CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040878	Enterococcus faecium strain HB-1 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,cas14j,DinG	0	0	4	0
NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	1 crisprs	DEDDh,csa3	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040878_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040878_1

1888733-1888822

Orphan

Consensus_repeat	Method
TGCAGCAGAGACAACACCTTCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040878_1

>merge|NZ_CP040878|1|1888733-1888822|CRISPRCasFinder
TGCAGCAGAGACAACACCTTCTTCTTCAAGTGACACAACTTATCAAGCAGGGGATTCAAGCAGCAATGCAGCAGAAACAACACCTTCTTC

>NZ_CP040878|1|1|1888733-1888822|CRISPRCasFinder
TGCAGCAGAGACAACACCTTCTTC	TTCAAGTGACACAACTTATCAAGCAGGGGATTCAAGCAGCAA
TGCAGCAGAAACAACACCTTCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040878.1\|WP_002290166.1\|1880467_1881079_+\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|226129
NZ_CP040878.1\|WP_002290165.1\|1879421_1880138_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
NZ_CP040878.1\|WP_002290171.1\|1885607_1885829_-\|ferredoxin	unknown	unknown	gnl\|CDD\|224064
NZ_CP040878.1\|WP_002290178.1\|1892809_1893085_+\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|259853
NZ_CP040878.1\|WP_002329098.1\|1883212_1884553_+\|Sapep-family-Mn(2+)-dependent-dipeptidase	unknown	unknown	gnl\|CDD\|235965
NZ_CP040878.1\|WP_086322632.1\|1894366_1895626_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP040878.1\|WP_139439800.1\|1886877_1888281_+\|RecQ-family-ATP-dependent-DNA-helicase	unknown	unknown	gnl\|CDD\|223588
NZ_CP040878.1\|WP_002290172.1\|1885859_1886891_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227291
NZ_CP040878.1\|WP_002290177.1\|1891256_1892567_+\|ribosome-biogenesis-GTPase-Der	unknown	unknown	gnl\|CDD\|234628
NZ_CP040878.1\|WP_002290182.1\|1895631_1896213_+\|IDEAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|235145
NZ_CP040878.1\|WP_002290183.1\|1896290_1897166_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP040878.1\|WP_002290184.1\|1897313_1897646_+\|nucleotide-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|212138
NZ_CP040878.1\|WP_002290168.1\|1881456_1882980_+\|YfcC-family-protein	unknown	unknown	gnl\|CDD\|224207
NZ_CP040878.1\|WP_002290186.1\|1897757_1898966_+\|CCA-tRNA-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|237339
NZ_CP040878.1\|WP_002329099.1\|1884707_1885445_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|315383
NZ_CP040878.1\|WP_002290175.1\|1889030_1889711_+\|(d)CMP-kinase	unknown	unknown	gnl\|CDD\|234579
NZ_CP040878.1\|WP_002329100.1\|1893318_1894365_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040878.1\|WP_002290163.1\|1878845_1879421_+\|SMC-Scp-complex-subunit-ScpB	unknown	unknown	gnl\|CDD\|234657
NZ_CP040878.1\|WP_033607403.1\|1878100_1878862_+\|segregation/condensation-protein-A	unknown	unknown	gnl\|CDD\|234635
NZ_CP040878.1\|WP_002290176.1\|1889845_1891075_+\|30S-ribosomal-protein-S1	unknown	unknown	gnl\|CDD\|235851

Protein	Function_ID	Function_description	E-value
NZ_CP040878.1\|WP_002290166.1\|1880467_1881079_+\|ECF-transporter-S-component	gnl\|CDD\|226129	COG3601, COG3601, Predicted membrane protein [Function unknown].	6.58474e-38
NZ_CP040878.1\|WP_002290165.1\|1879421_1880138_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	2.08813e-102
NZ_CP040878.1\|WP_002290171.1\|1885607_1885829_-\|ferredoxin	gnl\|CDD\|224064	COG1141, Fer, Ferredoxin [Energy production and conversion].	6.56945e-13
NZ_CP040878.1\|WP_002290178.1\|1892809_1893085_+\|HU-family-DNA-binding-protein	gnl\|CDD\|259853	cd13831, HU, histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.	9.29619e-47
NZ_CP040878.1\|WP_002329098.1\|1883212_1884553_+\|Sapep-family-Mn(2+)-dependent-dipeptidase	gnl\|CDD\|235965	PRK07205, PRK07205, hypothetical protein; Provisional.	0
NZ_CP040878.1\|WP_086322632.1\|1894366_1895626_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.17817e-14
NZ_CP040878.1\|WP_139439800.1\|1886877_1888281_+\|RecQ-family-ATP-dependent-DNA-helicase	gnl\|CDD\|223588	COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair].	2.17017e-155
NZ_CP040878.1\|WP_002290172.1\|1885859_1886891_+\|hypothetical-protein	gnl\|CDD\|227291	COG4955, COG4955, Uncharacterized protein conserved in bacteria [Function unknown].	2.37645e-23
NZ_CP040878.1\|WP_002290177.1\|1891256_1892567_+\|ribosome-biogenesis-GTPase-Der	gnl\|CDD\|234628	PRK00093, PRK00093, GTP-binding protein Der; Reviewed.	0
NZ_CP040878.1\|WP_002290182.1\|1895631_1896213_+\|IDEAL-domain-containing-protein	gnl\|CDD\|235145	PRK03636, PRK03636, hypothetical protein; Provisional.	7.36578e-61
NZ_CP040878.1\|WP_002290183.1\|1896290_1897166_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	1.79192e-87
NZ_CP040878.1\|WP_002290184.1\|1897313_1897646_+\|nucleotide-pyrophosphohydrolase	gnl\|CDD\|212138	cd11531, NTP-PPase_BsYpjD, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain putative pyrophosphatase YpjD from Bacillus subtilis and its bacterial homologs. This family includes a putative pyrophosphatase Ypjd from Bacillus subtilis (BsYpjD) and its homologs. Although its biological role has not been described in detail, BsYpjD shows significant sequence similarity to the dimeric 2-deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTP pyrophosphatase or dUTPase) and NTP-PPase MazG proteins. However, unlike typical tandem-domain MazG proteins, BsYpjD contains a single MazG-like domain.	4.05407e-43
NZ_CP040878.1\|WP_002290168.1\|1881456_1882980_+\|YfcC-family-protein	gnl\|CDD\|224207	COG1288, COG1288, Predicted membrane protein [Function unknown].	6.5543e-165
NZ_CP040878.1\|WP_002290186.1\|1897757_1898966_+\|CCA-tRNA-nucleotidyltransferase	gnl\|CDD\|237339	PRK13299, PRK13299, tRNA CCA-pyrophosphorylase; Provisional.	0
NZ_CP040878.1\|WP_002329099.1\|1884707_1885445_+\|alpha/beta-hydrolase	gnl\|CDD\|315383	pfam12695, Abhydrolase_5, Alpha/beta hydrolase family. This family contains a diverse range of alpha/beta hydrolase enzymes.	5.51729e-73
NZ_CP040878.1\|WP_002290175.1\|1889030_1889711_+\|(d)CMP-kinase	gnl\|CDD\|234579	PRK00023, cmk, (d)CMP kinase.	1.88287e-117
NZ_CP040878.1\|WP_002290163.1\|1878845_1879421_+\|SMC-Scp-complex-subunit-ScpB	gnl\|CDD\|234657	PRK00135, scpB, segregation and condensation protein B; Reviewed.	6.37121e-67
NZ_CP040878.1\|WP_033607403.1\|1878100_1878862_+\|segregation/condensation-protein-A	gnl\|CDD\|234635	PRK00104, scpA, segregation and condensation protein A; Reviewed.	1.94027e-90
NZ_CP040878.1\|WP_002290176.1\|1889845_1891075_+\|30S-ribosomal-protein-S1	gnl\|CDD\|235851	PRK06676, rpsA, 30S ribosomal protein S1; Reviewed.	0

>NZ_CP040878.1|WP_139439800.1|1886877_1888281_+|RecQ-family-ATP-dependent-DNA-helicase
MLINELKKYFGFDSFRPGQEEIIQALLDGEDTLAILPTGTGKSLCYQLTGYLTDGMVLIVSPLLSLMEDQVTQLQKRGEKRVAAFNSLLSRAERGYVLRHLSQYKFLFLSPEMLTNPSLLEQLKKQDIALYVVDEAHCVSQWGVDFRPEYQQLGKIREHLGNPVTLALTATATDLVAKDIRQVLFDRQPKEVRQSVNRQNISLFVRKTQQKEQELEQFMESAHGAAIIYCATKKEVERLYHLFRERFSVGYYHGGLDTAQRRQLQQQFVKNQLQFLIATNAFGMGIDKSDIRYVIHYDLPDSLENYVQEIGRAGRDQEESAAILLYQSGDERIHYFFNQLSREQRQSFELYLEYAAEQAPFDELQKKWMELIQQSEKPENWVERLKRQEKEKEFRLQQMLRYIHEEDCCRKFILAYFGEELSKKPQNCCDIDGAKVELLPKKKAFSKTEPLHWESILLNLFKKNMEH
>NZ_CP040878.1|WP_002290172.1|1885859_1886891_+|hypothetical-protein
MIVFILSLFSSRNKLRVSSLYQLLVGKRTTSVLIFGFTHELLFAHNSFPDLKQDKFYQIMQKLAQQGWIEINENEAKLTSAGADRLSELHTEYTGLRFDRYGRTGETSWRLIKFAVQVISNLASGNQDYLPAETSPFYTFQLKKWLSGSRLPRGILIDSAYESLAQLFSEIPEGAANFLANQFSGNDRTGLLPYQLAKTNDEAAVYLQQSRCIHLLLAQIEERPDSLWYVLIDPLLQQNFNQSMMITKQMFMNGQTIDQIMAIRHLKKGTVTDHLIEWALFFDDFPYERVLSQETVERLEPNKDSVREWRFSEWNVDGQLDYGEFRLYQIYLLRKEAIQNVNK
>NZ_CP040878.1|WP_002290171.1|1885607_1885829_-|ferredoxin
MSLLCKLVPERCIACGLCQIEAPDIFDYDEEGIVLFAQEPEAHQQFVMPEEEAYVRKAYQKCPVRAILLENKM
>NZ_CP040878.1|WP_002329099.1|1884707_1885445_+|alpha/beta-hydrolase
MKIFRRILIGLVIILGLLGGGGYYYIQQNTYEPSSEAQKVVKEGRNKEDYLFFEGEKKNQAKSPLLIFYPGALVEPESYSIWAQDLAKNGYSVAIVKMPLDLAVIGGNKADKIKEDFPDSDYVIGGHSLGGVMASRYANKNHSDSHLKGVFFMASYPDKKGTLKESAVPVLSITATKDKVLNQKAYEEAKQYLPERTEYVSINGGNHGGFGSYGEQKGDGEAEISNADQQTVIVNTLENWLKKLK
>NZ_CP040878.1|WP_002329098.1|1883212_1884553_+|Sapep-family-Mn(2+)-dependent-dipeptidase
MKQFVTEQHHEQALESLSELIRIPSVLDEADSGQGHPFGKKVIEALDKVLEISEKLGFRTFKDPEGYYGYSEIGSGDELFGILCHMDVVPAGDENNWETKPFDPTVKEGWLVGRGSQDDKGPSIAAMYAVKALMDAGVEFKTRIRFIFGTDEENLWRCLEKYNEKEEGITQGFAPDAEFPLIYAEKGLLQAYLTGPGTNDFSVKAGGALNVVPDAAPYSGEKISEVKEALKKHGFDFEEQGEGIVVLGKSIHAKDAAQGVNAISRLAIALSEVFDFGPINFLGKLVQENATGEAVVGKTEDEQSGELTMNFASLEITPEQTKIGVDMRIPVTFKKEDLVAKLTKTVEKYELSYEEFDFLDSLYVPLDSELVKNLLGTYREITGDMTEPFVSGGATFARTMNQCVAFGAMFPDTPDFMHQANERWELSSMYKAMEIYAEAVYRLCAK
>NZ_CP040878.1|WP_002290168.1|1881456_1882980_+|YfcC-family-protein
MEQTKKKKFQMPSAYTVLFIIIAVIAVLTWFIPAGHYSVDDAGNIVAGSYERVQQNPQGLWDIFMAPINGMLGVPAGELTKETPAAIPISFFILVVGGFLGIINKTGALDAGIASVVKKFKGKEKMLIPVLMLLFALGGSTYGMAEETIPFYALLIPVMMAVGFDTVVAVAIVLVGSQVGCLASTVNPFATGVASQAVGISMGEGIGLRFLMFVILLAISIVYVYRYASKIEKDPTKSLVYNQRKEDMKHFDIEAIGRQEVITKKQKHVNVLFFITFGIMIISLIPWTTLNANFTIFESLTNWLTNLPVLGTVLGKSMLPLGDWYFPEITMLFLVMSIVVAITYGMKESEFVSEFLAGASDLIGVAIVVAVARGIQVVMNNGLITDTILHWGEQGLSSLSSSVFIIITFIFYIPMSFLIPSTSGLAAATMGIMGPMGEFAGVGKDLVITAYQSASGLVNLITPTSAIVMGAVAIARFDVSVWWKFTGKLIAILFVAICVILGVAAMF
>NZ_CP040878.1|WP_002290166.1|1880467_1881079_+|ECF-transporter-S-component
MKNTRVQKMVAVAMFAAIALVLQYFAFPIMPAFSFLKIDFSDIPVLISMFLFGPAAGVATAFLRSVLHLLTTGFSPDNLVGDTASFLSTTIFTFPIYYFFSVKKQHKGRNKFLGVITGTIALTIFMSIANYFVITPLYLMFLGLNATQMLGMSLANYVLIGIVPFNLIKGFIVSAVFLVLHAQLLPWLSRKQHQMEQRHTAVK
>NZ_CP040878.1|WP_002290165.1|1879421_1880138_+|rRNA-pseudouridine-synthase
MERLQKVIAHAGITSRRKAEEFILAGRVKVNGQVVRELGIKVGKQDTVEVDEVPIYQEEYGYYLLYKPKGVISAVADDKGRKVVTDLLPMVKERIYPVGRLDYDTSGILLLTNDGDFAQRLTHPKHEVDKVYVAKVKGIATKSMLAPLAKGIKIEGRKTSPAKFQILSVDPKTNHSIVELTIHEGRNHQVKNMLQAVGLPVQKLKREKYGDLTLQGLRPGDYRELNKKEVSSLLNHSK
>NZ_CP040878.1|WP_002290163.1|1878845_1879421_+|SMC-Scp-complex-subunit-ScpB
MTKLSELEALLFIVGEEGISNEELSGLLNLSEAEVANLVKELKDSYAQNPHSALHIFETESHYVLTTKKELAPLLKRYAQGTSNTLSQAAVETLAIIAYKQPITRAEIEQIRGVQVSGAVQRLAAHKLIEEKGRVEGPGRPILYGTTGYFLDYFGLKSLEELPDTQEMEISLEEDVSPDLFFDGMNKGEQL
>NZ_CP040878.1|WP_033607403.1|1878100_1878862_+|segregation/condensation-protein-A
MTEINIKLDVFEGPLDLLLHLIQQMEIDIYDIPIAMITEQYMNYIHTMKTLELAVAGEYLVMAATLMAIKSKTLLPIQEFITDDEELWEEDPREELVTQLLEYRKYKYAAEKLTEKAEERSLYYTKDPMNIDGLADVEKPLKRGQVKKIDLIRAMQKILERKKFSQKVEKTITPDDTTIEERMIFIEERIKRNTHGCTFDSFFESPSKSEVVTTFMALLELMKKGQIIAQQKENYESIMLYPAVGDTEHDEIK
>NZ_CP040878.1|WP_002290175.1|1889030_1889711_+|(d)CMP-kinase
MTQISIAIDGPASSGKSTVAKILAKELNYIYTDTGAMYRAVTYLAITNNVSFSDEEGLVSLIKKYPISFSQQEDGQHVFTASKDVTQEIRQPDVTKAVSEVSAHGKVREELVAIQRKIGERGGVVMDGRDIGTAVLPNAEVKIFLVASVSERAERRFKENQEKGIPTDLETLTKEIQARDHYDSTREVSPLQQAEDAVRIDTTGKSIPEVVAAIKAVVLEKGYLLF
>NZ_CP040878.1|WP_002290176.1|1889845_1891075_+|30S-ribosomal-protein-S1
MTEFDQNQENNQSMEDAMKSVQEVKVGDVVKGEVLVIEDKQVIVGIEGAGVEGVVPAKELSTLPVEDINEVVKVGDVLDLVVISTIGKDKENGSYLLSKRRLDAKKVWEDIERDFQDGKVIEAPVTNVVKGGLVVDVGVRGFVPASMVEDHFVADFSDYKGKTLSFKIIEIEPSENRLILSHKAVVENEREEKKKEILSTIHEGDVLSGRVARLTDFGAFVDLGGIDGLVHVSEISHSHVAKPSDVLAVNDEVNVKVLSINPEQERVSLSIKDTQPGPWSEIDTKAPVGAVLDGTVKRLTSFGAFVEVFPGVEGLVHISQISHKHIATPHEVLHEGDEVKVKVLEIHPEEHRIALSIKALEEKPASEEEPKNVESYELPEENTGFTMGDILGDALKEEVEEKATDDSEK
>NZ_CP040878.1|WP_002290177.1|1891256_1892567_+|ribosome-biogenesis-GTPase-Der
MANPTIAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYAKGEWLGREFSVIDTGGIDLGDEPFMDQIKHQAEIAIEEADVIICVVSGREGVTDADEMVAKILYRSNKPVILAVNKVDNPEMRNDIYEFYSLGLGDPYPVSGSHGLGIGDILDEAVKYFSEETEEEDDDTIKFSLIGRPNVGKSSLINAILGEERVIVSDIEGTTRDAIDTHFVSESGQKFLMIDTAGMRKRGKVYENTEKYSVMRAMRAIDRSDIVLMVLNAEEGIREQDKRVAGYAHEAGRGVIIVVNKWDLVKKETNTMRDFEQEIRDEFRYLDYAPIVFVSAVTKQRLERLPEMIEQVSMNQNLRISSAVLNDIIMDAVAINPTPTDKGKRLKIFYATQVAVKPPTFVVFVNEEELMHFSYERFLENQIRKAFTFEGTSIRIIPRRRK
>NZ_CP040878.1|WP_002290178.1|1892809_1893085_+|HU-family-DNA-binding-protein
MANKAELIEKVASATDLTKKDATAAVDAVFSTIQDALANGEKVQLIGFGNFEVRERAARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVK
>NZ_CP040878.1|WP_002329100.1|1893318_1894365_+|hypothetical-protein
MELDYQVEEALTKVFYGETLVNQLRALSIDQPILFLTNQRYYDLFADKINPLFANQANNDWYICANTQCNHLTELKNLLDFTKRYPENQSMFVIGFGNEGIMDLAGFFQKHTILDSSLWLIPVSIRSLSRALTPQRTILQLPNRVVLQTINMPERIVYDQTISERQVDGKQIDFLTFICCGMICDHRFLQNLYKNYPNKKQLTTRPFAGMIEEMIYFYQLEAENLSNYGKLFEQAFYLTENGHLLSASMKKFLGMMFHFVWNLQAYPFDFQLKNFFVWLDLLGYPIQWLEQISKMEYLEKVLFLAGKSKKILVLEKIGIIDGYQRPNEKELLRTMTVFQQIVSEIRGN
>NZ_CP040878.1|WP_086322632.1|1894366_1895626_+|tetratricopeptide-repeat-protein
MNTNSEKMLQALSDEDLAQAQLFLEKALKEDPADILAELGEELLAIGFLIEAKQIFEQLINQYPENDGLNIPLAEIAIEDNEIDLAFEYLEKVDKESDYYPQSLLAIADLYQVIGIPEVSEAKLKEAAGLLPDEPLIQFALAELYFSVDRFKEAAVIYETLLASGINEMSGISMQERLGQSLSMQGEFEAAIAPLEEALKEEKTDDRLFQLAFTNLQLKENQQAINYLEELREVNPHYQSLYLYLGQALQEEEMVEEAQTVLEEGIKENPYQVELYHLASENAFRLHDKQRAEELLLKALEVGDKQDETLLTLSNLYLDDERYEDVIQVINQMEETDNPYAEWNLAHAYNELEDFTVAAVHYEQAYHELSHEPDFLKEYAFFLREEGQLKRAQELLTHYLKLEPGDMEALSLLDDLTER
>NZ_CP040878.1|WP_002290182.1|1895631_1896213_+|IDEAL-domain-containing-protein
MLIDVREKKNFLTWMVNHVSFSRREVFWVLNYLANHEAILSNVHFVEGANFADRGLQISDLSVEGEPMKLFLQGKEFTDTDQIFHEIRLNWKKPLYVECLFENAWQTREYLSILEDNPFSSWDASVSEEDTELIERYFQEKEEAAKLNMLYAQIDQALEDGDRDAFLKLSDEVNRKILLQTQKKNNRVSEHNN
>NZ_CP040878.1|WP_002290183.1|1896290_1897166_-|YitT-family-protein
MATRKTVKEVLFIIIGTSIYAFGLVYLNIANHLAEGGVSGITLILRALFGIDPAYTTLLINIPLILLGGKILGKRSLAYTVLGTLSLSFFLWIWQRVPLEINLQHDLLIVSLLAGLVAGVGSGIVYRMGGTTGGSDIIARILEQNYGISMGRSLLAFDIIVLLASLTYIDLKRMMYTLIVSYVFSRVIDSILDGGYSAKGLLVVSNKSEEIAPLLMTGLQRGVTFLSGEGAFSGNSKKIIYMVVSSSELTEAKRIVHEIDEKAFLSIINVHEVEGQGFTYLKPQTRLLKKR
>NZ_CP040878.1|WP_002290184.1|1897313_1897646_+|nucleotide-pyrophosphohydrolase
MDEKRSLYSMQQEVDGYIQQFKVGYFSPLAQLARLTEEVGELAREVNHTYGEKSKKASEPDNSVAEELGDVLFVTMIMANSLNIDLTDVFEKNMEKFNHRDHNRFERKDK
>NZ_CP040878.1|WP_002290186.1|1897757_1898966_+|CCA-tRNA-nucleotidyltransferase
MKLKQLPLEYQKAIPVLKKLENAGYEAYFVGGSVRDILLNQPIHDVDIATSAFPEEIKQLFPKTIDIGIEHGTVLVLENDEQYEITTFRTESTYQDYRRPDHVEFVRSLEEDLKRRDFTINAFALKEDGEIIDLFDGLQDLEEQILRAVGNPHERFHEDALRMMRGLRFVSQLGFKLEEETFYAIKENHELLSKISVERINVEFIKMLLGNERSAGIHAFIETECYICCPGLREEGEALLRFAELPSVPLKEESQAWTLLISQLDLKENEIRSFLKSWKCSNQMIKDVQALVQGLRQRETGVLEPFELYFLGKEHALQVEELMTYFDETPQMDVVEESYDRLPIKSLSELAVDGKILLEESGKKPGKWVSEALQSAEKAVVEQRIENDKKQVLDFLSKEKLI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

540 : 27954

Enterococcus_phage(40.74%)

tail,integrase,portal,capsid,head,terminase

attL 6552:6566|attR 28184:28198

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086322650.1\|540_1323_-\|tail	phage tail protein	D7RWD9	Brochothrix_phage	5.8e-54	43.1
WP_086322608.1\|1340_4460_-\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	2.9e-165	78.2
WP_002318903.1\|4476_4764_-	hypothetical protein	D7RWD7	Brochothrix_phage	2.4e-13	44.3
WP_002323702.1\|5230_5743_-\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	7.4e-58	66.3
WP_025479159.1\|5753_6146_-	hypothetical protein	Q77K20	Lactococcus_phage	1.5e-47	73.8
WP_002349652.1\|6145_6484_-	HK97 gp10 family phage protein	Q77K21	Lactococcus_phage	8.7e-31	58.9
WP_002293014.1\|6467_6794_-	hypothetical protein	C9E2J7	Enterococcus_phage	1.2e-37	70.2
6552:6566	attL	NA	NA	NA	NA
WP_081139786.1\|6790_7120_-	hypothetical protein	A0A0S2MYD5	Enterococcus_phage	1.9e-38	74.5
WP_002322710.1\|7131_7395_-	hypothetical protein	D2J062	Enterococcus_phage	5.0e-10	72.9
WP_081139784.1\|7412_8336_-\|capsid	phage major capsid protein	A0A1B1V000	Enterococcus_phage	3.1e-139	77.2
WP_081139782.1\|8348_8951_-	DUF4355 domain-containing protein	A0A097BY91	Enterococcus_phage	2.7e-35	50.2
WP_081139780.1\|9078_10005_-\|head	phage head morphogenesis protein	A0A1L2JXH2	Streptococcus_phage	1.3e-92	58.7
WP_081139777.1\|10009_11509_-\|portal	phage portal protein	A0A097BY86	Enterococcus_phage	1.9e-223	79.8
WP_081139775.1\|11521_12766_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.1e-200	81.4
WP_002342959.1\|12752_13286_-\|terminase	terminase small subunit	A0A059NT97	Lactococcus_phage	9.2e-19	40.7
WP_081139773.1\|13312_13537_-	hypothetical protein	NA	NA	NA	NA
WP_025479156.1\|13784_14234_-	hypothetical protein	NA	NA	NA	NA
WP_002323918.1\|14262_15183_-	hypothetical protein	NA	NA	NA	NA
WP_086322607.1\|15557_15974_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-46	68.1
WP_010722193.1\|16216_16516_-	hypothetical protein	NA	NA	NA	NA
WP_086322606.1\|16512_16734_-	hypothetical protein	NA	NA	NA	NA
WP_002335859.1\|16734_17046_-	hypothetical protein	D2IZY1	Enterococcus_phage	5.3e-35	73.7
WP_086322605.1\|17222_17537_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	1.7e-09	36.4
WP_086322604.1\|17536_17842_-	hypothetical protein	NA	NA	NA	NA
WP_010725027.1\|17838_18000_-	hypothetical protein	NA	NA	NA	NA
WP_073441489.1\|18014_18374_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	1.1e-18	49.2
WP_086322603.1\|18370_19222_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	8.1e-25	28.7
WP_002342029.1\|19239_20073_-	hypothetical protein	J7KBV5	Streptococcus_phage	1.7e-48	75.4
WP_086322602.1\|20079_20766_-	hypothetical protein	C9E2N1	Enterococcus_phage	2.9e-89	70.0
WP_010738857.1\|20771_21443_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	5.5e-29	47.8
WP_086322601.1\|21435_21777_-	hypothetical protein	NA	NA	NA	NA
WP_139439761.1\|21955_22654_-	phage regulatory protein	D2IYT0	Enterococcus_phage	2.3e-25	33.8
WP_086322599.1\|22708_23374_+	hypothetical protein	NA	NA	NA	NA
WP_002337281.1\|23654_23882_-	hypothetical protein	NA	NA	NA	NA
WP_002337282.1\|23894_24080_-	helix-turn-helix transcriptional regulator	Q5YAA3	Bacillus_phage	5.4e-11	53.3
WP_002315392.1\|24383_24758_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7
WP_086322598.1\|24762_25191_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002293175.1\|25240_25894_+	hypothetical protein	NA	NA	NA	NA
WP_047929334.1\|26027_26699_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_086322597.1\|26811_27954_+\|integrase	site-specific integrase	M1PRU8	Streptococcus_phage	1.4e-56	37.2
28184:28198	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1595814 : 1604286

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002292339.1\|1595814_1596459_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|1596473_1596803_+	hypothetical protein	NA	NA	NA	NA
WP_002292342.1\|1596816_1597755_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.1e-34	33.8
WP_002292343.1\|1597790_1598615_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|1598607_1598955_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002292345.1\|1599023_1599896_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-89	60.1
WP_002310241.1\|1600004_1601126_+	DNA polymerase IV	NA	NA	NA	NA
WP_002292348.1\|1601179_1601782_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	4.9e-53	58.0
WP_099107999.1\|1601799_1602003_-	hypothetical protein	NA	NA	NA	NA
WP_002292349.1\|1602096_1604286_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	6.8e-286	66.7

DBSCAN-SWA_3

2304221 : 2327075

Lactobacillus_phage(28.57%)

terminase,tail,plate,portal,capsid,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326206.1\|2304221_2305163_-	Abi family protein	A0A059NT88	Lactococcus_phage	1.2e-77	45.5
WP_139439809.1\|2305487_2306507_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	8.4e-61	67.2
WP_002346371.1\|2306517_2306715_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	1.0e-23	87.5
WP_002315346.1\|2306738_2307032_-	hypothetical protein	NA	NA	NA	NA
WP_002290625.1\|2307069_2307207_-	XkdX family protein	NA	NA	NA	NA
WP_139439810.1\|2307208_2307655_-	hypothetical protein	NA	NA	NA	NA
WP_139439811.1\|2307666_2309799_-\|plate	BppU family phage baseplate upper protein	A0A249XZH9	Enterococcus_phage	7.0e-102	54.5
WP_139439812.1\|2309798_2310848_-	hypothetical protein	Q9T1A4	Listeria_phage	5.1e-21	32.7
WP_139439813.1\|2310848_2311868_-	hypothetical protein	Q9T1A5	Listeria_phage	3.4e-102	54.7
WP_139439814.1\|2311876_2312704_-\|tail	phage tail family protein	Q9T1A6	Listeria_phage	3.4e-52	42.8
WP_139439815.1\|2312693_2317175_-	tape measure protein	A0A0M5M3L4	Enterococcus_phage	8.1e-108	32.2
WP_139439816.1\|2317187_2317808_-	hypothetical protein	O03936	Lactobacillus_phage	2.5e-36	42.9
WP_139439817.1\|2317812_2318247_-	hypothetical protein	NA	NA	NA	NA
WP_139439843.1\|2318306_2318603_-	Ig domain-containing protein	A0A1P8BL30	Lactococcus_phage	2.0e-15	61.4
WP_139439818.1\|2318563_2319031_-\|capsid	capsid protein	O03972	Lactobacillus_phage	1.7e-45	64.8
WP_016629363.1\|2319043_2319436_-	hypothetical protein	Q5YA65	Bacillus_phage	1.1e-29	47.3
WP_002314914.1\|2319435_2319771_-	hypothetical protein	U3PIU9	Lactobacillus_phage	2.0e-19	57.3
WP_139439819.1\|2319770_2320118_-\|capsid	capsid protein	O03932	Lactobacillus_phage	3.1e-31	54.5
WP_104875939.1\|2320114_2320510_-	hypothetical protein	NA	NA	NA	NA
WP_139439820.1\|2320548_2320794_-	Ig domain-containing protein	A5GYM0	Lactococcus_phage	2.8e-15	65.8
WP_139439821.1\|2320811_2321684_-	hypothetical protein	Q6SED2	Lactobacillus_prophage	4.0e-104	64.9
WP_139439822.1\|2321702_2322278_-\|capsid	capsid protein	Q9T1B8	Listeria_phage	3.1e-28	46.2
WP_139439823.1\|2322387_2323524_-\|capsid	capsid protein	O03929	Lactobacillus_phage	2.3e-91	53.8
WP_139439824.1\|2323526_2325080_-\|portal	phage portal protein	O03928	Lactobacillus_phage	1.2e-151	54.9
WP_139439844.1\|2325073_2326399_-\|terminase	PBSX family phage terminase large subunit	A4L7R3	Lactococcus_phage	9.6e-158	59.3
WP_139439825.1\|2326364_2327075_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.9e-43	45.9

DBSCAN-SWA_4

2549456 : 2604895

Enterococcus_phage(31.71%)

transposase,terminase,tail,plate,portal,capsid,head,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087628202.1\|2549456_2550619_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002290431.1\|2550752_2550938_-	hypothetical protein	NA	NA	NA	NA
WP_002290430.1\|2550954_2551185_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002290426.1\|2551181_2551736_-	hypothetical protein	NA	NA	NA	NA
WP_002290423.1\|2551949_2552201_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002290421.1\|2552364_2552745_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	2.8e-17	34.9
WP_002290420.1\|2552751_2553180_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002329377.1\|2553244_2553913_+	hypothetical protein	Q9AZW5	Lactococcus_phage	2.0e-39	50.3
WP_002290415.1\|2555394_2556741_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002329378.1\|2556852_2558202_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002329379.1\|2558318_2559572_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	4.5e-24	55.3
WP_002290411.1\|2559642_2560128_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002290410.1\|2560150_2560909_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	2.5e-25	35.6
WP_002290409.1\|2560924_2562103_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	2.1e-103	49.7
WP_016628702.1\|2562331_2564452_+	LTA synthase family protein	W6LM83	Streptococcus_phage	7.5e-221	58.4
WP_002290407.1\|2564623_2565349_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_002329381.1\|2565338_2565848_+	hypothetical protein	NA	NA	NA	NA
WP_016628703.1\|2565920_2567369_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.3e-19	29.3
WP_002290404.1\|2567368_2568085_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.1e-34	36.2
WP_002290403.1\|2568065_2568416_-	SdpI family protein	NA	NA	NA	NA
WP_002290402.1\|2568559_2569333_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_081125522.1\|2570090_2570393_+	hypothetical protein	NA	NA	NA	NA
WP_086322616.1\|2571208_2572579_-	hypothetical protein	V5UQY6	Oenococcus_phage	2.7e-06	20.9
WP_139439839.1\|2572697_2573672_-	N-acetylmuramoyl-L-alanine amidase	A0A060AHF9	Enterococcus_phage	4.6e-125	64.8
WP_002333628.1\|2573671_2574085_-\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	1.7e-41	65.4
WP_047929315.1\|2574145_2574274_-	XkdX family protein	NA	NA	NA	NA
WP_086322614.1\|2574275_2574650_-	hypothetical protein	NA	NA	NA	NA
WP_086322613.1\|2574673_2575225_-	hypothetical protein	NA	NA	NA	NA
WP_047929318.1\|2575224_2575593_-	hypothetical protein	NA	NA	NA	NA
WP_086322612.1\|2575597_2576386_-	hypothetical protein	NA	NA	NA	NA
WP_086322611.1\|2576385_2577294_-\|plate	phage baseplate upper protein	A0A1P8BKW9	Lactococcus_phage	7.8e-10	24.3
WP_086322610.1\|2577259_2577778_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_086322609.1\|2577788_2580677_-	hypothetical protein	D7RWE0	Brochothrix_phage	2.8e-202	45.1
WP_086322650.1\|2580676_2581459_-\|tail	phage tail protein	D7RWD9	Brochothrix_phage	5.8e-54	43.1
WP_086322608.1\|2581476_2584596_-\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	2.9e-165	78.2
WP_002318903.1\|2584612_2584900_-	hypothetical protein	D7RWD7	Brochothrix_phage	2.4e-13	44.3
WP_002293018.1\|2584953_2585322_-	hypothetical protein	Q77RZ7	Lactococcus_phage	8.6e-24	54.8
WP_002323702.1\|2585367_2585880_-\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	7.4e-58	66.3
WP_025479159.1\|2585890_2586283_-	hypothetical protein	Q77K20	Lactococcus_phage	1.5e-47	73.8
WP_002349652.1\|2586282_2586621_-	HK97 gp10 family phage protein	Q77K21	Lactococcus_phage	8.7e-31	58.9
WP_002293014.1\|2586604_2586931_-	hypothetical protein	C9E2J7	Enterococcus_phage	1.2e-37	70.2
WP_081139786.1\|2586927_2587257_-	hypothetical protein	A0A0S2MYD5	Enterococcus_phage	1.9e-38	74.5
WP_002322710.1\|2587268_2587532_-	hypothetical protein	D2J062	Enterococcus_phage	5.0e-10	72.9
WP_081139784.1\|2587549_2588473_-\|capsid	phage major capsid protein	A0A1B1V000	Enterococcus_phage	3.1e-139	77.2
WP_081139782.1\|2588485_2589088_-	DUF4355 domain-containing protein	A0A097BY91	Enterococcus_phage	2.7e-35	50.2
WP_081139780.1\|2589215_2590142_-\|head	phage head morphogenesis protein	A0A1L2JXH2	Streptococcus_phage	1.3e-92	58.7
WP_081139777.1\|2590146_2591646_-\|portal	phage portal protein	A0A097BY86	Enterococcus_phage	1.9e-223	79.8
WP_081139775.1\|2591658_2592903_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.1e-200	81.4
WP_002342959.1\|2592889_2593423_-\|terminase	terminase small subunit	A0A059NT97	Lactococcus_phage	9.2e-19	40.7
WP_081139773.1\|2593449_2593674_-	hypothetical protein	NA	NA	NA	NA
WP_025479156.1\|2593921_2594371_-	hypothetical protein	NA	NA	NA	NA
WP_002323918.1\|2594399_2595320_-	hypothetical protein	NA	NA	NA	NA
WP_086322607.1\|2595694_2596111_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-46	68.1
WP_010722193.1\|2596353_2596653_-	hypothetical protein	NA	NA	NA	NA
WP_086322606.1\|2596649_2596871_-	hypothetical protein	NA	NA	NA	NA
WP_002335859.1\|2596871_2597183_-	hypothetical protein	D2IZY1	Enterococcus_phage	5.3e-35	73.7
WP_086322605.1\|2597359_2597674_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	1.7e-09	36.4
WP_086322604.1\|2597673_2597979_-	hypothetical protein	NA	NA	NA	NA
WP_010725027.1\|2597975_2598137_-	hypothetical protein	NA	NA	NA	NA
WP_073441489.1\|2598151_2598511_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	1.1e-18	49.2
WP_086322603.1\|2598507_2599359_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	8.1e-25	28.7
WP_002342029.1\|2599376_2600210_-	hypothetical protein	J7KBV5	Streptococcus_phage	1.7e-48	75.4
WP_086322602.1\|2600216_2600903_-	hypothetical protein	C9E2N1	Enterococcus_phage	2.9e-89	70.0
WP_010738857.1\|2600908_2601580_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	5.5e-29	47.8
WP_086322601.1\|2601572_2601914_-	hypothetical protein	NA	NA	NA	NA
WP_139439761.1\|2602092_2602791_-	phage regulatory protein	D2IYT0	Enterococcus_phage	2.3e-25	33.8
WP_086322599.1\|2602845_2603511_+	hypothetical protein	NA	NA	NA	NA
WP_002337281.1\|2603791_2604019_-	hypothetical protein	NA	NA	NA	NA
WP_002337282.1\|2604031_2604217_-	helix-turn-helix transcriptional regulator	Q5YAA3	Bacillus_phage	5.4e-11	53.3
WP_002315392.1\|2604520_2604895_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP040877

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040877_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040877_1

56477-56605

Orphan

Consensus_repeat	Method
GGTATGATTTTCATACCCTCTTGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP040877_1

>merge|NZ_CP040877|1|56477-56605|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGATTTATCAACGTTTTGGCACGGTATGATTTTCATACCCTCTTGAGCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTGGGTATGATTTTCATACCCTCTGAT

>NZ_CP040877|1|1|56477-56605|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGAT	TTATCAACGTTTTGGCAC
GGTATGATTTTCATACCCTCTTGA	GCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTG
GGTATGATTTTCATACCCTCTGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040877.1\|WP_002338111.1\|59577_59895_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP040877.1\|WP_002342425.1\|48484_49240_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040877.1\|WP_128440560.1\|61216_62176_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP040877.1\|WP_002290397.1\|59322_59577_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NZ_CP040877.1\|WP_002313097.1\|49255_50008_-\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP040877.1\|WP_002297422.1\|69063_69327_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP040877.1\|WP_002311523.1\|53567_53858_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040877.1\|WP_002311521.1\|53876_54218_-\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP040877.1\|WP_002314366.1\|69326_69599_+\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|131171
NZ_CP040877.1\|WP_002342426.1\|46124_48215_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|375475
NZ_CP040877.1\|WP_002338109.1\|63540_64395_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380391
NZ_CP040877.1\|WP_010728556.1\|66743_67919_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341026
NZ_CP040877.1\|WP_002311526.1\|52051_52723_-\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP040877.1\|WP_002293489.1\|48211_48472_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040877.1\|WP_002342422.1\|64491_66741_+\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|225882
NZ_CP040877.1\|WP_002311524.1\|53142_53376_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040877.1\|WP_002322486.1\|54836_55169_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040877.1\|WP_002342424.1\|50022_51999_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP040877.1\|WP_109114464.1\|62550_63459_+\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP040877.1\|WP_002292678.1\|69675_70005_+\|AbrB-family-transcriptional-regulator	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040877.1\|WP_002338111.1\|59577_59895_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	3.11277e-05
NZ_CP040877.1\|WP_002290397.1\|59322_59577_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.45571e-07
NZ_CP040877.1\|WP_002313097.1\|49255_50008_-\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	8.18534e-61
NZ_CP040877.1\|WP_002342426.1\|46124_48215_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|375475	pfam17998, AgI_II_C2, Cell surface antigen I/II C2 terminal domain. This is the second domain (C2) located in the C-terminal region found in antigen I/II type adhesin protein AspA from S. pyogenes. Together with C3, these two domains form an elongated structure, each domain adopts the DEv-IgG fold. Similar to the classical IgG folds, it is comprised of two major antiparallel beta-sheets, designated ABED and CFG. For the C2-domain, there are two additional strands on the CFG sheet. Furthermore, sheets ABED and CFG are interconnected by several cross-connecting loops and one alpha-helix (DH1). The side chains of D982 and N996 in the C2-domain are involved in hydrogen bonding with the side chains of R1264 and N1295 in the C3 domain. Main chain hydrogen bonding can also be observed between S992 in C2 and N1189/G1191 in C3, furthermore stabilizing the interaction between the domains. The C2 domain contains one bound metal ion, modeled as Ca2+, and both the C2- and C3-domains are stabilized by conserved isopeptide bonds, which connect the beta-sheets of the central DEv-IgG motifs.Other members of this family include Major cell-surface adhesin PAc from Streptococcus mutans and SspB from Streptococcus gordonii.	1.01605e-15
NZ_CP040877.1\|WP_002314366.1\|69326_69599_+\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|131171	TIGR02116, Hypothetical_protein_Rv3358/MT3466/Mb3393., toxin-antitoxin system, toxin component, Txe/YoeB family. The Axe-Txe pair in Enterococcus faecium and the homologous YefM-YoeB pair in Escherichia coli have been shown to act as an antitoxin-toxin pair. This model describes the toxin component. Nearly every example found is next to an identifiable antitoxin, as indicated by match to models TIGR01552 and/or pfam02604. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	3.99984e-21
NZ_CP040877.1\|WP_002311521.1\|53876_54218_-\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	8.60138e-49
NZ_CP040877.1\|WP_002338109.1\|63540_64395_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380391	cd06986, cupin_MmsR-like_N, AraC/XylS family transcriptional regulators similar to MmsR, N-terminal cupin domain. This family contains bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included is MmsR, a bacterial transcriptional regulator thought to positively regulate the expression of the mmsAB operon. The mmsAB operon contains two structural genes involved in valine metabolism: mmsA which encodes methylmalonate-semialdehyde dehydrogenase, and mmsB which encodes 3-hydroxyisobutyrate dehydrogenase. The cupin domain of members of this subfamily does not contain a metal binding site.	3.18963e-42
NZ_CP040877.1\|WP_010728556.1\|66743_67919_+\|MFS-transporter	gnl\|CDD\|341026	cd17473, MFS_arabinose_efflux_permease_like, Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily. This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.22901e-45
NZ_CP040877.1\|WP_002311526.1\|52051_52723_-\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	1.18165e-44
NZ_CP040877.1\|WP_002342422.1\|64491_66741_+\|alpha-galactosidase	gnl\|CDD\|225882	COG3345, GalA, Alpha-galactosidase [Carbohydrate transport and metabolism].	0
NZ_CP040877.1\|WP_002342424.1\|50022_51999_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	3.45988e-30
NZ_CP040877.1\|WP_128440560.1\|61216_62176_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	5.612e-55
NZ_CP040877.1\|WP_002297422.1\|69063_69327_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	6.33891e-07
NZ_CP040877.1\|WP_109114464.1\|62550_63459_+\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.55641e-18

>NZ_CP040877.1|WP_002322486.1|54836_55169_-|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP040877.1|WP_002311521.1|53876_54218_-|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALNEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP040877.1|WP_002311523.1|53567_53858_-|hypothetical-protein
MKFFEVKSPYYYALIAAKNEEECAELYEQVVTDIENREEFIRCLHELNRNEAIQEDAKKISEETLQPIGMEEATKDIFTIIDEQKSCVLSIDSTLV
>NZ_CP040877.1|WP_002311524.1|53142_53376_-|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWREHNGIKDLKPARPVIRRKKLKK
>NZ_CP040877.1|WP_002311526.1|52051_52723_-|class-A-sortase
MKKWLFGFLGVALIVFCSVFGYVSYQKHEGDVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTCKFIVSEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP040877.1|WP_002342424.1|50022_51999_-|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPTEDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVVNPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLESAEFAAKNAEGKYYGGLVDTDKNGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP040877.1|WP_002313097.1|49255_50008_-|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLEPNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKQQKLSWKWLLGSTVFLSVMIIGSLFVYKKKK
>NZ_CP040877.1|WP_002342425.1|48484_49240_-|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGHEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKDRVKKLSSDQLKLVSNGETKTIDQQTGVFEFSIEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNDEFLKDVWIYPKSEASQPKEEVKKIVSTGVKKNFFENCWDFVTHLFSRD
>NZ_CP040877.1|WP_002293489.1|48211_48472_-|hypothetical-protein
MKLIKLLLFNLSCLTAVFLYCGLLFSQLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG
>NZ_CP040877.1|WP_002342426.1|46124_48215_-|isopeptide-forming-domain-containing-fimbrial-protein
MNFKHSWTRRLKYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKNIRYPSFQKEYGETNLVLEGVTTNTKVNIDYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIVYHSTQMNVQLVATYEDGSPVQFSGDTFISFNSLNPAGGKSTDLKGEYAHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKLTQADNDFNNLHDKLGDPKFGQGTVSFKISEANPTFVIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKVNRLGVDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSGEVTYDKTKHQVKYAAKADTLKNRMKYNGETYELVINVKVNELANQNSVAKNQGTSIINKVEKDTNIITVYFPKIPVKEVQQNGKDVSGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDAASDHYKQFSIQDPIEARLTYKEGSAQVIDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPLQSEKNIDNQAVVAVDNVSNKTNVVTIGVDPNLPQVIVPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI
>NZ_CP040877.1|WP_002290397.1|59322_59577_+|AbrB-family-transcriptional-regulator
MGKELKVRKIGNSVGVILPSSLGLKSGDTIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP040877.1|WP_002338111.1|59577_59895_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENDLALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGL
>NZ_CP040877.1|WP_128440560.1|61216_62176_+|IS30-family-transposase
MTYKHLTIDELTMIESYYLQHNKPVEIANRMGRAIQTIYSVVNKFNQGKTALDYWHQYKENKKKCGRKVIQLPAHEVDYIKEKVTLGWTPDVIIGRKERPVSCGMRTLYRLFSKGIFDIDTLPMKGKRKPNGHQEKRGKQQYQRSIHDRPDNYPDFNSEFGHLEGDTIVGIHHKSAVITLVERLSKVIITIKPNGRKALDIETALNQWFSRFPKNLFKSITFDCGKEFSNWKAISNQHDIDIYFADPGTPSQRPLNENSNGILRRNGLPKSMDFREVNQTFIFSVSNQRNHIPRKSLNYRTPIEIFLSYVQEAFYSSLI
>NZ_CP040877.1|WP_109114464.1|62550_63459_+|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIAGVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP040877.1|WP_002338109.1|63540_64395_+|AraC-family-transcriptional-regulator
MENSIYLVTEPNTQLKDCYFNFCGYSKTEPRHSFGPAIREQYLIHIVLEGEGYYSINDQKYFLKKGQGFVIPPGVSTFYQADEKNPWSYVWLGLSGNLVEYYLKEIGVGKNHLTFKVENLNSFKGLIFETLSYDQDNLVSELSRQKQVYKFLELLLNSASYLNEGIITKKMNPFVRQTIEIIRENAYQKLSVKDIAVSLSIHENYLSRLFKNDMGISIKEYISEIKISIANDLLSSTEYSIQQISDKIGFSTVQSFSKAFKKANGVSPGVYRKRRLGLGIINGE
>NZ_CP040877.1|WP_002342422.1|64491_66741_+|alpha-galactosidase
MYKDNEMNIIYRSENQQFHLFNQEISYIFKISEDGKLLHLYYGENLPDNDYSHLIEMHHRPMTTYRNENDLLYSLEHLKQEFPEYGTTDFRHPAISLLQKNGSRLSDFVYQGYEVEEGKPKLEGLPATYVDNNDESKTLKVYILDSVTNVQVELLYTIYRDYPVITRSARVMNKGKDIQIIENISSLSLDLPDANYEWQQLSGAWGRERTIKSRTLQQGIQSIESTRGISSHQHNPFVTLKRKNTDENQGEAIGAALVYSGNFLIQAEVDTWDVTRLQVGINPFGFNWKLNPGEIFTAPEAILVYSSKGLNAMSQTFHQLFRKRLARGKWREKDRPVLINNWEATYFDFDEEKLVNIAKKAFDVGIELFVLDDGWFGERENDCAGLGDWHVNPKRLPRGIGSLSEKIRSFGMKFGLWFEPEMVNKDSELYRTHPNWIISTPNRKPNHGRNQYVLNFGLDEVVENIFDQMCKIIDESNLDYIKWDMNRPLTDVFDSHLLADQQGEVFHRYVLGVYRLYEKLITKYPNILFESCSSGGGRFDPGMLHYAPQAWASDDSDAIERLKIQYGTSMLYPLSSIGAHVSIVPNHQTNRITPIKTRGNVAFFGAFGYELDLNELSEGDLRIVKEQIAFYKKYRTIIHNGTFYRLLSPFDDDNQTAWMVVSHDKKTAIVAHYKTLNEVNAPYRRLKLKGLDNDGLYNVGQNSLRSGMELMRAGLVCSDASSGQINDQNRRPETFDFDSKIWVITQEEK
>NZ_CP040877.1|WP_010728556.1|66743_67919_+|MFS-transporter
MINQKSLLQKGAILSISLMLTSSQAINGVIPQMKQSLGISQSQSELLGTAPSITVILFILLSSYFAKRIGMKKTIILGLLLAGIGGIIPVFTATFQTVLISRVILGAGLGVYNSLAVTYISSLYSGNTRATLLGIRNSMEALGQTILIFLAGVLVNINWTASFLVYAIAFPVALLFALKVPEIRDENSDIPENHVKEKMNPMVFALVLFAILLVMNSIAISVRFASIATEIKGVNFNASNYLALMPILGILAGFMFGPINKWIGKGTLYLGIIFFIISNLLIAVSNGNMTFLLTGLFLSSITGSWCFPFIFSNLDKVTTKNTINFATSLIFIGCNIGNFIAPIAMQLAQFLTRSTNLTAPFFVFAGIFIVILFVTFFATNKKNTRVTRGAS
>NZ_CP040877.1|WP_002297422.1|69063_69327_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVDEIDWDNL
>NZ_CP040877.1|WP_002314366.1|69326_69599_+|Txe/YoeB-family-addiction-module-toxin
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEIYSARTHYESQ
>NZ_CP040877.1|WP_002292678.1|69675_70005_+|AbrB-family-transcriptional-regulator
MITKTRKQGNSIMLTVPKDFNVPNGVEVEAKLVENGILYEFVEPQKEFYDFSEDILSDIIAEGYDKDEILVEFKNRKNKMHSSFRDIAEDTLTNSKVMTKEELATEIGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221216-221254	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-490	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244164	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27921	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96585	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-492	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95092-95130	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358205-358243	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119937-119975	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111408	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126972	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153621-153659	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129212-129250	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71307	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249118-249156	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107236	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91402-91440	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102426-102464	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1435	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60362-60400	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97677-97715	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52637-52675	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102651-102689	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200668	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56543-56581	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65333-65371	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67366	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14572-14610	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178936	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33082-33120	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105747	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39887-39925	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35203	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225650	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92046-92084	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17089-17127	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86205	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61691	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5122	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177316	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244164	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192113-192151	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-491	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168263-168301	0	1.0
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109448-109486	1	0.974
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-491	1	0.974
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-491	1	0.974
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47629-47667	1	0.974
NZ_CP040877_1	1.2\|56543\|39\|NZ_CP040877\|CRISPRCasFinder	56543-56581	39	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3396	4	0.897

1. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

2. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

3. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

4. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

5. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

6. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

7. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

8. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

9. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

10. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

11. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

12. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

13. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

14. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

15. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

16. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

17. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

18. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

19. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

20. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

21. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

22. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

23. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

24. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

25. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

26. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

27. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

28. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

29. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

30. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

31. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

32. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

33. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

34. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

35. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

36. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

37. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

38. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

39. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

40. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

41. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

42. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

43. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

44. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

45. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

46. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

47. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

48. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

49. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

50. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

51. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

52. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

53. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

54. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

55. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

56. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

57. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

58. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

59. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

60. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

61. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

62. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

63. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

64. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

65. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

66. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

67. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

68. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

69. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

70. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

71. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

72. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

73. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

74. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

75. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

76. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

77. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

78. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

79. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

80. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

81. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

82. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

83. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

84. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

85. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

86. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

87. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

88. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

89. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

90. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

91. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

92. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

93. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

94. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

95. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

96. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

97. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

98. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

99. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

100. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

101. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

102. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

103. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

104. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

105. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

106. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

107. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

108. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

109. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

110. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

111. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

112. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

113. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

114. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

115. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

116. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

117. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgaggatg	Protospacer
************************************.**

118. spacer 1.2|56543|39|NZ_CP040877|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 4, identity: 0.897

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
agccccaaggattcagcgtctgatttttcgtcgagggtg	Protospacer
. *** *.*******************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

293 : 63459

Streptococcus_phage(21.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002290567.1\|293_1247_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-34	36.1
WP_002342376.1\|1527_2697_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002377170.1\|2972_3155_+	hypothetical protein	NA	NA	NA	NA
WP_002319346.1\|3393_3798_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_002292745.1\|3813_4377_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_086322653.1\|4390_6874_-	vitamin B12-dependent ribonucleotide reductase	A0A0K2CP92	Brevibacillus_phage	6.3e-187	46.5
WP_002292747.1\|7023_7569_+	hypothetical protein	NA	NA	NA	NA
WP_002342380.1\|8445_8997_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_002290399.1\|9577_10876_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_002342383.1\|12209_14012_-	exonuclease DNA polymerase III epsilon subunit	A0A0A7RWA3	Clostridium_phage	7.6e-33	30.4
WP_002342384.1\|14074_14917_-	hypothetical protein	NA	NA	NA	NA
WP_002331328.1\|14932_15154_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_080108108.1\|15296_15602_-	site-specific recombinase	A0A2K5B2B4	Erysipelothrix_phage	3.0e-14	49.5
WP_002354485.1\|15695_16382_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002341317.1\|17235_17853_-	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_002341318.1\|17869_18232_-	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	8.4e-16	43.6
WP_002329961.1\|18540_18750_+	hypothetical protein	NA	NA	NA	NA
WP_002329962.1\|18746_18983_+	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	7.6e-18	73.8
WP_086322655.1\|19252_21157_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-99	35.5
WP_002342389.1\|21354_21588_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002320187.1\|22574_22913_-	hypothetical protein	NA	NA	NA	NA
WP_002320186.1\|23140_23845_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002292150.1\|23989_24562_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	3.9e-23	42.6
WP_139439750.1\|25097_26288_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	4.9e-28	24.6
WP_002291321.1\|27007_27319_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_002342391.1\|27867_28692_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_002342392.1\|28904_31067_-	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	4.3e-06	41.1
WP_002291308.1\|31347_33642_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002342393.1\|33634_34300_+	beta-phosphoglucomutase	M1HXP3	Paramecium_bursaria_Chlorella_virus	1.9e-13	31.7
WP_002328396.1\|34292_35327_+	galactose mutarotase	NA	NA	NA	NA
WP_086322657.1\|38325_39351_-	saccharopine dehydrogenase	NA	NA	NA	NA
WP_002303333.1\|40009_40369_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_139439751.1\|41673_42951_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_047927455.1\|42950_45005_-	hypothetical protein	NA	NA	NA	NA
WP_002295662.1\|45074_45377_-	hypothetical protein	NA	NA	NA	NA
WP_002305229.1\|45394_45637_-	DUF5415 family protein	NA	NA	NA	NA
WP_002310966.1\|45633_46098_-	hypothetical protein	NA	NA	NA	NA
WP_002342426.1\|46124_48215_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002293489.1\|48211_48472_-	hypothetical protein	NA	NA	NA	NA
WP_002342425.1\|48484_49240_-	hypothetical protein	NA	NA	NA	NA
WP_002313097.1\|49255_50008_-	class C sortase	NA	NA	NA	NA
WP_002342424.1\|50022_51999_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002311526.1\|52051_52723_-	class A sortase	NA	NA	NA	NA
WP_002311524.1\|53142_53376_-	hypothetical protein	NA	NA	NA	NA
WP_002311523.1\|53567_53858_-	hypothetical protein	NA	NA	NA	NA
WP_002311521.1\|53876_54218_-	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	3.1e-36	63.4
WP_002322486.1\|54836_55169_-	hypothetical protein	NA	NA	NA	NA
WP_002311519.1\|55992_57033_-	replication protein RepA	NA	NA	NA	NA
WP_002290397.1\|59322_59577_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002338111.1\|59577_59895_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_128440560.1\|61216_62176_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-37	36.1
WP_109114464.1\|62550_63459_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

73138 : 114895

Enterococcus_phage(21.05%)

bacteriocin,holin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_136653604.1\|73138_73819_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	83.6
WP_025479643.1\|74070_74337_-	hypothetical protein	NA	NA	NA	NA
WP_025477461.1\|74341_74506_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_002339781.1\|74598_74796_-	hypothetical protein	NA	NA	NA	NA
WP_002339780.1\|75087_75699_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.2e-16	33.5
WP_002342403.1\|75799_77218_+	hypothetical protein	NA	NA	NA	NA
WP_077495151.1\|77558_77693_+	DNA topoisomerase	NA	NA	NA	NA
WP_002342402.1\|77932_78526_+	hypothetical protein	NA	NA	NA	NA
WP_086322659.1\|78538_79438_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002339775.1\|79440_79926_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	1.4e-42	60.5
WP_025479642.1\|80025_80271_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_139439760.1\|80345_80606_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	4.5e-11	50.0
WP_002293540.1\|81050_81257_+	hypothetical protein	NA	NA	NA	NA
WP_002287517.1\|81256_81508_+	hypothetical protein	NA	NA	NA	NA
WP_002339840.1\|81523_81961_+	hypothetical protein	NA	NA	NA	NA
WP_025477546.1\|82180_82381_+	hypothetical protein	NA	NA	NA	NA
WP_086322660.1\|82641_83037_+	hypothetical protein	NA	NA	NA	NA
WP_002293548.1\|83086_83293_+	hypothetical protein	NA	NA	NA	NA
WP_002307516.1\|83302_83536_+	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_002335346.1\|83878_84061_+	hypothetical protein	NA	NA	NA	NA
WP_002293551.1\|84050_84362_+	hypothetical protein	NA	NA	NA	NA
WP_002314385.1\|85109_85799_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	99.1
WP_002290114.1\|86021_86693_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_025477426.1\|86850_87417_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_139439752.1\|87420_87618_+	DUF1971 domain-containing protein	NA	NA	NA	NA
WP_002290112.1\|87652_89809_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.0e-241	57.8
WP_002290111.1\|89818_90772_+	ribonucleotide-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	6.4e-31	34.5
WP_025477519.1\|91133_91625_+	thiol peroxidase	NA	NA	NA	NA
WP_002292696.1\|91699_92650_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	7.5e-96	54.4
WP_002314385.1\|93100_93790_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-126	99.1
WP_002293183.1\|93982_94114_-\|bacteriocin	enterocin L50 family leaderless bacteriocin	NA	NA	NA	NA
WP_002293184.1\|94133_94268_-\|bacteriocin	enterocin L50 family leaderless bacteriocin	NA	NA	NA	NA
WP_002329885.1\|94775_95045_+	hypothetical protein	NA	NA	NA	NA
WP_002293186.1\|95045_95318_+	hypothetical protein	NA	NA	NA	NA
WP_002293187.1\|95307_95739_+	hypothetical protein	NA	NA	NA	NA
WP_002293188.1\|95735_97121_+	hypothetical protein	NA	NA	NA	NA
WP_002345873.1\|97122_97620_+	hypothetical protein	NA	NA	NA	NA
WP_047937082.1\|97612_98830_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_002293192.1\|98826_99510_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-38	38.7
WP_002293193.1\|99506_100706_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_047928023.1\|101109_101454_-	hypothetical protein	NA	NA	NA	NA
WP_025481242.1\|101534_102038_-	XRE family transcriptional regulator	A0A1B2APZ3	Phage_Wrath	7.6e-39	54.4
WP_077940961.1\|102000_102237_+	helix-turn-helix transcriptional regulator	A0A097PBE6	Streptococcus_pyogenes_phage	1.5e-13	52.1
WP_002293196.1\|102473_104588_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.8e-118	39.0
WP_016925871.1\|104733_104928_+	hypothetical protein	NA	NA	NA	NA
WP_002395927.1\|104969_105200_-	hypothetical protein	NA	NA	NA	NA
WP_139439753.1\|105285_106411_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-75	54.1
WP_139439754.1\|107136_108263_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.5e-74	53.4
WP_100067862.1\|108345_108888_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.2e-23	42.0
WP_002293180.1\|108947_109244_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_139439755.1\|109302_110472_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002307506.1\|111062_111485_+	cupin domain-containing protein	Q2I8C5	Bacillus_phage	2.4e-38	58.5
WP_002307505.1\|111568_112222_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.8e-23	36.0
WP_002311027.1\|112218_112983_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002318453.1\|113057_113171_+	hypothetical protein	NA	NA	NA	NA
WP_002342366.1\|113384_113627_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_086956687.1\|113732_114895_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3

DBSCAN-SWA_3

134909 : 143365

Bacillus_phage(33.33%)

integrase,transposase

attL 127292:127307|attR 148046:148061

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
127292:127307	attL	NA	NA	NA	NA
WP_047937439.1\|134909_136181_-	substrate-binding domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	1.2e-16	44.0
WP_047937438.1\|136464_137412_-	glyoxalase	NA	NA	NA	NA
WP_002290382.1\|137423_137897_+\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
WP_002290383.1\|138069_138624_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_139439757.1\|139094_140285_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	5.6e-24	28.4
WP_139439758.1\|140999_142126_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-75	54.1
WP_002329140.1\|142405_143365_+\|transposase	IS30-like element IS6770 family transposase	W5R8L2	Staphylococcus_phage	1.8e-36	35.9
148046:148061	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040878

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP040877

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection