1|WP_139722203.1|2554132_2554930_-|SDR-family-NAD(P)-dependent-oxidoreductase
MAQTVADEAAAALGWEHLVPPDLSGRTVVVTGASDGIGRESALHLARWGARLVLPVRNRAKGERARARLLRESAADRADAVTLVDLDLTESLLPVVRERVVLVTSHAHTSGRMDHDDPHFRRTRWTLPRAYSRSKLTAMLWGLDLGARMPAGTQVQLTHPGWVVTNLQNASGNAHVDRLVTAASRPLAMTPAQGAAAVLFSLTQPLPPGSYVGPDGWQHLRGRPTLIRRSARALDRSEAARTAAWMRREVGLDAGGPVPGPRAPA
>NZ_CP040887.1|WP_139722202.1|2553623_2554130_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MHIMTVCLGNVCRSPAAEAVLVRSLDEAGIEGVSVSSAGTADYHVGERPNPASVTEGERRGYAFTTRGAQFGADDFDRADLVLAMDSSNEDDLLALARTPEEAARVVRLGAFAPDAGEGVRDVPDPWGLSREAFVAMYDQVEEAVAGLVAAIREGRVEEVVTAQRARR
>NZ_CP040887.1|WP_139722201.1|2552832_2553582_-|fructosamine-kinase-family-protein
MTRPDEPFTKTRADAPTLFFDREATGLRALAAAGARVPEVLAVSRTGISIEQVPSGGHRTAASEEAFGRELAALHRTTGERYGAVDGEPTAYLGDCPVDLAPCDTLAESWLDRRVVPLARRAVESGRLDPSALADARALGAEHLGPVEPPTLVHGDLWAGNRLVDDRGRSWLVDPCAHYAHREVDLAMMQLFGGFSGRVLAAYVEAFPLSEGWERRTAVFQTVPLLVHVLLFGGGYAVQAGDALRAARG
>NZ_CP040887.1|WP_139722200.1|2551266_2552760_-|serine-hydrolase
MRRVIGGVLGASLLLTGCTEEYDDDVAATSTPPLVVQTAAPQDAAASSAPAGGSTTTSPPVPVDPADAIGDAELLDAVQWVLGLLEEDAEGPPAQEAAERFAPDLLEEVSPVELGLVLAQVRSAGPYVVTAAVPSSGVGRTATLSLAAQDPLLMTVGVDEQGRIATLLLQPDTSGEPPVVDAWPDLDAALAELGGTSQVVVGHVRGGTCETDYTSAGVEPGGDAFPGASVVKLLVLLAVVDEVEAGALSWDEELTLTADVVSLPSGELQDRPEGSSVQVREAAELMISISDNTATDLLMERVGQRALRAAAVEAGLDPTEVMPVPTTRQIFQLGWQVDSEVRTRWAEAVVPERREAMLADLPAELDVDPATVTEPRWQDGIDWFLTGEQVCSLHARLQQRAAEPAGEPVREILALDPGLPPPEGVGYQAFKGGSLPGVLAMSFYVEPQEGAVGGDGEPAAPEGLVLVVQTRSAEPVDPLRAATIVGAGLQHLVDVGG
>NZ_CP040887.1|WP_139722211.1|2564098_2565094_-|hypothetical-protein
MRRTLAGLWAILPLAALLLALSLVPPPDLVPTHWSGRVPDGFASGPGFVAGVLTTVVVCTVVAAVASVARRLVPPSWGRWVLAVVAGVSWGAVLLYLVTAWRVGVDGAQDVREGWPLVAVLGALLAGLVGYAVHGRWVPSAEQLADLVPERSRVQPVRGRAAQPVQPWSSDVSSRTMRVLGVGLLVVFVVVAVVIVGADESVVLLVVVLLTGLGAGGLALLWSAVTVQVDEDGLRVRSRVLPVPVARVRADQVAGVDVQDLDPLRWGGIGLRALPDRTAFIVDAGGPGIVVYLRTGRRLALQITEGDQAARVGARTLLRAAGQRVGAGSPS
>NZ_CP040887.1|WP_139722212.1|2565278_2567252_+|DUF839-domain-containing-protein
MSPLTERRTLLPLLPAHPGGRSAATCRYRCGDACSQPVPNTSDNRYFGDVVAATVQRRSLLQAGAAATGAAALAWGTARPAAAAGHGRPGLAGFTPIAPTPADVDELVVPEGYSWAPVISWGDPIDAGAPDFDVDRQSVEAQRRQAGYNADYLTLRRGGARGNGANRGLIAFNNEYTNPENMFPDFSGVPTPEQAMIEMAAHGMTIVEVSRRNPFSPWRYDVAGARNRRIHAHTPFRVDGPAAGSRLLRTAADPQGRTVLGTLNNCAGGDTPWGTVLSGEENVNQYFNADGAPDPDGSLARYGITSSGRGWEQADERFSVVDHPHEVHRFGWIVEVDPDDPTSTPVKHTALGRFKHEGATIRLADDGRAVAYMGDDERFDYIYKFVSRERYRRGDKRHNMQLLSEGDLYVARFTGDGVEDGEFDGSGVWLPLVVDGTSRVPGMSVEEVCVHTRLAADLVGPTKMDRPEDVEPNPHTGQVYVALTNNTRRTPGQIDEANPRANNKFGHVIQWTEAGDDAAALTFRWRIVLVAGDPDDPSTYFSGFDRSQVSPISCPDNVAFDGQADHLWISTDGAPGTIGTCDGMFLMPTAGPEKGKVQQFLSVPTGAECCGPVVSWDERSVLVSVQHPGEGGTPSAYPYLGDPVPRPGVAHVYRSRR
>NZ_CP040887.1|WP_139722213.1|2567324_2568332_-|polyprenyl-synthetase-family-protein
MRTATVPGSDDALTGRVQTGLDRVAARLEEVVDHDDPFIAEANLHLARAGGKRFRPLLTLLTSEVGRGWDDQVVDAAVGVELTHLASLYHDDVMDEADLRRGVSSANARYGNATAILVGDLLFGTASAVVAGLGAEAVRIQAETFIRLCAGQIRDDRQGATPPPAGGQDAAVEAYLSILADKTGSLIATAARYGAMFGGCDEATVRTLTAYGETLGVVFQLADDLLDVASEADASGKTPGTDLREGKATLPVLYALGGSDPADARLRELLAGPIDDPAELAEALALLRPHTAMEQARERTLAMAAQARALLEDLEPSPAVDALRALVDGVADRSR
>NZ_CP040887.1|WP_139722214.1|2568328_2569876_-|NADH-quinone-oxidoreductase-subunit-NuoN
MGGSMFVAPDINYTALLPMIIVFVGGLVGVTVEGFASRRTRYAVQVPLSIATLVLALLALVLLGRDNEGITAAGTVAVDGVALALQGLVLVLSILGLLVMSERFGGEQPDAFTQSGVSTPGSAEETLATKVGATTTEVYPLTLMSVGGMMLFVAANDLLLLFVALEILSLPLYVLAGLARRRRLLSQEASLKYFLLGSFSSAFYLFGAVLLYGYAGSMRFSDIAAAISSNVGMDGLLVPGVLLVAVGLLFKVGAVPFHAWTPDVYQGAPTPVTGFMAACTKVAAFGAMLRVLYVAVEGARLEWQPVIAVVAALSMVVGALLAIVQTDVKRILAYSSIAHAGFILTGVVALDVAGVSSTMFYLATYGFMTIPAFAIVALVRSAGTEATLVDQWAGLGRRSPWIAASFTFLLMAFAGIPLTSGFTGKFAVFSAAVSQGWAWLAVVGVLASAVTAYIYFVLVVQMWLGDPDDAAGTVVVRPSWMTSVAILVGVAITLALGVMPSPVLDLAQSTAAFLR
>NZ_CP040887.1|WP_170215602.1|2569875_2571432_-|NADH-quinone-oxidoreductase-subunit-M
MSFPWLTTLLVLPLVGALVVSLLPKGSTIVRPVALGVALLTLAVGVGAATQFRIGGGTAGEPFQLTEVYSWIPQFGVSYALGVDGISLSMILLGLVLVPICIVAAWDDVPSVGRRQHAYFALMLALTSMMVGVFAAIDVFLFYVFFEAMLIPVYFLIGVFGGSRRARAATSFLLYSLAGGLIMLVAVIGVYLAGPRGTDGFLLSNLTGMDLSVEAGRWLFLGFFIAFAIKAPMWPVHTWLPLAAEQARPATSVLLVGVLDKVGTYGMIRFCLTLFPEASQWATPVILALALVSLFVGAFLAIGQTDMLRLISYTSISHFGFIVLGIFAFTTVSQTGATLYMVNHGFTTAGLFLVAGMLIVRRGSRDLRDFGGWQRVTPLVAGALFVSGMSGLALPGLNSFVSEFLVIVGTFGRHPWLGVISAIGVILAAVYILVMYQKVATGPRPTGPEVEDVADMSGREKWVVAPIIAAFLVLGFYPKPVLELLEPAVQQTLQTVGISDPAPAVDTAANHSTEGSDH
>NZ_CP040887.1|WP_139723111.1|2571431_2573408_-|NADH-quinone-oxidoreductase-subunit-L
MHDLSHGLATLSLAAAEHEGGASAVHATPAEGFAALGWLLVALPLLGAAVLLLGGRRTDRWGPALATALSWGSFGVGVAVIVQLTGLAPEERALSVPLWDWVSVGDLSLSAGLLLDPLSLAFVMLITFVGSLIHVYSLGYMEHDPDKRRFFAYLNLFVAAMLILVLADSYLLLFVGWEGVGLASYLLIGFWNDNPDYAAAANKAFVVNRVGDVGLITAMAIMLATFGALDFATVHGSAAGAGDLTLTLIGLALLLGACGKSAQFPLQSWLGDAMAGPTPVSALIHAATMVTAGVYLIARSQAIYDLTPDARLVVAVVGAVTLLYGAVVGCAKDDLKKALAASTMSQIGYMMLAVGLGPVGYLYAIFHLVTHGFFKANMFLGAGSVMHAMDNRVDMRRFGALRTDIKITFFTFLAGWLAIIGFPFTAGWYSKDFIIETAFAEPGWRAWVFGGIALLGAGITAFYMSRLFFMTFFGKARWHEDAHPHESPLVMTVPMMILALGSLVLGLVLYPTHIITDWLEPVFGHAEHGEPLIPVLAIQILAFVLMVAGAGLAWMMYGRREVPQTAPEAGPLTRAARRDLYQDDLNDALFTSPTMTLARTSVEADSVLVEGTVTGGTIGGLNSLSRMLRRAQNGFVRSYALTMLLGVVAILGAVWVMQ
>NZ_CP040887.1|WP_139722215.1|2573423_2573723_-|NADH-quinone-oxidoreductase-subunit-NuoK
MGLEAYIYLSVVLFALGAITVLTRRNTIIVFMGIELMLNACNLALVTFARIHGTLDGQVYALFVMVVAAAEVVVGLAIIMSIFRARRSASVDDANLLKL
>NZ_CP040887.1|WP_139722216.1|2573722_2574595_-|NADH-quinone-oxidoreductase-subunit-J
MTPDRIDGMEVGLFWVLAVVAVAGALGLLFARKAVHAAMAMAMTMISLGVIYIVQQAEFVGIIQIFVYSGAVMMLFLFVVMLVGVDASDSTVETLRGQRVLAFGLGALFVAAAVYGLTRVSWPAAVGLETVQAEGSVTALAREIFERQVLTFETLGALLVIAVMGAMVLAHRERLTPKRTQRQISQERLRAGEWLAGKPNPGVYARHNAADTPALAPDGSPVEESVPRVLVARGQVTNPGEYRLPSGSGRSDGQPPAEQSREDLPSGTNAAADNEMTKHDGTDRSDGEER
>NZ_CP040887.1|WP_170215603.1|2574591_2575302_-|NADH-quinone-oxidoreductase-subunit-NuoI
MADPTEPHTDEPARTHADSTPARRGETVSGDGRKEPGLLGQLFAPVAGFGVTFGTMFRKVPTQEYPEVKRKTATRFHGRHQLNRHPDGLEKCVGCELCAWACPADAIYVEGADNTDEARFSPGERYGRVYQINYLRCIFCGLCIEACPTRALTMTNEYEMADSERAPLIYEKHQLLAPLRPDMLTPPFPMAEGMEERDYYQGKVTGATSGQQDYVEQRDARRDEAGADADQAEARS
>NZ_CP040887.1|WP_139722217.1|2575294_2576725_-|NADH-quinone-oxidoreductase-subunit-NuoH
MSLLTAYPEVMASVPLVTQDLPAADFSDTPWWLSLVKAFLLFVYVMISVVIVIWFERRVIGRMQQRPGPNRLGPLGILQTTADGIKLFLKEDVTPKGADKLMFYAAPLIVASLAFVSFAIIPLGGDVQMFGHTTPLQLTDTPVAVLLVLAVAGVSAYGFVLAGWSSGSTYPLLGGLRSTAQVISYEIAMGLSLVAVFLYAGSMSTSQIVEAQQQSTVLGIPLWYIVPLFFSFVVYVITMIGETNRLPFDLAEGEGELGGGFHTEYSSMKFGMFFLGEYINMFTVSALATTLFLGGWHAPWPLNVLFDGALDSGWWGLLWFTAKMWGFIFFYVWVRGSLPRVRYDQFMALGWKILIPLSLVWVVAVMLIRSAQEGYFGEGRWVTVLTLGGIGVFVLIGILLWDRYAQRRAAAREEAQEVPEEIDPFADGYPVPPMPGQRLVEPRPAVEQARPVTVAAGPRDADDPGTDRTTEEERRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040887_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040887_5

2590996-2591089

Orphan

Consensus_repeat	Method
CAGGTCAGCTGACGGCCCCCTCGAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP040887_5

>merge|NZ_CP040887|5|2590996-2591089|CRISPRCasFinder
CCGGTCAGCTCTCGGCCGTCAGGTCAGCTGACGGCCCCCTCGACCCGGCGGGCGTCGTCCGTCAGCCGCCCGGTCAGCTCTCGGCCGCCAGGTC

>NZ_CP040887|5|5|2590996-2591089|CRISPRCasFinder
CCGGTCAGCTCTCGGCCGTCAGGTC	AGCTGACGGCCCCCTCGACCCGGCGGGCGTCGTCCGTCAGCCGC
CCGGTCAGCTCTCGGCCGCCAGGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040887.1\|WP_170215604.1\|2584789_2586109_-\|geranylgeranyl-reductase-family-protein	unknown	unknown	gnl\|CDD\|273936
NZ_CP040887.1\|WP_139722231.1\|2602200_2604183_-\|peptidase-M13	unknown	unknown	gnl\|CDD\|226118
NZ_CP040887.1\|WP_139722223.1\|2586941_2588792_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP040887.1\|WP_139722225.1\|2591677_2593000_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340951
NZ_CP040887.1\|WP_139722232.1\|2604312_2604609_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040887.1\|WP_139722219.1\|2579261_2580575_-\|NADH-quinone-oxidoreductase-subunit-NuoF	unknown	unknown	gnl\|CDD\|131014
NZ_CP040887.1\|WP_139723115.1\|2582933_2583716_-\|NADH-quinone-oxidoreductase-subunit-C	unknown	unknown	gnl\|CDD\|181115
NZ_CP040887.1\|WP_139722224.1\|2591177_2591678_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226489
NZ_CP040887.1\|WP_139722233.1\|2604776_2605241_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240044
NZ_CP040887.1\|WP_139723116.1\|2589620_2590955_+\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
NZ_CP040887.1\|WP_139722222.1\|2586222_2586942_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP040887.1\|WP_158296769.1\|2593071_2594385_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|234945
NZ_CP040887.1\|WP_139722220.1\|2581515_2582934_-\|NADH-quinone-oxidoreductase-subunit-D	unknown	unknown	gnl\|CDD\|180385
NZ_CP040887.1\|WP_139722229.1\|2598391_2600032_+\|helicase-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|379300
NZ_CP040887.1\|WP_010146291.1\|2584338_2584704_-\|NADH-quinone-oxidoreductase-subunit-A	unknown	unknown	gnl\|CDD\|181171
NZ_CP040887.1\|WP_158296770.1\|2600028_2602170_+\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224748
NZ_CP040887.1\|WP_139722228.1\|2596282_2597782_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|212659
NZ_CP040887.1\|WP_058890547.1\|2583760_2584315_-\|NADH-quinone-oxidoreductase-subunit-B	unknown	unknown	gnl\|CDD\|235797
NZ_CP040887.1\|WP_139723114.1\|2580571_2581492_-\|NADH-quinone-oxidoreductase-subunit-NuoE	unknown	unknown	gnl\|CDD\|181024
NZ_CP040887.1\|WP_139722227.1\|2594467_2596204_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|236020

Protein	Function_ID	Function_description	E-value
NZ_CP040887.1\|WP_170215604.1\|2584789_2586109_-\|geranylgeranyl-reductase-family-protein	gnl\|CDD\|273936	TIGR02032, Uncharacterized_protein_MJ1520, geranylgeranyl reductase family. This model represents a subfamily which includes geranylgeranyl reductases involved in chlorophyll and bacteriochlorophyll biosynthesis as well as other related enzymes which may also act on geranylgeranyl groups or related substrates. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll].	5.16274e-72
NZ_CP040887.1\|WP_139722231.1\|2602200_2604183_-\|peptidase-M13	gnl\|CDD\|226118	COG3590, PepO, Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP040887.1\|WP_139722223.1\|2586941_2588792_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	7.68667e-174
NZ_CP040887.1\|WP_139722225.1\|2591677_2593000_-\|MFS-transporter	gnl\|CDD\|340951	cd17393, MFS_MosC_like, Membrane protein MosC and similar proteins of the Major Facilitator Superfamily of transporters. The gene encoding Sinorhizobium meliloti membrane protein MosC is part of the mos locus, which encodes the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine. MosC belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.93607e-65
NZ_CP040887.1\|WP_139722219.1\|2579261_2580575_-\|NADH-quinone-oxidoreductase-subunit-NuoF	gnl\|CDD\|131014	TIGR01959, NADH-quinone_oxidoreductase_subunit_F, NADH-quinone oxidoreductase, F subunit. This model describes the F chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2. [Energy metabolism, Electron transport].	0
NZ_CP040887.1\|WP_139723115.1\|2582933_2583716_-\|NADH-quinone-oxidoreductase-subunit-C	gnl\|CDD\|181115	PRK07785, PRK07785, NADH dehydrogenase subunit C; Provisional.	8.93265e-139
NZ_CP040887.1\|WP_139722224.1\|2591177_2591678_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226489	COG3981, COG3981, Predicted acetyltransferase [General function prediction only].	1.45563e-43
NZ_CP040887.1\|WP_139722233.1\|2604776_2605241_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240044	cd04688, Nudix_Hydrolase_29, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.2002e-23
NZ_CP040887.1\|WP_139723116.1\|2589620_2590955_+\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	3.62012e-81
NZ_CP040887.1\|WP_139722222.1\|2586222_2586942_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	2.15738e-51
NZ_CP040887.1\|WP_158296769.1\|2593071_2594385_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|234945	PRK01346, PRK01346, enhanced intracellular survival protein Eis.	1.72899e-82
NZ_CP040887.1\|WP_139722220.1\|2581515_2582934_-\|NADH-quinone-oxidoreductase-subunit-D	gnl\|CDD\|180385	PRK06075, PRK06075, NADH-quinone oxidoreductase subunit D.	0
NZ_CP040887.1\|WP_139722229.1\|2598391_2600032_+\|helicase-associated-domain-containing-protein	gnl\|CDD\|379300	pfam13625, Helicase_C_3, Helicase conserved C-terminal domain. This domain family is found in a wide variety of helicases and helicase-related proteins.	6.3525e-33
NZ_CP040887.1\|WP_010146291.1\|2584338_2584704_-\|NADH-quinone-oxidoreductase-subunit-A	gnl\|CDD\|181171	PRK07928, PRK07928, NADH dehydrogenase subunit A; Validated.	1.3525e-50
NZ_CP040887.1\|WP_158296770.1\|2600028_2602170_+\|acyltransferase-family-protein	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	3.20868e-52
NZ_CP040887.1\|WP_139722228.1\|2596282_2597782_+\|sugar-kinase	gnl\|CDD\|212659	cd07770, FGGY_GntK, Gluconate kinases; a subfamily of the FGGY family of carbohydrate kinases. This subfamily is composed of a group of gluconate kinases (GntK, also known as gluconokinase; EC 2.7.1.12) encoded by the gntK gene, which catalyzes the ATP-dependent phosphorylation of D-gluconate and produce 6-phospho-D-gluconate and ADP. The presence of Mg2+ might be required for catalytic activity. The prototypical member of this subfamily is GntK from Lactobacillus acidophilus. Unlike Escherichia coli GntK, which belongs to the superfamily of P-loop containing nucleoside triphosphate hydrolases, members in this subfamily are homologous to glycerol kinase, xylulose kinase, and rhamnulokinase from Escherichia coli. They have been classified as members of the FGGY family of carbohydrate kinases, which contain two large domains separated by a deep cleft that forms the active site. This model spans both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Some uncharacterized homologous sequences are also included in this subfamily. The Lactobacillus gnt operon contains a single gntK gene. The gnt operons of some bacteria, such as Corynebacterium glutamicum, have two gntK genes. For example, the C. glutamicum gnt operon has both a gluconate kinase gntV gene (also known as gntK) and a second hypothetical gntK gene (also known as gntK2). Both gluconate kinases encoded by these genes belong to this family, however the protein encoded by C. glutamicum gntV is not included in this model as it is truncated in the C-terminal domain.	1.64393e-126
NZ_CP040887.1\|WP_058890547.1\|2583760_2584315_-\|NADH-quinone-oxidoreductase-subunit-B	gnl\|CDD\|235797	PRK06411, PRK06411, NADH-quinone oxidoreductase subunit NuoB.	4.30015e-93
NZ_CP040887.1\|WP_139723114.1\|2580571_2581492_-\|NADH-quinone-oxidoreductase-subunit-NuoE	gnl\|CDD\|181024	PRK07539, PRK07539, NADH-quinone oxidoreductase subunit NuoE.	3.42591e-78
NZ_CP040887.1\|WP_139722227.1\|2594467_2596204_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|236020	PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated.	1.2546e-153

>NZ_CP040887.1|WP_139723116.1|2589620_2590955_+|isochorismate-synthase
MTRPVPRLRARTLAVDAPGDLLTRIPDEIDPSDVVAWLREGDGLVGWGRVAGVRTGGADRFVEAERWWTAVQEHAEVEDGVRLPGTGLVTFGSFTFSPDSADASVLTIPRVVIGRRDGLAWVTQVVVDDEPWPTAHPAELLGRTNADIEVLDPLVESSGAVPADGWPGVVEQAVGRIGRGEVEKVVLARDVHVRHRDGHVVRLAPVLERLEKRYAATWTFAVEGLVGATPEMLVRLQGGRARSRVLAGTIRRPNGIPVRRVGDALAAAPDPEHPVDPRLRLVSSEKDLDEHAFAVRSVAEALAPHCAELVVPEAPYVLELPDVYHLASDLTGTMRSGATSLRLAAALHPSAAVCGTPTDPAARLIAELEGMDRGRYAGPVGWMDASGDGDWGIALRCGELAEDRHSMRLFAGGGIVAASDPQAELAETEVKLTAMRHALGLGGT
>NZ_CP040887.1|WP_139722223.1|2586941_2588792_-|CBS-domain-containing-protein
MDVELAEIRDFLAEHPPFDALPADVLDRLPARCTVSYARRGTVVLRPGDHGDRLYLVRSGAVDITDEGHLVDRVGAGGGFGMSALVEHVPARYAATAREDTLLLELPQADFDALAAEHPAVAVHFAATHHGRITAAIAQLQTPARGSAVLKTSVRDLLRAPQPVSVAPSATVAEGARVMTAAGVSSLLVMEGGSLVGIVTDRDLRRRVLAAGVPPDRPVGEVMTPDPVTLPARALALEAMLEMTGRNIHHLPVVEDGRVLGLVTTTDLVRLERSNPVYVVADVQRQEDVAGVVEQAARIPAVVGQLVREDASAADVGRVLAALTDAVTRRLVVLAETQLGPAPGRYAWAALGSVAREEQGLASDQDHALVLADDADPADPWWAAMAERVTAGLEACGLPRCPGGTMATDPRWRQRVSGWRSQFARWGEEPAPEAVLRAAIFYDMRAVHGDADLVVGLRSEVVPLGGRSDLLLAHLTAQSARMRPPIGFFRGLVLEDAGEHRDTLDLKRGIAAVVQMARIHALRAGSTALGSGARLAAAREAGILPKESATDLTDALELLSYLRLRHQAARVAAGEVPDNHLDPRRLGSLDRRHLRDAFAVVRSAQQGLSSRSPQVG
>NZ_CP040887.1|WP_139722222.1|2586222_2586942_-|DNA-polymerase-III-subunit-epsilon
MGLRELLPGRRPRPGPGTPLADLAAASAVDPATPLDQVRLLALDLETTGLDPRRHEVLSVGHVPVAQGRILLAHARHELVRPQGPVGESAVHHGLTDDRLAHVPDLAQVLPRVLEALRTGSAQDGEDARPVRRVLLAHFAQIETDFLAAACRRLYGTDVPLQVVDTLTLAQRMLRVPTPELASGRLRLDACRRHYRLPRYRAHSALTDALACAELFLAQSAELAEQYGRPLRLADVLTR
>NZ_CP040887.1|WP_170215604.1|2584789_2586109_-|geranylgeranyl-reductase-family-protein
MSQARRHSVNEQVETADVIVVGAGPGGASAAAYLSAHGLDVLLLEKSTFPRDKICGDGLTPRAVRELISLGVPIDEADGWHRTRGLRILGGGMRLELDWPANETFPGFGLVRTRHDLDEILARHAVTRGARLLEGINVQEPVLDARGHICGVKAKVMGPDGRPTGERREFRSRVVVAADGNSSRLSLAMDRPKRDDRPMGVAVRAYFETPRHADPYLESWLELWTKDEQGRDDVLMPGYGWIFPVGDGTANVGLGILDTAEAFGTFDYRDVMRRWIATMPQDWTFSEETQQGPIRGAALPMCFNRQPLYDRGLLLVGDAGGMVNPFNGEGIAEAMESGRHAAEVIASALARPTPGETEVVLQSYTAAMKASLGGYYTLGRHFATLIGKPEVMRLAVRYGLPRRSLMRLLLKIMANLPQERGGGMDDRVINALSRMTPAA
>NZ_CP040887.1|WP_010146291.1|2584338_2584704_-|NADH-quinone-oxidoreductase-subunit-A
MDYHPYLPVVFFLLFGLLFAFGSVFGGALLGRTTYNRAKAEAYECGIQPTPQAHEGGRVPVKYYLTAMLFIVFDVEVLFLYPFAVAFDQVGLFSVLAMLLFLVVVSVPFVYEWSRGGLEWD
>NZ_CP040887.1|WP_058890547.1|2583760_2584315_-|NADH-quinone-oxidoreductase-subunit-B
MGLEDKIPGGIMLTTVEGLAGHLRQYSVWPATFGLACCAIEMMAVGTPDYDIARFGMERFAATPRQADLMIVAGRVSQKMAPVVRQVYDQMPNPKWVISMGVCASSGGMFNNYAIVQGVDHIVPVDVYLPGCPPRPEMLLNAVLELHKQIREFKFSVNREEAARAAESAAMKAMPTSEMKGLLA
>NZ_CP040887.1|WP_139723115.1|2582933_2583716_-|NADH-quinone-oxidoreductase-subunit-C
MQETTEDRVNAPERTEDQKVSPGHAQESGGGSVPAATRAEDHDPVEVARKKGMFGASLGNDTSGYGGLDVPVLMPGAAQRPYGSYFDEVVDALEAAAPEAFAAGLERVVVDRGELTLHVHRDHLLALVRPLRDDPRLRFEVCTGVSGVHWPQQTGAELHAVYHFQSITHGVRRVRLEVTCPDEDPRIPSIVGTYPTNDWHERETWDMFGIVFEGHPGLTRILMPDDWPGHPQRKDYPLGGIPVEYKGATVPAPDQRRSYT
>NZ_CP040887.1|WP_139722220.1|2581515_2582934_-|NADH-quinone-oxidoreductase-subunit-D
MATTNSTDEQVAGSPADEGAAYLDSTPTDLYAEGGPTSDADGDAVFTAAGGDWDDIARDVAALGAERIVVNMGPQHPSTHGVLRLILELDGETVQEARAGIGYLHTGIEKNMEVRTWTQGTTFCTRMDYLTPIFNEAAYCLSVEKLLGITDQIPQRANDIRVLMMELNRIGSHLIAVATGGMELGATTVMTIGFRERERLLRFFEAVSGLRMNHAYVRPGGVAQDVLPEHLDQFEEELPLLRRGISELEKLLLESPVLKGRLVDVGYLSLASCMALGITGPILRSTGLPHDLRKADPYCGYETYDFDVVTRRDMDAYSRLCIRLDEMWQSLRIAEQAIARLRASEGEPVMVADKKIAWPAQLSVGADGQGNSLDHIREIMGESMEALIHHFKLVTEGFRVPPGQAYAAVESPKGELGVHTVSDGGTRPYRVHFRDPSFTNLQAASALSEGGLVADVIVAVASIDPVMGGVDR
>NZ_CP040887.1|WP_139723114.1|2580571_2581492_-|NADH-quinone-oxidoreductase-subunit-NuoE
MRSQLDEASERRVHHSVPGHSDHGPLHHHTPLHASEEPYPEDVLARLVADGEQVIARYPQKRSALLPLLHLVQSVDGYVTGRGVRLCADLLDLTTAEVSGVATFYTQYKRHPNGEYTVGVCTNTLCAVMGGDQIFDEVSEHLGIGHDETTEDGRITLERVECNAACDYAPVVMVNWEFFDEQTPESTKELTDRLRAGEPVTPTRGPSRVCTFKQVSRVLAGFPDGLADEGPGAGQASLRGTLLAKEKGWTAPRPDSGTDTEATSEGQAGGQSQGMYGSVNTDANEPDDVPTSEGVKDVDETKGDEA
>NZ_CP040887.1|WP_139722219.1|2579261_2580575_-|NADH-quinone-oxidoreductase-subunit-NuoF
MSTQLTPILSEFWDVERSWTLETYEQHEGYRALRTALAGDAADLVAAAKESGLRGRGGAGFPTGMKWGFLPPPDGGPRYLVVNADESEPGTCKDTPLMMAAPQFLIEGMIITSFAIDCHHAFIYVRGEIVHVYRRLMRAVEEAYAAGYLGKDILGSGFDLDITVHAGAGAYICGEETALLDSLEGRRGQPRLKPPFPAVAGLYARPTVVNNVESIASVPSIVLHGADWFAGMGTEKSQGYGLFSLSGHVERPGQYEAPLGITLRELLEMAGGMRGGKKLKFWTPGGSSTPIFTDAHLDVPLDFESVAAEGSMLGTRALQIFDETVSVVRAVSRWTDFYAHESCGKCTPCREGTFWLKQILERLEAGQGRPGDIEKLDDICDNILGRAFCALGDGATSPITSAIQYFREEFEEAMHTPWQETFPAGRNTLFAKESQPA
>NZ_CP040887.1|WP_139722224.1|2591177_2591678_-|GNAT-family-N-acetyltransferase
MLTLRPPTLHDEAALRAMHEQLAAEDFTFLLAQGTWSEILAQVRREADGRDLPADRVRADFLVAEADGVPVGRVSIRHELTPFLREVGGHVGYAVAPPFRRRGHATEILRQSVERLRGLGVERVLVTCDDANAASAATIESCGGVLEDVRVPPGGGVPRRRYWIDG
>NZ_CP040887.1|WP_139722225.1|2591677_2593000_-|MFS-transporter
MGRDVRGSVLAVLVVFASSGFVMGQALARVPAVRDHLGADTGALGLALMGMGLGSLLAMPFTGWLVDRFGSRRVVTVAVALGCLGWSAVAVVPSVPVLLAVLVLTGTNVGIWDVGMNIQGTHVEQARSRSLMPFFHAAFSGGAVLGAGSGALAAWLGIGLAQLPVLAVVGAVAGVWGASRFVPEAPPEEPGAATARAEDGVPARAEDGVPAGATAPAVAAEHGAPAGATATGHDEHDEQAPQRPARRGVTSAELLIGLICLAGALAEGSANDWLALLLVDVHGAPAAFGALTLTAFNLTMMIGRLLGGPAIERFGRAAVVRAGGALAAAAILVVTLSSSLGLALAGGLLWGLGVATIFPAAISAAGEVPGRGNRAITVVSTIAYGAFLFGAPTIGLLAEVAGLDRALFIVVGFLVLLLVLSPVMREKSGGRDRAGAAMVG
>NZ_CP040887.1|WP_158296769.1|2593071_2594385_+|GNAT-family-N-acetyltransferase
MTTSLPAPVDLTPDDLPRIRDLVETVWFSVVPGKTLQHLEEEIDLRHARGIERPDGPLPGEPASAAPLLGLYSAFDLGLTVPAAAGGLTRVPMDGLTMVSVHPDARRRGVLRRMMTDHLHRVHERGDAALAGLHASEPAIYGRFGYGHASADAKLTLGRGTTLTAPPALTARADEIRTHVTDLDGEEALAVVHRTHLACARVTLGAVTRPESTEQSWFAFRDHPKARAGKEPNRVMFARRGEELTGYAVFRRESRWDDGQPAGEVSVAELTAADDASLLALARRLVDMDLTGRTVFWSRPTDDPLAWWAGGPRSAGMRVFDALWLRLVDVPRALGDRGYAAGAPLDLVVQVEDDVCPWNAGRWRLQVDGDGAAQVGTTDAEPDLVAPVAALGAAYLGGRTLLAQVATLGVQELTPGAVAGLSRAMRADREPVPAIGF
>NZ_CP040887.1|WP_139722227.1|2594467_2596204_-|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MHPSTALAAVLVDELVRGGVREAVLAPGSRSAPLAYALEEADRAGRLRLHVRIDERSASFLALGLARGGGAPVPVVTTSGTAVAHLHPAVLEAAHSGIPLVVLSADRPSELRGTGANQTTVQPGVFAGSVRWEVDLPAPEGVTRAAGAHWRSTVCRALAAAGDAGPLRGAGPGPVHLNVSFRDPLAPGPGQPDTADDVLAGRAGGAPWVAVAPAPGPVAAPIGPGRRTLVLLGDLPDPALADRALSWAQEAGWPVLAEPFGRLPTGPGVVPHGPLVASAVARGELTELVPDRVVVVGRLTLFRELGALLRLPGVLVEHVSAQERWTDPSHVVSRVHGPGALVTAPPRHPEASGWVHAWTAAGAQRSATVAAAAGAEPTGVGVAGVVAEALGEDDVLVLGSSTVPRDLALSLHGTAAAARVVAQRGLAGIDGTVSAAVGVALAVQGDEAPEGLPRVVALMGDLTFLHDAGGLLIGPGEPRPDLTVVVVNDDGGGIFSTLEYGDPARLDDPGAAAAAERVFGTPHGTDLAALCAAHGVRHERLATLAALRESLAGRSEGLRVLEVPVDRASHRRVRDALR
>NZ_CP040887.1|WP_139722228.1|2596282_2597782_+|sugar-kinase
MASNFDIELKDAVAPLVLAIDVGSSASRGMVYDAHGRPVGKRAKVSHAFTTAADGTSEIDPDQLVDEVRTIIGELLGALDGHEVAGVALDTFASSLVVVDADGAPLTPCFTYADGRCSAQVQELREELSEENLQQRTGTRVHSSYWPARLRWLAAERPKVMKKAATFLSLGDYLLMGLIGTVATGTSTASWTGLVDRHTAQWYPELVEICGIDADRLPPIHHLDEPVEVADTHVDRIAADWPGLVGARWYAPITDGLAANVGLGAHDETAIAASCATSGALRVLVREMPETLPPGLWCYRVSHDRSLLGGALNDVGRALAWADVTLAVDQVGPEALSAALTAEPHPTTPIVLPFFTGERSTGWASDARAVLAGVTAASAPAEVYRGVVEGIALSYARIASQLREVAPQPEKLYAGGSVASDRPELMQIMADAMRTPVTPVTIKRSTLHGTALLALESLAPDVRRARPVRGATLSPDYQRRPYYTDRFRRFQQVYEALFD
>NZ_CP040887.1|WP_139722229.1|2598391_2600032_+|helicase-associated-domain-containing-protein
MALALRGGRLHRHPAVEAPAVEHTTVDQDVVDAAAGGRAAELVVLVTEVVEEWGARPPRVLRSGGLAVRDLGRLSAHLETGTEEVAWLLETVHAAGLVAVDDGRRQAGGEESSVWAPTALADAWLEEPAGARWATLAQAWWTTSAAPGLVGTTDGGRVNVLSTATSYPLARQRRHDTLRALASLPPGAVGAPEPLAELLRWRHPLRSARSTGDHGVGPGTALREAEWAGLTGRGALSTPGRAVVAGDPAADLMEPLVPPAVDHVLLQADLTAIAPGRLDGPARTLLRLVSDVESRGGATVHRFGEQSVRRALDLGWTADRVLEELAAVSRTGVPQPLDYLVRDVARRHGVARVGACAAYLRCDDAALLDRIEHDRALGMLQWRRVAPTVLVSPVPAPTVMDLLREEQYGPVADGADAGLALAVQRHRAPRTTTPAVRVSGVDETVARQVVGVVRRGDASAAAAGGGDGDAGTDASTDPVVVSATVREAAVDGQALWIGYADDAGGVATHLVRPLAVEGGRLRASVGDADVTRTFLLHRITRVSPAQ
>NZ_CP040887.1|WP_158296770.1|2600028_2602170_+|acyltransferase-family-protein
MSPSRTDTRTDRRGEAAPPSPSREATSPGEGSGATAHPSLTARYRRELHGLRGLAIALVVVFHVFGDGRVSGGIDVFLAISGFLFTGMLAREAVRTGGRVDLGRYLGRILRRLLPTAVLVLAATWLAGRLLLPETRWVQLGREVRASLTYVENWELIASQLGYGAAGASTSPLQHFWSMSVQGQFYLLWPVVVVLGVLLARGLRVGPRAVLLAVVGAVGVGSFGYAAWLHHADQQVAYLHTGARLWEPALGGVVALLALDARLPRALRLLLGWAGVGLVASSGLVLDGGALFPGPAALWPVGGFALVMAAGTTGSRWGADRWLSGRLLGWVGDIAYPLFLWHWPVVVYTLVVTGKERLDLADGALVIAASLLLAQLTHTLVEGPVTASPMRRPWLVVGVGALVVAVGAGLVGGWTATLVREREVALAQAAQDSPDHPGAAALHEPGFGNTGATPVPALAAAPQDNADVYGQGCIQGHEDTAAASEVLVCPGTDPGAEHTVVVTGGSHVVQFVPALEVAAEQQGWNLVVVSRSGCHLTTNTGGYPERTDAVPTDSCVAWNTGFLETVEELDPDAVVTLGTTTQPGSEQVSRGFVEVWRELGRRGIDVIGLRDTARMPQDVPDCLAEHPDEPQACAMPRDPAYRDTAPYLGRDDLPANISFVDVVDQICTERTCPAVAGDVVVYSDHSHVTATYMRTLAPALDARLREAAPRLYR
>NZ_CP040887.1|WP_139722231.1|2602200_2604183_-|peptidase-M13
MKSGIDRAGMNADVRPQDDLFGHVNGGWLASATIPEDRSRYGAFDLLRENAETSVRELIEQAAQAQPELDTPAGKVGALYASFMDTDQVERVGLTPLTDPLQRIAQVEDVSAFVRLSAQLQREGVDGLTHLWVTADAGDPESYIAYLHQGGIGLPDEAYYTAEEHASVREAYRTYLARLLELAAPALAGTGLEEILGGDAVDRVYALEERLAAAHWDRVAARDAVKSYTRLTRGELAERTPGMDWDAFADGLGAPAGALDAVVARQPDVLAALGETLTQVPLADWQAWLVVRLLDALAPYLTDDLVAAHFDFHGRALSGTPANKERWKRGVGIVEALLGEAAGQLYVEAHFPPAARERMTELVAHVTEAFRRRIGELEWMGPQTRERAVEKLASFRPKIGHPDTFRDYTAYALDPGDLVGNVRRGAAFETDRELAKVGGPIDHDEWLMTPQTVNAYYHPMLNEIVFPAAILQPPFFDVDADDAANYGGIGAVIAHEIGHGFDDQGSRYAGDGSLTDWWTEADREAFDARSQQLVEQFDTLSPRDLPGGTATVNGGLTVGENIGDLCGLELAHLAYTIATEGSAPELDGWTGDQRFFLGWGSVWRTVAREEEARRLLSIDPHAPADLRANTVRNVDAFHAAFGTQEGDALWLAPEDRVRIF
>NZ_CP040887.1|WP_139722232.1|2604312_2604609_-|hypothetical-protein
MPVGEDGRWRPGSAGDLRREAAGRETYVVPRLMRRLTPVVAVLAWVTVLLGWSRGRAWGDDLLGVYLVMACLWTVMALAVWRPWVPRRARARPAQPRT
>NZ_CP040887.1|WP_139722233.1|2604776_2605241_-|NUDIX-domain-containing-protein
MDIVTEGGASASEYLPPAHIRVLALALIRHPSSGAVFVTEYLDPARGESLHRPAGGGIEFGETAQQALRREFREEFDTEIEVGDRVAVLENIFVFNGRPGHEWVVLHEARFLDDAMHGPGPHPVLDAPTDLGVWRPATGTDLPRLVPDALGDLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040887_4	4.1\|2561864\|19\|NZ_CP040887\|CRISPRCasFinder	2561864-2561882	19	NZ_CP040887.1	579475-579493	1	0.947
NZ_CP040887_4	4.1\|2561864\|19\|NZ_CP040887\|CRISPRCasFinder	2561864-2561882	19	NZ_CP040887.1	59816-59834	2	0.895
NZ_CP040887_4	4.1\|2561864\|19\|NZ_CP040887\|CRISPRCasFinder	2561864-2561882	19	NZ_CP040887.1	393446-393464	2	0.895
NZ_CP040887_4	4.1\|2561864\|19\|NZ_CP040887\|CRISPRCasFinder	2561864-2561882	19	NZ_CP040887.1	2198137-2198155	2	0.895
NZ_CP040887_4	4.1\|2561864\|19\|NZ_CP040887\|CRISPRCasFinder	2561864-2561882	19	NZ_CP040887.1	2575853-2575871	2	0.895

1. spacer 4.1|2561864|19|NZ_CP040887|CRISPRCasFinder matches to position: 579475-579493, mismatch: 1, identity: 0.947

cgcgcaggccgccaccctg	CRISPR spacer
cgtgcaggccgccaccctg	Protospacer
**.****************

2. spacer 4.1|2561864|19|NZ_CP040887|CRISPRCasFinder matches to position: 59816-59834, mismatch: 2, identity: 0.895

cgcgcaggccgccaccctg	CRISPR spacer
cgcgcaggacgtcaccctg	Protospacer
******** **.*******

3. spacer 4.1|2561864|19|NZ_CP040887|CRISPRCasFinder matches to position: 393446-393464, mismatch: 2, identity: 0.895

cgcgcaggccgccaccctg	CRISPR spacer
cgcgcacgccgccaacctg	Protospacer
****** ******* ****

4. spacer 4.1|2561864|19|NZ_CP040887|CRISPRCasFinder matches to position: 2198137-2198155, mismatch: 2, identity: 0.895

cgcgcaggccgccaccctg	CRISPR spacer
cgcgcaggccgccgcgctg	Protospacer
*************.* ***

5. spacer 4.1|2561864|19|NZ_CP040887|CRISPRCasFinder matches to position: 2575853-2575871, mismatch: 2, identity: 0.895

cgcgcaggccgccaccctg	CRISPR spacer
cgcgctggccaccaccctg	Protospacer
***** ****.********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1126978-1127004	4	0.852
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	36032-36058	4	0.852
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	533990-534016	4	0.852
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	173981-174011	4	0.871
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2218014-2218040	5	0.815
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	AJ006589	Bacteriophage phi-C31 complete genome	28069-28095	5	0.815
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	X76288	Bacteriophage phi-C31 early region, virus genome	9558-9584	5	0.815
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	87982-88012	5	0.839
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	502883-502913	5	0.839
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1245605-1245635	5	0.839
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1087788-1087818	5	0.839
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	63172-63198	6	0.778
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	299524-299550	6	0.778
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	984048-984074	6	0.778
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	447676-447702	6	0.778
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	704792-704818	6	0.778
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	MK450421	Streptomyces phage Vash, complete genome	27192-27218	6	0.778
NZ_CP040887_3	3.1\|2513033\|27\|NZ_CP040887\|CRISPRCasFinder	2513033-2513059	27	JN698994	Mycobacterium phage DS6A, complete genome	36062-36088	6	0.778
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP023524	Burkholderia gladioli pv. gladioli strain FDAARGOS_389 plasmid unnamed, complete sequence	24280-24310	6	0.806
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	147685-147715	6	0.806
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	197331-197361	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	464971-465001	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	480499-480529	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	467774-467804	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP042515	Serratia marcescens strain E28 plasmid pE28_003	43736-43766	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	508588-508618	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	464948-464978	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	494882-494912	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	436638-436668	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	481681-481711	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	479369-479399	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	480499-480529	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	494882-494912	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	464948-464978	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	464456-464486	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	116607-116637	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP012183	Pseudonocardia sp. EC080610-09 plasmid pBCI2-2, complete sequence	109758-109788	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	251077-251107	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP015369	Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p2, complete sequence	50504-50534	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1473263-1473293	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	1289475-1289505	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	MK494105	Mycobacterium phage Pinnie, complete genome	36134-36164	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	MN304816	Phage 67_12, partial genome	39086-39116	7	0.774
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	KX641266	Mycobacterium phage Terror, complete genome	35446-35476	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	KX641265	Mycobacterium phage Taheera, complete genome	35446-35476	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP027794	Rhodococcus hoagii strain DSSKP-R-001 plasmid plas1, complete sequence	32637-32667	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	CP020974	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence	25859-25889	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_LN890657	Candidatus Promineofilum breve strain Cfx-K plasmid III, complete sequence	3809-3839	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	245210-245240	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_AP013064	Serratia marcescens SM39 plasmid pSMC1, complete sequence	14080-14110	8	0.742
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	MN813694	Gordonia phage Opie, complete genome	38470-38500	8	0.742
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP041928	Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374A, complete sequence	134632-134666	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NC_023332	Klebsiella pneumoniae strain ST48 plasmid pKP09085, complete sequence	96783-96817	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NC_023333	Klebsiella pneumoniae strain ST23 plasmid pKP007, complete sequence	99671-99705	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NC_023334	Klebsiella pneumoniae strain ST15 plasmid pKP02022, complete sequence	99012-99046	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP029591	Klebsiella pneumoniae strain DA33144 plasmid pDA33144-220, complete sequence	186155-186189	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NC_016966	Klebsiella pneumoniae plasmid pUUH239.2, complete sequence	99266-99300	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP012572	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6.X, complete sequence	29292-29326	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP041640	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MPH, complete sequence	91832-91866	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP012567	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6, complete sequence	29291-29325	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP050379	Klebsiella pneumoniae strain 51015 plasmid p51015_CTX_M_15, complete sequence	140422-140456	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP050374	Klebsiella pneumoniae strain 50595 plasmid p50595_NDM_1, complete sequence	163970-164004	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP020903	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-2, complete sequence	125519-125553	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP032186	Klebsiella pneumoniae strain AR_0075 plasmid unnamed1, complete sequence	181607-181641	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_LR025089	Klebsiella pneumoniae isolate KP980 plasmid 2, complete sequence	1258-1292	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP036188	Klebsiella pneumoniae strain BA1559 plasmid pIncFIBK, complete sequence	112050-112084	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_MN268580	Klebsiella pneumoniae strain KP13-53 plasmid pKP13-53-tet(A), complete sequence	90241-90275	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP029588	Klebsiella pneumoniae strain DA33141 plasmid pDA33141-217, complete sequence	185915-185949	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP036302	Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 plasmid p1_015093, complete sequence	176649-176683	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	CP052405	Klebsiella pneumoniae strain C17KP0020 plasmid pC17KP0020-1, complete sequence	206583-206617	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP041949	Klebsiella pneumoniae strain KP2 plasmid pKP2_3, complete sequence	147630-147664	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	CP052218	Klebsiella pneumoniae strain E17KP0053 plasmid pE17KP0053-1, complete sequence	176127-176161	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP036337	Klebsiella pneumoniae strain BP327 plasmid pIncFIBK, complete sequence	91928-91962	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP039809	Klebsiella pneumoniae strain C2660 plasmid pC2660-2, complete sequence	176649-176683	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP033402	Klebsiella pneumoniae strain WCHKP115069 plasmid p1_115069, complete sequence	179285-179319	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP029387	Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pTetD_040074, complete sequence	198107-198141	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_LR025093	Klebsiella pneumoniae isolate KP9201 plasmid 2, complete sequence	76074-76108	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_CP042883	Klebsiella pneumoniae strain NMBU-W07E18 plasmid pNMBU-W07E18_01, complete sequence	167763-167797	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	CP052435	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-1, complete sequence	123384-123418	9	0.743
NZ_CP040887_1	1.1\|272493\|35\|NZ_CP040887\|CRISPRCasFinder	272493-272527	35	NZ_LT994840	Klebsiella pneumoniae isolate CNR48 plasmid CNR48, complete sequence	61430-61464	9	0.743
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	837907-837937	9	0.71
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1793288-1793318	9	0.71
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	19974-20004	9	0.71
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	761497-761527	9	0.71
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	165819-165849	10	0.677
NZ_CP040887_3	3.2\|2513085\|31\|NZ_CP040887\|CRISPRCasFinder	2513085-2513115	31	KJ028219	Mycobacterium phage 32HC, complete genome	44833-44863	10	0.677

1. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.852

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
gcgccagcggcgacccgtcggccccgg	Protospacer
*  ** **************** ****

2. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 4, identity: 0.852

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ggatcggcggcgtcccgtcggcgccgg	Protospacer
** .* ****** **************

3. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ggatcagcggcgtcccgtcggcgccgg	Protospacer
** .* ****** **************

4. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 4, identity: 0.871

gtcggcgccggcgccggccgct-gacgacggc	CRISPR spacer
gtcgccgccggcgcgggccgctggacggcgg-	Protospacer
**** ********* ******* ****.***

5. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.815

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ggcactgcgtcgacccgtcggcggtgc	Protospacer
*** ***** ************* .*

6. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to AJ006589 (Bacteriophage phi-C31 complete genome) position: , mismatch: 5, identity: 0.815

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
cgttctacgtcgacccgtcggcgccgg	Protospacer
 *..**.** *****************

7. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to X76288 (Bacteriophage phi-C31 early region, virus genome) position: , mismatch: 5, identity: 0.815

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
cgttctacgtcgacccgtcggcgccgg	Protospacer
 *..**.** *****************

8. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ggcggcgcagccgccggccgctgacgacgcg	Protospacer
* ****** * ******************

9. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 5, identity: 0.839

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gcccgcgccggagccggccgccgacgacggg	Protospacer
*.* ******* *********.********

10. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.839

gtcggcg-ccggcgccggccgctgacgacggc	CRISPR spacer
-ccggcgcccggcgccggcggctgacgacgag	Protospacer
 .***** *********** **********.

11. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 5, identity: 0.839

gtcggcgccggcgccggccgctgacgacggc-	CRISPR spacer
gtcggcggcggcgccgggcgctg-cagcggcg	Protospacer
******* ********* ***** *..****

12. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ggccctgccgcgacccgccggcgtgtc	Protospacer
******** ********.*****.

13. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
tcgcctggggcaacccgtcggcgccgc	Protospacer
   **** ***.**************

14. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
actcctgcggcggcccgtcggggccgt	Protospacer
. .*********.******** ****

15. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
aaggcggcggcgaccagtcggcgccgg	Protospacer
..  * ********* ***********

16. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ccgcctgcgccgacccgtcgccgccgc	Protospacer
   ****** ********** *****

17. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to MK450421 (Streptomyces phage Vash, complete genome) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ccttctacgtcgacccgtcggcgccgg	Protospacer
  ..**.** *****************

18. spacer 3.1|2513033|27|NZ_CP040887|CRISPRCasFinder matches to JN698994 (Mycobacterium phage DS6A, complete genome) position: , mismatch: 6, identity: 0.778

ggccctgcggcgacccgtcggcgccgg	CRISPR spacer
ctcggcgcggcgacccgtgggcgccgg	Protospacer
  *  .************ ********

19. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP023524 (Burkholderia gladioli pv. gladioli strain FDAARGOS_389 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

gtcggcgccggcgccggccgctga-cgacggc	CRISPR spacer
ctcggcgcctgcgccagccgctgattgatgg-	Protospacer
 ******** *****.******** .**.**

20. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

gtcggcgccggcgccggccgctgacgacggc-	CRISPR spacer
gtcggcgccggcgtgggccgctg-cgatgatg	Protospacer
*************. ******** ***.*..

21. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctga--cgacggc	CRISPR spacer
cgcggcgccggagccggccgctgatctggcg--	Protospacer
  ********* ************  .*.**

22. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

23. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

24. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattgg	Protospacer
 * ** **** ****************. *

25. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP042515 (Serratia marcescens strain E28 plasmid pE28_003) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacg-acggc	CRISPR spacer
aacggcggcggcgctggccgctgacgcgcag-	Protospacer
. ***** ******.*********** .*.*

26. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

27. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

28. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattgg	Protospacer
 * ** **** ****************. *

29. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattgg	Protospacer
 * ** **** ****************. *

30. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattgg	Protospacer
 * ** **** ****************. *

31. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

32. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

33. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattgg	Protospacer
 * ** **** ****************. *

34. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

35. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ctgggagccgccgccggccgctgacgattga	Protospacer
 * ** **** ****************. *

36. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
cgctgcgccggcgccggccggtgacggctcc	Protospacer
  * **************** *****.*  *

37. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP012183 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-2, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gctggggccggcgccggccgcggacgatgtg	Protospacer
*..** *************** *****.*

38. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
cttcgaggcggcgccggctggtgacgacggc	Protospacer
 *. * * **********.* **********

39. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP015369 (Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p2, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc-	CRISPR spacer
accggcgccggcgccggccgaggac-ccgact	Protospacer
..******************  ***  **.*

40. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gacggcggcggcgccggccgccgaccaggca	Protospacer
* ***** *************.*** * *

41. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gacggcggcggcgccggccgccgaccaggca	Protospacer
* ***** *************.*** * *

42. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ggacgcgccggcgccggccgacgacgaggac	Protospacer
*   **************** .***** *.*

43. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to MN304816 (Phage 67_12, partial genome) position: , mismatch: 7, identity: 0.774

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
cgcgttgccggcggcggccgctgacgtcgac	Protospacer
  ** .******* ************ **.*

44. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to KX641266 (Mycobacterium phage Terror, complete genome) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gctggcgccggcgccggccgcggatgagtta	Protospacer
*..****************** **.**

45. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to KX641265 (Mycobacterium phage Taheera, complete genome) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gctggcgccggcgccggccgcggatgagtta	Protospacer
*..****************** **.**

46. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP027794 (Rhodococcus hoagii strain DSSKP-R-001 plasmid plas1, complete sequence) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
accggccccggcgccgaccgctgacatcgcg	Protospacer
..**** *********.********. **

47. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to CP020974 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
tggcgcgccggcgccggcagctggcgatcgc	Protospacer
    ************** ****.***. **

48. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_LN890657 (Candidatus Promineofilum breve strain Cfx-K plasmid III, complete sequence) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
acccccaccgtcgccgggcgctgacgacggt	Protospacer
..*  *.*** ****** ************.

49. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gtccgtgccggcgccggccgctgtgctcgat	Protospacer
*** *.*****************    **..

50. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_AP013064 (Serratia marcescens SM39 plasmid pSMC1, complete sequence) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
gtcggcgcttgcgccggccgctgggcttcgc	Protospacer
********. *************.   . **

51. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to MN813694 (Gordonia phage Opie, complete genome) position: , mismatch: 8, identity: 0.742

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
cgagaccacgtcgccggccggtgacgacggc	Protospacer
   *.*  ** ********* **********

52. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP041928 (Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374A, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

53. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NC_023332 (Klebsiella pneumoniae strain ST48 plasmid pKP09085, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

54. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NC_023333 (Klebsiella pneumoniae strain ST23 plasmid pKP007, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

55. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NC_023334 (Klebsiella pneumoniae strain ST15 plasmid pKP02022, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

56. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP029591 (Klebsiella pneumoniae strain DA33144 plasmid pDA33144-220, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

57. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NC_016966 (Klebsiella pneumoniae plasmid pUUH239.2, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

58. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP012572 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6.X, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

59. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP041640 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MPH, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

60. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP012567 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

61. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP050379 (Klebsiella pneumoniae strain 51015 plasmid p51015_CTX_M_15, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

62. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP050374 (Klebsiella pneumoniae strain 50595 plasmid p50595_NDM_1, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

63. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP020903 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-2, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

64. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP032186 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

65. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_LR025089 (Klebsiella pneumoniae isolate KP980 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

66. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP036188 (Klebsiella pneumoniae strain BA1559 plasmid pIncFIBK, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

67. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_MN268580 (Klebsiella pneumoniae strain KP13-53 plasmid pKP13-53-tet(A), complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

68. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP029588 (Klebsiella pneumoniae strain DA33141 plasmid pDA33141-217, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

69. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP036302 (Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 plasmid p1_015093, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

70. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to CP052405 (Klebsiella pneumoniae strain C17KP0020 plasmid pC17KP0020-1, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

71. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP041949 (Klebsiella pneumoniae strain KP2 plasmid pKP2_3, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

72. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to CP052218 (Klebsiella pneumoniae strain E17KP0053 plasmid pE17KP0053-1, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

73. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP036337 (Klebsiella pneumoniae strain BP327 plasmid pIncFIBK, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

74. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP039809 (Klebsiella pneumoniae strain C2660 plasmid pC2660-2, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

75. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP033402 (Klebsiella pneumoniae strain WCHKP115069 plasmid p1_115069, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

76. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP029387 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pTetD_040074, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

77. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_LR025093 (Klebsiella pneumoniae isolate KP9201 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

78. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_CP042883 (Klebsiella pneumoniae strain NMBU-W07E18 plasmid pNMBU-W07E18_01, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

79. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to CP052435 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-1, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

80. spacer 1.1|272493|35|NZ_CP040887|CRISPRCasFinder matches to NZ_LT994840 (Klebsiella pneumoniae isolate CNR48 plasmid CNR48, complete sequence) position: , mismatch: 9, identity: 0.743

gggcgacgattcgccggtcgggcgcgggtggcgcg-	CRISPR spacer
gggcgtcgattcgctggtcgggcgc-aacgacctgc	Protospacer
***** ********.********** ...*.* .*

81. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 9, identity: 0.71

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
cgaggcgccggcgctgaccgctgacgagacg	Protospacer
   ***********.*.********** .

82. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.71

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ccgcactccggcgccggcggctgacgacgag	Protospacer
 .  .* *********** **********.

83. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.71

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ccgcactccggcgccggcggctgacgacgag	Protospacer
 .  .* *********** **********.

84. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 9, identity: 0.71

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
cgaggcgccggcgctgaccgctgacgagacg	Protospacer
   ***********.*.********** .

85. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 10, identity: 0.677

gtcggcgccggcgccggccgctgacgacggc------	CRISPR spacer
-----cgcc-gcgtcggccgccggcgccggcgccacg	Protospacer
     **** ***.*******.*.** ****

86. spacer 3.2|2513085|31|NZ_CP040887|CRISPRCasFinder matches to KJ028219 (Mycobacterium phage 32HC, complete genome) position: , mismatch: 10, identity: 0.677

gtcggcgccggcgccggccgctgacgacggc	CRISPR spacer
ccgggcgccggcgccggccggtgtcgttcaa	Protospacer
 . ***************** ** ** . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2605334 : 2617086

Staphylococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139722234.1\|2605334_2606225_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-18	28.9
WP_139722235.1\|2606221_2607817_+	ABC transporter permease	NA	NA	NA	NA
WP_139722236.1\|2607844_2608783_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	2.5e-35	32.0
WP_139722237.1\|2609032_2609494_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.7e-16	40.4
WP_139722238.1\|2609490_2610807_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	4.2e-73	39.8
WP_139722239.1\|2610803_2611403_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.3e-16	36.3
WP_139723117.1\|2611403_2612492_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.0e-27	29.5
WP_139722240.1\|2612945_2614625_+	helicase-associated domain-containing protein	B2CRJ8	Acidianus_filamentous_virus	3.3e-14	22.1
WP_058890526.1\|2614870_2615578_+	response regulator transcription factor	W8CYM9	Bacillus_phage	8.7e-33	35.7
WP_139722241.1\|2615595_2617086_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.0e-19	26.6

DBSCAN-SWA_2

2660152 : 2688376

Bacteriophage(50.0%)

tail,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139722276.1\|2660152_2661367_-\|tail	lamin tail domain-containing protein	NA	NA	NA	NA
WP_139722277.1\|2661681_2662671_+	hypothetical protein	NA	NA	NA	NA
WP_139722278.1\|2662749_2663544_+	sortase	NA	NA	NA	NA
WP_139722279.1\|2663805_2664240_-	hypothetical protein	NA	NA	NA	NA
WP_139722280.1\|2664286_2664499_-	HVA1 family protein	A0A1L2BWQ1	Bacteriophage	2.1e-06	42.9
WP_058890496.1\|2664571_2664796_-	hypothetical protein	NA	NA	NA	NA
WP_058890495.1\|2664881_2665274_-	hypothetical protein	NA	NA	NA	NA
WP_083518715.1\|2665297_2666143_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_139722281.1\|2666509_2667313_+	hypothetical protein	NA	NA	NA	NA
WP_139722282.1\|2667422_2667938_-	hypothetical protein	NA	NA	NA	NA
WP_139722283.1\|2668053_2668758_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_139722284.1\|2668822_2669224_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_158296774.1\|2670651_2671452_-	hypothetical protein	NA	NA	NA	NA
WP_139722285.1\|2671543_2672113_-	SRPBCC family protein	NA	NA	NA	NA
WP_139723122.1\|2672424_2673774_+	DUF2252 family protein	NA	NA	NA	NA
WP_139722286.1\|2673880_2674957_+	DUF4232 domain-containing protein	NA	NA	NA	NA
WP_139722287.1\|2674963_2675821_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158296775.1\|2675813_2676749_+	serine hydrolase	NA	NA	NA	NA
WP_139722289.1\|2676805_2678725_+	penicillin-binding protein	NA	NA	NA	NA
WP_139722290.1\|2678889_2679666_-	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_139722291.1\|2679909_2680770_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_139722292.1\|2680902_2681709_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_139722293.1\|2681749_2682241_-	hypothetical protein	NA	NA	NA	NA
WP_139723123.1\|2682336_2683305_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_139722294.1\|2683491_2684166_+	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_139722295.1\|2684527_2685754_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	7.6e-109	53.0
WP_170215648.1\|2685761_2686409_+	hypothetical protein	NA	NA	NA	NA
WP_139722296.1\|2686494_2686794_+	hypothetical protein	NA	NA	NA	NA
WP_139722297.1\|2687087_2687636_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_170215578.1\|2687632_2688376_+\|transposase	ISL3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040887

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection