CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	0 crisprs	NA	0	0	1
NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	0 crisprs	NA	0	0	2
NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	0 crisprs	cas14j,csa3,RT	0	0	3
NZ_CP029454	Bacillus cereus strain FORC087 chromosome, complete genome	3 crisprs	cas3,csa3,WYL,c2c9_V-U4,DinG,DEDDh	1	22	8

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 18458

Bacillus_phage(61.54%)

holin,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000907420.1\|0_1482_+\|tail	phage tail protein	A0A0S2MV63	Bacillus_phage	1.0e-261	87.4
WP_139895017.1\|1478_5840_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	58.5
WP_058839882.1\|5855_6230_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	4.7e-62	91.9
WP_000373885.1\|6264_6690_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	1.4e-70	96.5
WP_000540645.1\|6689_7508_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.0e-146	88.6
WP_000780751.1\|7701_7980_-	hypothetical protein	NA	NA	NA	NA
WP_098204998.1\|8020_8362_-	YolD-like family protein	NA	NA	NA	NA
WP_139895018.1\|8358_9624_-	Y-family DNA polymerase	O64031	Bacillus_phage	1.6e-106	47.9
WP_000264499.1\|9734_9959_-	helix-turn-helix domain-containing protein	A0A1B1P883	Bacillus_phage	3.7e-30	82.4
WP_139895019.1\|10271_11570_+	cell division protein FtsK	B3RH36	Bacillus_virus	7.5e-107	45.0
WP_080019657.1\|11493_12084_+	hypothetical protein	B3RH37	Bacillus_virus	4.1e-68	62.2
WP_139895020.1\|12103_12592_+	hypothetical protein	A6XML4	Bacillus_virus	6.7e-16	53.8
WP_139895021.1\|12780_12960_+	hypothetical protein	NA	NA	NA	NA
WP_139895022.1\|13208_13796_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	6.6e-10	34.8
WP_097863165.1\|13904_14405_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000820696.1\|14467_15406_-	hypothetical protein	V9QKZ6	Oenococcus_phage	9.5e-11	37.6
WP_087965683.1\|15783_16137_+	hypothetical protein	NA	NA	NA	NA
WP_087965681.1\|16300_16612_+	hypothetical protein	NA	NA	NA	NA
WP_087965679.1\|16709_17060_-	hypothetical protein	NA	NA	NA	NA
WP_087965677.1\|17260_17635_-	hypothetical protein	NA	NA	NA	NA
WP_001018642.1\|17636_18458_-	ParA family protein	F0PIG8	Enterococcus_phage	4.4e-52	44.2

DBSCAN-SWA_2

39520 : 65081

Bacillus_phage(78.57%)

portal,terminase,head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139895030.1\|39520_40747_+	hypothetical protein	A0A1B1P895	Bacillus_phage	7.0e-179	77.9
WP_097821268.1\|41211_41568_-	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	3.1e-15	40.5
WP_000693791.1\|41760_41955_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139895031.1\|42640_42796_+	BC1881 family protein	NA	NA	NA	NA
WP_139895032.1\|42792_43008_-	KTSC domain-containing protein	D2IZW7	Enterococcus_phage	2.2e-08	46.4
WP_058839902.1\|43201_43402_+	hypothetical protein	NA	NA	NA	NA
WP_139895033.1\|43597_44230_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	2.5e-31	41.2
WP_000472843.1\|44421_44643_+	hypothetical protein	NA	NA	NA	NA
WP_139895034.1\|44643_45378_+	DnaD domain protein	A0A1B1P8C4	Bacillus_phage	4.2e-54	53.5
WP_139895043.1\|45361_46120_+	ATP-binding protein	U5PWH5	Bacillus_phage	4.3e-38	40.3
WP_139895044.1\|46316_46763_+	hypothetical protein	U5PVF9	Bacillus_phage	3.2e-33	48.9
WP_139895035.1\|46785_47049_+	hypothetical protein	A0A1B1P8D7	Bacillus_phage	2.3e-15	62.1
WP_002153818.1\|47005_47251_+	hypothetical protein	A0A1B1P7W1	Bacillus_phage	4.1e-30	85.9
WP_097862704.1\|47247_47511_+	hypothetical protein	A0A0S2GLK4	Bacillus_phage	4.4e-22	60.2
WP_097862703.1\|47524_47938_+	hypothetical protein	A0A1C8E9A7	Bacillus_phage	6.3e-07	42.9
WP_000375383.1\|47946_48081_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_139895036.1\|48077_48524_+	dUTP diphosphatase	A0A0U3SLD3	Bacillus_phage	1.3e-66	87.8
WP_139895037.1\|49094_49850_+	DNA (cytosine-5-)-methyltransferase	A0A0K2CYZ1	Paenibacillus_phage	3.2e-65	51.0
WP_139895038.1\|50140_50440_-	hypothetical protein	NA	NA	NA	NA
WP_139895039.1\|50569_51199_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.7e-48	60.1
WP_098205031.1\|51337_51724_+	ArpU family transcriptional regulator	A0A1B1P853	Bacillus_phage	2.0e-23	45.6
WP_061660538.1\|51784_52123_-	hypothetical protein	NA	NA	NA	NA
WP_000387493.1\|53214_53439_+	hypothetical protein	NA	NA	NA	NA
WP_001067903.1\|53572_53779_-	hypothetical protein	NA	NA	NA	NA
WP_001018890.1\|54202_54778_+	recombinase family protein	I1ZBD6	Salisaeta_icosahedral_phage	8.1e-29	41.4
WP_098601474.1\|54911_55226_+	hypothetical protein	NA	NA	NA	NA
WP_000265600.1\|55377_55599_-	hypothetical protein	NA	NA	NA	NA
WP_082682419.1\|55617_55815_-	hypothetical protein	NA	NA	NA	NA
WP_139895040.1\|56196_56955_+	hypothetical protein	D2XPX8	Bacillus_virus	1.3e-55	60.3
WP_098661337.1\|56951_58181_+\|terminase	PBSX family phage terminase large subunit	A0A059T7K2	Staphylococcus_phage	1.5e-144	61.9
WP_098522480.1\|58193_59618_+\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	1.5e-257	92.9
WP_098522491.1\|59691_60459_+\|head	phage head protein	A0A0S2MVF0	Bacillus_phage	1.5e-134	92.9
WP_071728189.1\|60531_61263_+	DUF4355 domain-containing protein	A0A0A7AQU8	Bacillus_phage	6.4e-71	63.1
WP_000116908.1\|61380_62226_+	hypothetical protein	A0A0S2MVF8	Bacillus_phage	4.1e-138	88.2
WP_098005732.1\|62269_62581_+	hypothetical protein	A0A0A7AQX9	Bacillus_phage	8.8e-46	90.0
WP_139895041.1\|62577_62922_+\|head,tail	head-tail adaptor protein	A0A0A7AR32	Bacillus_phage	2.5e-54	87.7
WP_097862690.1\|62896_63304_+	HK97 gp10 family phage protein	A0A0S2MVE4	Bacillus_phage	1.7e-65	95.6
WP_097862689.1\|63309_63672_+	hypothetical protein	A0A0S2MV90	Bacillus_phage	1.9e-60	95.0
WP_139895042.1\|64344_64773_+	hypothetical protein	A0A0S2MV94	Bacillus_phage	4.7e-58	80.3
WP_139895045.1\|64877_65081_+	hypothetical protein	A0A0S2MV68	Bacillus_phage	8.3e-29	89.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP029456

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28484 : 72508

Bacillus_phage(28.57%)

integrase,protease,bacteriocin,transposase

attL 24415:24431|attR 62550:62566

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
24415:24431	attL	NA	NA	NA	NA
WP_139894974.1\|28484_29918_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_139894975.1\|30238_31165_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P793	Bacillus_phage	1.4e-70	45.3
WP_139894976.1\|31249_31459_+	hypothetical protein	NA	NA	NA	NA
WP_074569871.1\|32224_33229_-	Replicase RepFR55	NA	NA	NA	NA
WP_139894977.1\|33719_34874_+	helix-turn-helix domain-containing protein	A0A1B1P895	Bacillus_phage	3.6e-20	23.2
WP_023523901.1\|35355_35739_-	helix-turn-helix transcriptional regulator	A0A1J0MG99	Staphylococcus_phage	6.8e-08	39.4
WP_000881199.1\|35876_36113_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139895014.1\|36401_38819_+	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_139894978.1\|38854_39040_+	hypothetical protein	NA	NA	NA	NA
WP_074569874.1\|39346_39586_+	hypothetical protein	NA	NA	NA	NA
WP_139894979.1\|39618_42420_+	ATP-binding protein	NA	NA	NA	NA
WP_139894980.1\|42425_43268_+	hypothetical protein	NA	NA	NA	NA
WP_139894981.1\|43272_43485_+	hypothetical protein	NA	NA	NA	NA
WP_139894982.1\|43496_43751_+	hypothetical protein	NA	NA	NA	NA
WP_139894983.1\|43764_44742_+	conjugal transfer protein	NA	NA	NA	NA
WP_000281809.1\|44751_45003_+	hypothetical protein	NA	NA	NA	NA
WP_139894984.1\|45030_45582_+	conjugal transfer protein	NA	NA	NA	NA
WP_139894985.1\|45541_48112_+	recombinase RmuC	A0A1S5SF64	Streptococcus_phage	1.1e-85	28.6
WP_139894986.1\|48170_48680_+	hypothetical protein	NA	NA	NA	NA
WP_139894987.1\|48676_51319_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_139894988.1\|51375_51774_+	hypothetical protein	NA	NA	NA	NA
WP_139894989.1\|51801_52929_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2D0ZM66	Rhodococcus_phage	3.3e-18	41.4
WP_139894990.1\|52953_53538_+	hypothetical protein	NA	NA	NA	NA
WP_139894991.1\|53556_53877_+	hypothetical protein	NA	NA	NA	NA
WP_086391941.1\|53902_54199_+	hypothetical protein	NA	NA	NA	NA
WP_139894992.1\|54325_54646_+	hypothetical protein	NA	NA	NA	NA
WP_139894993.1\|54677_54890_+	hypothetical protein	NA	NA	NA	NA
WP_139894994.1\|55169_56327_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_139894995.1\|56536_57457_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_139894996.1\|58079_59156_+	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_139894997.1\|60333_61287_+	collagen-like protein	NA	NA	NA	NA
WP_139894998.1\|62451_62961_+	DUF4367 domain-containing protein	NA	NA	NA	NA
62550:62566	attR	NA	NA	NA	NA
WP_139894999.1\|63208_64252_-	hypothetical protein	NA	NA	NA	NA
WP_139895000.1\|64310_64715_-	hypothetical protein	NA	NA	NA	NA
WP_098512216.1\|65580_66783_+	replication initiation protein	E5FFJ0	Burkholderia_phage	2.0e-13	25.6
WP_139895001.1\|66905_67310_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_139895002.1\|67913_69107_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_139895003.1\|69103_69784_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.2e-34	39.3
WP_000054384.1\|69780_70980_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_139895004.1\|71114_71780_+	DUF1282 family protein	NA	NA	NA	NA
WP_001993458.1\|71970_72198_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_139895005.1\|72280_72508_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP029455

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

177833 : 234428

Bacillus_phage(43.33%)

portal,terminase,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098488162.1\|177833_178232_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.4e-51	69.7
WP_139894854.1\|178243_179356_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	1.1e-79	47.5
WP_087966401.1\|180330_180705_-	hypothetical protein	NA	NA	NA	NA
WP_087966399.1\|181120_181444_+\|transposase	transposase	NA	NA	NA	NA
WP_087966397.1\|181712_182003_+	hypothetical protein	NA	NA	NA	NA
WP_087966395.1\|182022_182457_+	hypothetical protein	NA	NA	NA	NA
WP_087966393.1\|182548_183130_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_087966391.1\|183653_184538_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_087966389.1\|185273_186071_+	LysM peptidoglycan-binding domain-containing protein	A0A141HRV8	Bacillus_phage	9.2e-31	39.8
WP_087966387.1\|186119_186380_+	hypothetical protein	NA	NA	NA	NA
WP_075312952.1\|186466_186688_-	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	1.4e-10	45.2
WP_087966385.1\|186977_187298_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	1.2e-29	62.3
WP_087966383.1\|187313_188480_+	DNA translocase FtsK	A0A0S2GLG9	Bacillus_phage	1.3e-179	79.6
WP_087966402.1\|188502_189078_+	hypothetical protein	W8CZ47	Bacillus_phage	1.7e-82	75.5
WP_087966381.1\|190100_191915_+	acetyltransferase	B5WZU0	Pseudomonas_phage	1.4e-42	35.4
WP_087966378.1\|192505_193012_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_139894856.1\|193254_194187_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_087965305.1\|194956_195850_+	hypothetical protein	NA	NA	NA	NA
WP_080495052.1\|196020_196497_+	GNAT family N-acetyltransferase	E9LUK4	Lactobacillus_phage	1.8e-29	43.3
WP_087965304.1\|197210_198539_+	nucleotide sugar dehydrogenase	A7IWZ0	Paramecium_bursaria_Chlorella_virus	1.5e-38	29.9
WP_087965302.1\|198547_199705_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2P1ELT3	Moumouvirus	5.8e-42	33.1
WP_087965300.1\|199711_200635_+	NAD-dependent epimerase/dehydratase family protein	A0A0E3FNQ3	Synechococcus_phage	3.2e-27	32.0
WP_087965298.1\|200609_201851_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2P1ELT3	Moumouvirus	2.6e-16	38.1
WP_098284853.1\|201862_202744_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_074593164.1\|202747_203437_+	WbqC family protein	NA	NA	NA	NA
WP_071732404.1\|203443_204121_+	PIG-L family deacetylase	NA	NA	NA	NA
WP_087965311.1\|204132_205068_+	endonuclease	NA	NA	NA	NA
WP_087965294.1\|205200_206574_+	M28 family peptidase	NA	NA	NA	NA
WP_087965292.1\|206681_207956_+	MFS transporter	NA	NA	NA	NA
WP_087965290.1\|208124_208592_-	RsfA family transcriptional regulator	NA	NA	NA	NA
WP_087965288.1\|208945_210592_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	2.3e-07	23.8
WP_087965286.1\|210802_211150_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	2.5e-09	33.6
WP_000577226.1\|211519_211927_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000787540.1\|211916_212330_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_087965284.1\|212853_213339_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_087965282.1\|214320_216063_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.5e-06	41.5
WP_001167049.1\|216229_216445_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.7e-19	70.1
WP_084065910.1\|216514_216934_-	hypothetical protein	NA	NA	NA	NA
WP_000482313.1\|217628_218033_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_087965280.1\|218884_219178_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000834513.1\|220269_220914_-	helix-turn-helix domain-containing protein	A0A2H4J245	uncultured_Caudovirales_phage	1.1e-29	34.3
WP_000549412.1\|221051_221258_+	transcriptional regulator	W8CYN7	Bacillus_phage	1.8e-10	51.7
WP_000231991.1\|221776_222061_+	hypothetical protein	NA	NA	NA	NA
WP_000096618.1\|222139_222904_+	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	3.6e-56	49.2
WP_000251926.1\|222938_223670_+	ATP-binding protein	U5PWH5	Bacillus_phage	1.7e-31	37.0
WP_098842613.1\|223860_224475_+	hypothetical protein	X2JKZ4	Bacillus_phage	1.1e-07	28.2
WP_000765291.1\|224479_224656_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_000931946.1\|224733_225105_+	hypothetical protein	A0A0M4R397	Bacillus_phage	1.0e-16	42.9
WP_139894858.1\|225387_225888_+	sigma-70 family RNA polymerase sigma factor	A0A0A7AQW8	Bacillus_phage	2.2e-46	60.4
WP_087965276.1\|226119_226305_+	hypothetical protein	NA	NA	NA	NA
WP_087965274.1\|226322_226814_+	hypothetical protein	A0A1B0XTP0	Freshwater_phage	2.4e-05	22.8
WP_087965272.1\|226994_228251_+\|terminase	phage terminase large subunit	A0A2H4J7G6	uncultured_Caudovirales_phage	1.3e-111	51.3
WP_000229504.1\|228344_229685_+\|portal	phage portal protein	A0A222YY66	Streptomyces_phage	2.9e-45	28.6
WP_086391823.1\|229713_230904_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	1.9e-35	30.1
WP_001060157.1\|230924_231905_+	hypothetical protein	H7BVA6	unidentified_phage	1.6e-69	41.6
WP_000691127.1\|231921_232086_+	hypothetical protein	NA	NA	NA	NA
WP_087965267.1\|232099_232633_+	hypothetical protein	NA	NA	NA	NA
WP_000392020.1\|232661_232988_+	hypothetical protein	NA	NA	NA	NA
WP_033668458.1\|232989_233406_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_000208342.1\|233402_233819_+	hypothetical protein	NA	NA	NA	NA
WP_000118565.1\|233831_234428_+	hypothetical protein	A0A1S5S9Y8	Streptococcus_phage	1.0e-13	30.3

DBSCAN-SWA_2

289960 : 368553

Bacillus_phage(28.57%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139894882.1\|289960_291082_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	4.0e-173	81.5
WP_139894884.1\|291254_291929_-	hypothetical protein	NA	NA	NA	NA
WP_000219733.1\|292812_293109_-	hypothetical protein	NA	NA	NA	NA
WP_139894886.1\|294472_295474_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.3e-21	28.2
WP_139894888.1\|295562_296843_-	MFS transporter	NA	NA	NA	NA
WP_139894890.1\|297007_297223_+	hypothetical protein	NA	NA	NA	NA
WP_139894892.1\|297337_298363_+	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_016135862.1\|298794_299793_+	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_016089984.1\|299871_301335_+	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_139894894.1\|301489_303424_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_139894896.1\|303546_304443_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_139894897.1\|304572_305418_+	class II aldolase	NA	NA	NA	NA
WP_098568360.1\|305523_306315_+	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_064472536.1\|306496_307381_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_139894898.1\|308502_308931_+	hypothetical protein	NA	NA	NA	NA
WP_097813728.1\|309313_310249_+	DUF3994 domain-containing protein	NA	NA	NA	NA
WP_097813729.1\|310559_310919_-	hypothetical protein	NA	NA	NA	NA
WP_098568371.1\|311102_311348_+\|transposase	transposase	NA	NA	NA	NA
WP_139894899.1\|311540_312299_-	hypothetical protein	NA	NA	NA	NA
WP_097813731.1\|312318_312909_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_000760020.1\|313119_313545_+	DUF4362 domain-containing protein	NA	NA	NA	NA
WP_000675540.1\|315569_316169_+	hypothetical protein	NA	NA	NA	NA
WP_000206464.1\|316329_316557_+	hypothetical protein	NA	NA	NA	NA
WP_139894900.1\|317596_318670_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.3e-74	41.5
WP_000709206.1\|318666_318792_+	hypothetical protein	NA	NA	NA	NA
WP_098568401.1\|318943_319333_+	hypothetical protein	NA	NA	NA	NA
WP_000473786.1\|320120_320555_-	hypothetical protein	NA	NA	NA	NA
WP_000503058.1\|320774_321044_+	hypothetical protein	NA	NA	NA	NA
WP_097814511.1\|321460_321949_-	hypothetical protein	NA	NA	NA	NA
WP_001161901.1\|322321_322696_-	hypothetical protein	D2XQ01	Bacillus_virus	5.4e-26	47.9
WP_000063578.1\|322738_323080_-	YolD-like family protein	NA	NA	NA	NA
WP_139894901.1\|323076_324369_-	Y-family DNA polymerase	O64031	Bacillus_phage	2.9e-103	46.7
WP_000527914.1\|325883_328124_+	hypothetical protein	G1FGA4	Mycobacterium_phage	1.3e-10	45.1
WP_139894902.1\|328256_330206_+	DUF3472 domain-containing protein	NA	NA	NA	NA
WP_069604118.1\|330530_331079_+	hypothetical protein	NA	NA	NA	NA
WP_139894903.1\|332943_334056_-	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	2.0e-79	47.0
WP_016513590.1\|334067_334466_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	4.0e-51	68.9
WP_074593111.1\|334743_335871_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_097863248.1\|335867_336971_-	endospore germination permease	NA	NA	NA	NA
WP_087965806.1\|336972_338466_-	spore germination protein	NA	NA	NA	NA
WP_001204221.1\|339293_340337_-	Fic family protein	NA	NA	NA	NA
WP_139894904.1\|341726_343103_+	chitin-binding protein	G1FGA4	Mycobacterium_phage	1.3e-08	39.2
WP_139894905.1\|343280_344696_-	phosphatidylinositol-specific phospholipase C domain-containing protein	NA	NA	NA	NA
WP_139894906.1\|345106_345676_-	methyltransferase	NA	NA	NA	NA
WP_087965816.1\|346677_347445_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.6e-34	38.4
WP_139894907.1\|347434_349417_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_139894908.1\|349498_350170_+	response regulator	NA	NA	NA	NA
WP_139894909.1\|350166_351189_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_087965824.1\|351623_352856_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.6e-19	24.8
WP_139894910.1\|352860_353553_-	response regulator	NA	NA	NA	NA
WP_139848321.1\|354254_355055_+	hypothetical protein	NA	NA	NA	NA
WP_097855914.1\|355076_355790_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.1e-34	35.5
WP_139894911.1\|355786_358255_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_139848341.1\|358251_358407_+	S-layer protein	NA	NA	NA	NA
WP_139894912.1\|361326_364017_+	magnesium-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.3e-33	23.9
WP_139894913.1\|364608_366018_+	S-methylmethionine permease	NA	NA	NA	NA
WP_139848312.1\|365992_366970_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_139894914.1\|367431_368553_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.0e-172	81.0

DBSCAN-SWA_3

402519 : 444538

Bacillus_phage(63.64%)

integrase,coat,transposase

attL 414646:414666|attR 448295:448315

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087965550.1\|402519_403578_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_087965549.1\|403602_404739_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_087965547.1\|404891_405995_+\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_087965546.1\|405954_406212_-	hypothetical protein	NA	NA	NA	NA
WP_087965544.1\|406208_406442_-	hypothetical protein	NA	NA	NA	NA
WP_087965542.1\|406452_406557_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_087965540.1\|406925_407375_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_139894925.1\|407423_407552_-	helix-turn-helix domain-containing protein	S6AND0	Bacillus_phage	5.4e-10	78.4
WP_069604262.1\|407873_408665_-	ADP-ribosyltransferase	Q331X8	Clostridium_botulinum_C_phage	1.6e-27	37.7
WP_046960447.1\|408893_409319_-	DUF4879 domain-containing protein	NA	NA	NA	NA
WP_048538634.1\|409977_410523_-	hypothetical protein	NA	NA	NA	NA
WP_048538635.1\|410527_411127_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_139894926.1\|411311_412748_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000791800.1\|413904_414264_+	DUF3796 domain-containing protein	NA	NA	NA	NA
WP_001128819.1\|414253_414454_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
414646:414666	attL	NA	NA	NA	NA
WP_071729452.1\|414751_415222_-	hypothetical protein	NA	NA	NA	NA
WP_139848288.1\|415223_415421_-	helix-turn-helix domain-containing protein	A0A1B1IRF4	uncultured_Mediterranean_phage	2.8e-05	48.4
WP_087965585.1\|415626_415743_+	DUF5065 family protein	NA	NA	NA	NA
WP_087965532.1\|415944_416124_-	hypothetical protein	NA	NA	NA	NA
WP_000824729.1\|416870_417368_-	DM13 domain-containing protein	NA	NA	NA	NA
WP_087965530.1\|417466_418525_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.8e-29	30.6
WP_087965528.1\|418521_419235_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.7e-39	38.3
WP_065705848.1\|420080_420425_-	cell division protein FtsK	NA	NA	NA	NA
WP_139894927.1\|421215_423072_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_139894928.1\|423170_423536_+	YxeA family protein	NA	NA	NA	NA
WP_065705841.1\|425767_426529_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-33	38.6
WP_087954697.1\|426571_426919_-	YxeA family protein	NA	NA	NA	NA
WP_087965519.1\|427212_428109_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_087965517.1\|428130_428256_-	fibronectin	NA	NA	NA	NA
WP_087965515.1\|428658_429210_+	hypothetical protein	NA	NA	NA	NA
WP_065705835.1\|429496_429748_-	hypothetical protein	NA	NA	NA	NA
WP_139848281.1\|430017_431433_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_139848279.1\|431432_432494_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_065705829.1\|432508_432946_-	DUF441 family protein	NA	NA	NA	NA
WP_139848340.1\|432960_433827_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_087965507.1\|433840_434689_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_139848277.1\|435896_437447_+	mosquitocidal toxin protein	Q38196	Clostridium_botulinum_phage	1.4e-06	39.2
WP_139848275.1\|437766_438846_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.9e-31	36.4
WP_139848273.1\|438842_439556_-	response regulator	W8CYM9	Bacillus_phage	5.1e-41	38.3
WP_139894929.1\|439941_442140_-	hypothetical protein	NA	NA	NA	NA
WP_087965498.1\|442808_443027_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.5e-17	66.2
WP_087965496.1\|443365_444538_-\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	4.0e-06	24.4
448295:448315	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP029454

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP029454_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029454_1

1056601-1056689

Orphan

Consensus_repeat	Method
GATATATTCGAAGAATCGCTGATATAATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP029454_1

>merge|NZ_CP029454|1|1056601-1056689|CRISPRCasFinder
GATATATTCGAAGAATCGCTGATATAATTCGAGTTGCGCTGATATATTCAGAAAAACGCTGATATAATTCGAGTTGCGCTGATATATTC

>NZ_CP029454|1|1|1056601-1056689|CRISPRCasFinder
GATATATTCGAAGAATCGCTGATATAATT	CGAGTTGCGCTGATATATTCAGAAAAACGCT
GATATAATTCGAGTTGCGCTGATATATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029454.1\|WP_139894361.1\|1044919_1045456_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380063
NZ_CP029454.1\|WP_001208941.1\|1052671_1053418_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP029454.1\|WP_000144819.1\|1051937_1052675_+\|2OG-Fe-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|370779
NZ_CP029454.1\|WP_097814533.1\|1056747_1057251_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NZ_CP029454.1\|WP_000984174.1\|1067613_1068459_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_109103328.1\|1055146_1056562_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|225962
NZ_CP029454.1\|WP_000252603.1\|1059673_1060720_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP029454.1\|WP_000278201.1\|1041523_1042966_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|225962
NZ_CP029454.1\|WP_000726800.1\|1060734_1061670_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP029454.1\|WP_139894721.1\|1053554_1054397_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP029454.1\|WP_097814532.1\|1057378_1059496_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP029454.1\|WP_000184509.1\|1068688_1069090_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP029454.1\|WP_001182725.1\|1054677_1055154_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|225937
NZ_CP029454.1\|WP_002004591.1\|1044038_1044470_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_000625400.1\|1043166_1043820_+\|DUF975-family-protein	unknown	unknown	gnl\|CDD\|283754
NZ_CP029454.1\|WP_000371346.1\|1041054_1041531_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|225937
NZ_CP029454.1\|WP_001228100.1\|1061689_1063111_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP029454.1\|WP_098219363.1\|1064761_1067128_+\|endonuclease	unknown	unknown	gnl\|CDD\|225249
NZ_CP029454.1\|WP_001176845.1\|1067260_1067560_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_000453718.1\|1063167_1064520_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635

Protein	Function_ID	Function_description	E-value
NZ_CP029454.1\|WP_001208941.1\|1052671_1053418_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	9.02492e-66
NZ_CP029454.1\|WP_000144819.1\|1051937_1052675_+\|2OG-Fe-dioxygenase-family-protein	gnl\|CDD\|370779	pfam10014, 2OG-Fe_Oxy_2, 2OG-Fe dioxygenase. This family contains 2-oxoglutarate (2OG) and Fe-dependent dioxygenases. It includes L-isoleucine dioxygenase (IDO).	1.79573e-53
NZ_CP029454.1\|WP_097814533.1\|1056747_1057251_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	7.36083e-22
NZ_CP029454.1\|WP_109103328.1\|1055146_1056562_+\|PH-domain-containing-protein	gnl\|CDD\|225962	COG3428, COG3428, Predicted membrane protein [Function unknown].	5.80228e-80
NZ_CP029454.1\|WP_000252603.1\|1059673_1060720_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP029454.1\|WP_000278201.1\|1041523_1042966_+\|PH-domain-containing-protein	gnl\|CDD\|225962	COG3428, COG3428, Predicted membrane protein [Function unknown].	3.59614e-86
NZ_CP029454.1\|WP_000726800.1\|1060734_1061670_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP029454.1\|WP_139894721.1\|1053554_1054397_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	2.09004e-15
NZ_CP029454.1\|WP_097814532.1\|1057378_1059496_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP029454.1\|WP_000184509.1\|1068688_1069090_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	1.71375e-45
NZ_CP029454.1\|WP_001182725.1\|1054677_1055154_+\|PH-domain-containing-protein	gnl\|CDD\|225937	COG3402, COG3402, Uncharacterized conserved protein [Function unknown].	4.06391e-35
NZ_CP029454.1\|WP_139894361.1\|1044919_1045456_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380063	pfam17937, TetR_C_28, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in CgmR (C. glutamicum multidrug-responsive transcriptional repressor), previously called CGL2612 protein. CgmR (CGL2612) from Corynebacterium glutamicum is a multidrug-resistance-related transcription factor belonging to the TetR family. It regulates expression of the immediately upstream gene cgmA (cgl2611) by binding to the operator cgmO in the cgmA promoter. The cgmA gene encodes a permease belonging to the major facilitator superfamily, a protein family composed of bacterial multidrug exporters, and the pair of CgmR and CgmA confers multidrug resistance on C. glutamicum.	9.77828e-26
NZ_CP029454.1\|WP_000625400.1\|1043166_1043820_+\|DUF975-family-protein	gnl\|CDD\|283754	pfam06161, DUF975, Protein of unknown function (DUF975). Family of uncharacterized bacterial proteins.	1.46024e-25
NZ_CP029454.1\|WP_000371346.1\|1041054_1041531_+\|PH-domain-containing-protein	gnl\|CDD\|225937	COG3402, COG3402, Uncharacterized conserved protein [Function unknown].	1.27254e-35
NZ_CP029454.1\|WP_001228100.1\|1061689_1063111_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP029454.1\|WP_098219363.1\|1064761_1067128_+\|endonuclease	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	9.82566e-71
NZ_CP029454.1\|WP_000453718.1\|1063167_1064520_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	9.95419e-175

>NZ_CP029454.1|WP_109103328.1|1055146_1056562_+|PH-domain-containing-protein
MYKRQHPITILLGIRVASLLPLIILVLFKPDEQVEPWYLFYLFLLVVLFIMAIFSAIKWYFKVYWIENNILHIKHGVFVKKESYLNKERVQNVSTSSNVIYQMLGLMKLNIEVAGGGSEPEVMLAGIKEDEAKHLISLLHKKETTVKEEIEEEESKTVYQLTAKEVLAAAITSGRFGLVFSGLVLLYTKFDFVLPEGFTSKVEAYVMGNGVYKLIVIALILMAISWIISTAGYVLKYANFKIERKGEEIRIVQGLFEKKEFVLKLHRIQAITVKECMLRQPFGYCAVEVEAIHSIGAASNEVMLHPFMKKKDVQHLLKYLELPYEIEAEIAHLPKTALRRYFIMGWLISIILTVLIASVSIYLKQYIALFFILPLFIVFSLLAYARYKSGGYELRENQLTVVYRNFSKYTGIMRRRHVQAVGYNQSYFQRKDELCTTLVAVAGRGYEVKHMRKKDSLRIYNWYKEKGNTGV
>NZ_CP029454.1|WP_001182725.1|1054677_1055154_+|PH-domain-containing-protein
MQPLEREIHSNMLKVWRIHALIGTAVILTVVIAYFFFMINFNWWGWLFGLLVTGAITFIPLDYFVFPNLRQRYYSYRLNEEEIEIQKGMFVVKRVLIPMIRVQHVTIEQGPIMRKYNLAELHISTAATSHSIPGLTKEEAEQLKRQIGELAKVSDKDV
>NZ_CP029454.1|WP_139894721.1|1053554_1054397_+|EamA-family-transporter
MIASMVIFGSVGFFSVQTNLPSFELVFVRCIFATIFLSVCWLLTGQYKQDKWERKEVIQVLICGFFLVFNWVFLFKAFENMSVTIAISVYHLAPVIVLLIGSIVFKEKLTFISIISIIVCFAGALLIAGIDGSFSVGSLMSSGMIWGFLAALFYAFTTLFGKGINKMSAYAMTFLQTFLGIFLLIPFIDLDAFSGLTQSNWTYIIATGFIHTGIVYYLFFDSLRYLSTKTISILVFLDPAVAILLDTVLTGFRPTLMQITGILFIFIGMTLTLKNLKIKN
>NZ_CP029454.1|WP_001208941.1|1052671_1053418_+|SDR-family-oxidoreductase
MRENKIIMISGANSGIGHACIKYFLEKSFHVIALDINNNNLIDYMKTDMPLKVVQIDLSNSEAIHNLFTQLDLEKLSPDILINAAGIREITPVLHLSDDMFKKVIDVNLVAPFILSREVAKRWCESKIKGCIVNIASVSGLMAEPERAAYVASKHALIGLTKQMAMEFGKQNIRVNSISPGVIRTELTEEYFSNTALMSMIKSNQSLDTWGLPQDIVSCIEYLISDQARFITGSNFVIDGGWTAGKNL
>NZ_CP029454.1|WP_000144819.1|1051937_1052675_+|2OG-Fe-dioxygenase-family-protein
MTFVLSKMSGFSIEEKVHEFESKGFLEISNEIFLQEEENHRLLTQAQLDYYNLEDDAYGECRARSYSRYIKYVDSPDYILDNSNDYFQSKEYNYDDGGKVRQFNSINDSFLCNPLIQNIVRFDTEFAFKTNIIDTSKDLIIGLHQVRYKATKERPSFSSPIWLHKDDEPVVFLHLMNLSNTAIGGDNLIANSPREINQFISLKEPLETLVFGQKVFHAVTPLGTECSTEAFRDILLVTFSYKETK
>NZ_CP029454.1|WP_139894361.1|1044919_1045456_+|TetR-family-transcriptional-regulator
MSISITRQKILAAASQIVQCKGVAKLTLEAVAKEAGLSKGGLLYHFSNKEALIEGMIVRGVEDYEGAIYNKVAEDSERKGRWARSFVEERLSNERRTEELSSSMMAALMLKPELLEPLQQSFQQLQKNIENDEIDSVCATIIRLAADGLWYSEYLGVGRLSPELREKVIQALISNSYK
>NZ_CP029454.1|WP_002004591.1|1044038_1044470_+|hypothetical-protein
MRVSKFLIPYSFSILSFFISATALDLYDRMGNDSELVSPNIIGKIIQSTAQMGVLTLYFGVPIILGGCLLGELLFRGIILRFKLSYIISLLLYLFLAFSIVFVTVGIPTTYEDSNTFFMGITMICAVTFFVSRNIWENKLIME
>NZ_CP029454.1|WP_000625400.1|1043166_1043820_+|DUF975-family-protein
MISQLKREALDALKGRWGLAVGATLLIGILIGAVEMLTTGIFSIFWGWEEASDSLTVSIIVMLVIGPLTIGAYYLVLNAIRGTDARIGHIFRWFSDGSKLMKSFLTYLLMYVYLTLWTLLLIIPGIIKSFSYSMTYFILNDHPEYTANQAITESRHMMNGHKMDYFLLCLSFLGWFILSILTVGIGFLWLAPYFYATSAAFYEEISKEYYKKEGTTF
>NZ_CP029454.1|WP_000278201.1|1041523_1042966_+|PH-domain-containing-protein
MYKRQHPITMLLELKITDFIPLIIFLFSLRGKFPFWYLVPIGFALITIISAIVGWYYKVYWVENNVLHVKQGLFVKKESYLNKERVQTINTSSNVLYQMLGLKKIQIETAGGGDEAEVSLAGITVEEATELITLLNEPTPEVKAEKTLDEAAENTVEKAIVTEEKQTTEYKLTWKEILIASVTSGQFGVLFSLIFFVYHQVDEYIPKWIKNSVTSYVMDHDIYGWIYMVAILLVVSWMISTIGYALKHGNFTVNRKNDEVRISQGLLERKELVLKLHRIQGITIKEGILRQPFGYCAVQVEVIQSEGKEEKVTLHPIIRKDRVQQLLAHLQLPYELNANITSLPKAALRRYLIDSFIFFAMLAIPLTGISIYFEKYYIMWALLPLAILIFTLGYATFKTNGYSVNGEQITLVYRSVGKYTGLIRRRHVQSMEKTQSYFQRRADLCTYKFSSASSSYKIEHTRVEDAERMQDWYKKKINEM
>NZ_CP029454.1|WP_000371346.1|1041054_1041531_+|PH-domain-containing-protein
MDPLKNEIHPDMVKVWKARSLIELGISIIVILAYLFFMIKFNWWAWIFYVLIGLTIVYTPFDYFTFPKLRQRYYSYQLNEEELEIQHGLFVVKRVLVPMIRVQHVTIEQGPIMRKYGLAELHISTAATSHSIPGLTMYEAEMLKTKIAELAKVSDEDV
>NZ_CP029454.1|WP_097814533.1|1056747_1057251_-|antibiotic-biosynthesis-monooxygenase
MKAIISYETPLEQAHFTAKNDEKNMFYKENTEESVEGSLQYDVLDAVGEFKGQPGYIVCNNISVTDGGRPVFENRFKNRAGLIENEPGFQAIRVLRPLSNDTYVILTMWETEQNFKDWTESRSFENAHKKRPTQAEGQPQAQAHPHAEQQKSIFSRPSFVTTFDVLV
>NZ_CP029454.1|WP_097814532.1|1057378_1059496_+|PBP1A-family-penicillin-binding-protein
MKKVKWTLLGGVATFVVAIVLYKLIVLAGGYMMDEKQLVFHSSSRIVDQKGKEITKLYVENRDLVPIEQIPKYVQQAFVAVEDSRFYEHQGIDYPSIFRALYKDTLAREKVEGGSTITQQLAKNVFLTREKTFTRKLKEVAISLQLEQKYTKQQILEMYMNHIYFGHGAYGIQAAAKLYFNKNVEDLTVEEGAMLAGLPKSPNGYSPYYSAEKSKERRDLVLSLMHKQGYLTAEESVRYQGKTIALYKNLDENELAYMPYIDMVIDEAARLYGLSHHEVLRGGYTFVVPMDEKIQKVAYNQFQDARNFPGKEEGAQGAFLLMDNRTGGIKAAIGGRKYVPRGFNRVFAKRQPGSVLKPLIVYAPALETKKYNPYSLLTNERNSFEGYEPRNYNHEYSKEMTMYDAILESANVPAVSLLNELGVEEGKQYLEKGNVHIADAGLSTALGGLKNGVSTFDLVKMYRSFLANGNIIEPHVIDKVLNRHGAVIGESPKVETKIFSKQTAWYMTKMLEGVVKEGTARAGVYNGALAGKTGTTSLPNDDKGARDMWFVGYTPNLVGAVWIGYDRTDKEHQLQGESASATKLFKKILTKANVEHKEKFMKPEGVETIGAPIRLRKIEDVKMKLSFSPFGLFKAKLSWTPLPDNRIMYRIYRVENGIHTHVSTVNGAGEYEEKFVNIFSKPSFYVVPYNTQTNREGEKSKVAKP
>NZ_CP029454.1|WP_000252603.1|1059673_1060720_+|uroporphyrinogen-decarboxylase
MVRTINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALMDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMELIFAEVRKMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKAVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK
>NZ_CP029454.1|WP_000726800.1|1060734_1061670_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEQRLNEVQDEVEYHMYLGLKHIEPFIEDAVKDMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKGIYNGMSDAEREKAVLIVSAHSLPEKIIAMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKHGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVLKKKESVL
>NZ_CP029454.1|WP_001228100.1|1061689_1063111_+|protoporphyrinogen-oxidase
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSVANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAGDEAVVEQTEEELVQLVLEDLKKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKQLTTFMEKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
>NZ_CP029454.1|WP_000453718.1|1063167_1064520_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLETIATKVDDLKIVYSDETSLIVELHMGETVIPYELHIDEPNDPEGYKMYNRQDATIVDRNFEDAAFGTEIFTRTLFVGDVLDCFFQQLQFLWNLAPDLLFVIDSSAAMKVISRSYIEYHVENELLPDIPDLYVIHSVYEDDKDGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGISDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPIDAQNTFLGGMDARDEYHQSPSVLLFKFNTSEEYIESFFKEHEEATGLMFYKTNSETDRMAYNAKNTFGYFSNIFHIEQSNEDFRFLAKFGVSYEEGKSEHMWFEMQNITEDFIQGILINEPYFIEDMSEGNSYHLDFDNLTEWVIYAGDAVIKPNNLYMFIGE
>NZ_CP029454.1|WP_098219363.1|1064761_1067128_+|endonuclease
MAVKKLLSVFLSFLLLLSFTGTLAQAEETASMSVEKAIQVFKQQGKTKGIVEGYIVGYTQSSSKYTKDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRTAVNVKDHPENIGKKVSLTGTLELYFSNPGLKSVTAYKFQGEGQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIIVNENSVVKAIAEKEGLTTSAISTFSFIIVNNEQVRIHDIQGKSHISPYNGKKVNNVEGVVTALDKNGFYIEDNQPDNDPATSEGMYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFETDLTTTEIKASRVAVIAKDQSLPAPIVLGENGVKIPDQIIDNDAFGLFDPNEDAIDFYESIEGMRVTMPTPKIITPQKNGNLYVTVKNGGDKIVTQYGTPLLDENQLNPERLSVKVPRDYVAKVGDTFTGDITGVVGYDYGSFRISPITELPAVVDGGFKQVGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGSINDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNQDGGAPGANIRVGFFYNPSRVKLATVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNIVVVANHLNSKLGDATPFGKVQPLVLKSEDKRIQLAQEVNYFVQGIQKKNTNAPVVVLGDMNDFEFSKPLKTLEGTILKDMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNSNIMKEHGRVSDHDPVLAQIDLKKAS
>NZ_CP029454.1|WP_001176845.1|1067260_1067560_+|hypothetical-protein
MQLQINGKVMNQFAIFFSTIIMLQFVADITGLTSNLDITYNLIHTAASYITFSLAVIFTLIGARRELSKYAIVSLCLVVGIKAIYFVAVVILWGVAGTP
>NZ_CP029454.1|WP_000984174.1|1067613_1068459_-|hypothetical-protein
MMRALRLNIKQAFCSRISLIMMLSGFVLICIYHYYYVIRYLGNAANGPISTDLKWIGFRDNEMDVYLLLMPVIASFPFSTSYNSDKSDGFKPFVSKGISIFPYSVAKYIVTFFCGGFLYTLPFILSLLFCKLTIPDGTPTVGSGIINADGMFANLYFDAPLTYIAVYIGINFLFAGLMALLGLAASVWSQKDYMAILFPFAAASIPYVLLNTILPSIGGAPFHLYDPKQPLQGMSPYILMTQCAFFLFVSLLMYIQGVKRDRKKYKRRLQKRERCRKAFQV
>NZ_CP029454.1|WP_000184509.1|1068688_1069090_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWSSSPQTANEIIEELEDAMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRILDEKTEENKRKDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP029454_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029454_2

3547459-3549762

Orphan

Consensus_repeat	Method
GNGCNACTGGACCTCANG	CRT

44 spacers

The CRISPR arrays of NZ_CP029454_2

>merge|NZ_CP029454|2|3547459-3549762|CRT
GCGCTACTGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGGCCTCAAGGTAACACGGGCGCTACTGGCGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACAGGCGCTACCGGTGCCACTGGGCCTCGAGGTAATACGGGCGCTACTGGCGCTACTGGGCCTCAAGGTAACACGGGCGCTACTGGCGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGTGCCACTGGACCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACAGGCGCTACCGGTGCCACTGGGCCTCGAGGTAATACGGGCGCTACTGGCGCTACTGGGCCTCAAGGTAACACGGGCGCTACTGGCGCCACTGGACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGGGCGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAGGGACCTCAAGGTAACACGGGTGCTACTGGTGCTACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAGGGACCTCAAGGTAACACGGGTGCTACTGGTGCTACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAGGGACCTCAAGGTAACACGGGTGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAGGGACCTCAAGGTAACACGGGTGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACCGGCGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACCGGCGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGTGCTACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACTGGCGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACAGGCGCTACCGGGCCTCAAG

>NZ_CP029454|2|1|3547459-3549762|CRT
GCGCTACTGGTGCCACTG	GGCCTCGAGGTAACACGGGCGCTACCGGCGCTACTGGGCCTCAAGGTAACACGG
GCGCTACTGGCGCCACTG	GACCTCAAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGGCCTCGAGGTAACACGG
GCGCTACCGGCGCTACTG	GGCCTCGAGGTAACACGGGCGCTACTGGCGCTACCGGTGCCACTGGACCTCGAGGTAACACGG
GCGCTACTGGCGCTACCG	GTGCCACTGGGCCTCGAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGG
GCGCTACTGGCGCTACCG	GTGCCACTGGGCCTCGAGGTAACACAGGCGCTACCGGTGCCACTGGGCCTCGAGGTAATACGG
GCGCTACTGGCGCTACTG	GGCCTCAAGGTAACACGGGCGCTACTGGCGCCACTGGACCTCAAGGTAACACGG
GCGCTACTGGCGCTACCG	GCGCTACTGGGCCTCGAGGTAACACGGGCGCTACTGGCGCTACTGGTGCCACTGGACCTCGAGGTAACACGG
GCGCTACTGGCGCTACCG	GTGCCACTGGGCCTCGAGGTAACACAGGCGCTACTGGTGCCACTGGACCTCAAGGTAACACGG
GCGCTACTGGCGCTACCG	GTGCCACTGGGCCTCGAGGTAACACAGGCGCTACCGGTGCCACTGGGCCTCGAGGTAATACGG
GCGCTACTGGCGCTACTG	GGCCTCAAGGTAACACGGGCGCTACTGGCGCCACTGGACCTCAAGGTAACACGG
GCGCTACTGGCGCTACCG	GTGCCACTGGGCCTCGAGGTAACACGG
GCGCTACTGGCGCTACCG	GTGCCACTGGGCCTCGAGGTAACACGG
GCGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAG
GCGCTACTGGACCTCAAG	GTAACACAGGTGCTACTG
GCGCTACTGGACCTCAAG	GTGCTCAAGGTAACACGGGTGCTACTG
GTGCCACTGGACCTCAGG	GACCTCAAGGTAACACGGGTGCTACTG
GTGCTACTGGACCTCAAG	GTGCTCAAGGTAACACGGGTGCTACTG
GTGCCACTGGACCTCAAG	GTGCTCAAGGTAACACGGGTGCTACTG
GTGCCACTGGACCTCAGG	GACCTCAAGGTAACACGGGTGCTACTG
GTGCTACTGGACCTCAAG	GTGCTCAAGGTAACACGGGTGCTACTG
GTGCCACTGGACCTCAAG	GTAACACGGGTGCTACTG
GTGCCACTGGACCTCAGG	GACCTCAAGGTAACACGGGTGCTACTG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAGGTGCTACTG
GTGCCACTGGACCTCAAG	GTGCTCAAGGTAACACGGGTGCTACTG
GTGCCACTGGACCTCAGG	GACCTCAAGGTAACACGGGTGCTACTG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAGGTGCTACTG
GTGCCACTGGACCTCAAG	GTGCTCAAGGTAACACGG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAG
GCGCTACTGGACCTCAAG	GCGCTCAAGGTAACACAGGCGCTACTG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAGGTGCTACTG
GTGCCACTGGACCTCAAG	GTAACACAGGCGCTACTG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAGGTGCTACTG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACAGGCGCTACCGGCGCTACTG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACAGGTGCTACTG
GCGCTACTGGACCTCAAG	GCGCTCAAGGTAACACAGGTGCTACTG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACAGGCGCTACCGGCGCTACTG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAGGTGCTACTG
GCGCTACTGGACCTCAAG	GCGCTCAAGGTAACACAGGTGCTACTG
GTGCTACTGGACCTCAAG	GTGTTCAAGGTAACACAGGCGCTACTG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACAGGCGCTACCG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACGGGTGCTACTGGCGCTACTG
GTGCCACTGGACCTCAAG	GTGCTCAAGGTAACACAGGCGCTACTG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACAGGCGCTACCG
GTGCCACTGGACCTCAAG	GTGTTCAAGGTAACACAG
GCGCTACCGGGCCTCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029454.1\|WP_000640830.1\|3555200_3556112_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP029454.1\|WP_000228314.1\|3558298_3558841_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP029454.1\|WP_000460289.1\|3541287_3542559_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP029454.1\|WP_000391395.1\|3542551_3543826_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP029454.1\|WP_048567458.1\|3536955_3537714_-\|antirepressor	unknown	unknown	gnl\|CDD\|371131
NZ_CP029454.1\|WP_000704599.1\|3553330_3555187_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP029454.1\|WP_000092763.1\|3539329_3540664_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP029454.1\|WP_000504957.1\|3550588_3551542_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP029454.1\|WP_000814426.1\|3551722_3551968_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_000813896.1\|3550342_3550567_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP029454.1\|WP_001179092.1\|3557018_3558182_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP029454.1\|WP_000656783.1\|3540712_3541102_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP029454.1\|WP_000450319.1\|3545880_3546846_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP029454.1\|WP_000438176.1\|3544810_3545767_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP029454.1\|WP_000283431.1\|3537916_3538129_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_103595474.1\|3559158_3559476_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_000734613.1\|3552030_3552981_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP029454.1\|WP_000312267.1\|3543918_3544542_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP029454.1\|WP_033683142.1\|3538333_3538993_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885
NZ_CP029454.1\|WP_002000547.1\|3556108_3556918_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268

Protein	Function_ID	Function_description	E-value
NZ_CP029454.1\|WP_000640830.1\|3555200_3556112_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	5.6001e-143
NZ_CP029454.1\|WP_000228314.1\|3558298_3558841_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	3.82961e-56
NZ_CP029454.1\|WP_000460289.1\|3541287_3542559_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP029454.1\|WP_000391395.1\|3542551_3543826_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP029454.1\|WP_048567458.1\|3536955_3537714_-\|antirepressor	gnl\|CDD\|371131	pfam10552, ORF6C, ORF6C domain. This domain was identified by Iyer and colleagues.	5.36631e-36
NZ_CP029454.1\|WP_000704599.1\|3553330_3555187_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	1.82614e-143
NZ_CP029454.1\|WP_000092763.1\|3539329_3540664_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP029454.1\|WP_000504957.1\|3550588_3551542_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	7.80471e-165
NZ_CP029454.1\|WP_000813896.1\|3550342_3550567_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP029454.1\|WP_000656783.1\|3540712_3541102_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP029454.1\|WP_000450319.1\|3545880_3546846_+\|site-specific-integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	9.07412e-13
NZ_CP029454.1\|WP_000438176.1\|3544810_3545767_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	5.4824e-156
NZ_CP029454.1\|WP_001179092.1\|3557018_3558182_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP029454.1\|WP_000734613.1\|3552030_3552981_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.68064e-36
NZ_CP029454.1\|WP_000312267.1\|3543918_3544542_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.8015e-60
NZ_CP029454.1\|WP_033683142.1\|3538333_3538993_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	3.31987e-29
NZ_CP029454.1\|WP_002000547.1\|3556108_3556918_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	5.69155e-81

>NZ_CP029454.1|WP_000450319.1|3545880_3546846_+|site-specific-integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKTNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISPDEEKRLKYIVTSLEGLSEKQLPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLAKEDKKQLYNYYKSIPEPVRPKYHSDDPLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALL
>NZ_CP029454.1|WP_000438176.1|3544810_3545767_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISNETAIKHEMLQRIEEEMGKLVGMEDIKKIIKEIYAWIYVNKKRQEKGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEDREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKNDLIGISSVDLMLEEETHST
>NZ_CP029454.1|WP_000312267.1|3543918_3544542_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYILFILIVCFRMVSIHYKWHLPHRRIETKERSMHK
>NZ_CP029454.1|WP_000391395.1|3542551_3543826_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYIGHEKTVKRLLSELEINHIPVITLYNKKDELHQNFIPFPKSDFLMTSAFEESDLLRIKEAIETKMKKEMDRYRVEIPPSEGKLLTLLKTETLLAKMEFLEDKFVYDCAGYIFTHSSLNVQLKRFLVEEGENKNV
>NZ_CP029454.1|WP_000460289.1|3541287_3542559_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEAGLVDFEAVAAAIHNNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP029454.1|WP_000656783.1|3540712_3541102_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP029454.1|WP_000092763.1|3539329_3540664_-|type-I-glutamate--ammonia-ligase
MSRYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVRQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDANGDLQLSDDARHFIAGILKHAPAFTAIANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP029454.1|WP_033683142.1|3538333_3538993_+|helix-turn-helix-domain-containing-protein
MKKAEVVTRLIKEAGYSKRAFAEKIGLPPTTLQSMLSRGIGKASVDNVIKVCKGLGITTDDLERLATQEDNTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENIEGYLPMLSTFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISKSGSIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQAVKNY
>NZ_CP029454.1|WP_000283431.1|3537916_3538129_-|hypothetical-protein
MYPNLRAEMARKRIMITQISSHLKLRHATVSDKINGKFRFYYDEAFEIKKTFFPEHSLEYLFEFEENEAN
>NZ_CP029454.1|WP_048567458.1|3536955_3537714_-|antirepressor
MRQLTDSSVHSSLVFEVNGKVVTDSLVIAKIFKKNHLDVLKEVRKQIVYVGEEFGGENFHESTYVNSKNRRISKYDLTEEAFTLLVMGYTSREAVGMKIKFMKEFKRMKQYIQNQQNVPKDPMGVLKLTFAALEGHTQEIQEIKSEVKGLRENMPLYAIECEEITRAVKRLGVILLGGKNSNSYQDIGLRRKLYRDIYSQLHREFGVNSYKAIKRHHLDRAIQIINEEYSIPTVLNEEITVKNSQINMADIQ
>NZ_CP029454.1|WP_000813896.1|3550342_3550567_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP029454.1|WP_000504957.1|3550588_3551542_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSINLAKALNGEIISGDSMQIYRTMDIGTAKVTKAEMDGIPHYMIDIKNPEDSFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSEQIEKQEKELLYDVSLIGLTMDREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFENRVSLEDAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTNGEKTSEILRYIEGKLQVKSNNSK
>NZ_CP029454.1|WP_000814426.1|3551722_3551968_+|hypothetical-protein
MKQSTINFSSLTKDLILATSIKEQNCSQEELYFALNCLLRAFHSTLHETTLHPENKNTEYIQTQFCSAYKIITGKTIYPFQ
>NZ_CP029454.1|WP_000734613.1|3552030_3552981_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPNVESKLVGKVLSGNTLDVINTENGWTKIKLNGKEAFVSADFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVIEKKEVVAQEEAPARTNTPVKNNTVVKNKESVKSNDSIKNVESSKPVVKEKPAAKPVAKSTETSAPTGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIQ
>NZ_CP029454.1|WP_000704599.1|3553330_3555187_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMDLTASNKEAVIDELVEKLNGANRLNSKMEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDESELLQLFDEKENEKEEEIEVAKPEVNEPYVLAVTACPTGIAHTYMAADSLKAKATELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTETLLNRAVKQDAPIFKGVKEDGKAESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAANANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKAVIPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMLGVWKKKVQ
>NZ_CP029454.1|WP_000640830.1|3555200_3556112_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSFDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENIALGFTGGFTGQFIKGVLQAEGVMTNFIQVDGDSRINVKIKGQEETELNGQGPNVTNEQFEQLMKQIESMKQGDCVVLAGSVPASIPTTFYESIAALGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVELSTVEDVLPYGRKLIEQGIKHVIVSMAGEGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCKKEKVEELLSQVIVAKR
>NZ_CP029454.1|WP_002000547.1|3556108_3556918_-|DeoR/GlpR-transcriptional-regulator
MVDFCDRFHYTVIKEEVNKMLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIANYAASVIEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP029454.1|WP_001179092.1|3557018_3558182_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFANEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTTSVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCEAVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVEENVSRFKQFAIRVFDIETDGKTDKEVALEGIKALRQFWTSIEAPATLADYGIGENEIDIMANKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP029454.1|WP_000228314.1|3558298_3558841_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGELHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP029454.1|WP_103595474.1|3559158_3559476_-|hypothetical-protein
MIMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYANVNYEQIPFVIFFMIRFITAIVRKKESDDEECHSTCNIANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP029454_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP029454_3

5054964-5055097

Orphan

Consensus_repeat	Method
GTTGATTTCTCTTCTTTTTGAGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP029454_3

>merge|NZ_CP029454|3|5054964-5055097|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGGTTCTTCTTTTTTGTCACTAGTTGAACCGCTTGTTGATTTCTCTTCTTTTTGAGACTTGTCTTCTGTTTTACTTTCAGGTTTCGTGCTCGTTGACTTCTCTTCTTTTTGAGA

>NZ_CP029454|3|2|5054964-5055097|CRISPRCasFinder
GTTGATTTTTCTTCTTTCTTCGG	TTCTTCTTTTTTGTCACTAGTTGAACCGCTT
GTTGATTTCTCTTCTTTTTGAGA	CTTGTCTTCTGTTTTACTTTCAGGTTTCGTGCTC
GTTGACTTCTCTTCTTTTTGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP029454.1\|WP_000144442.1\|5055984_5056689_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP029454.1\|WP_087965178.1\|5062583_5064104_-\|NADH-quinone-oxidoreductase-subunit-NuoN	unknown	unknown	gnl\|CDD\|235603
NZ_CP029454.1\|WP_000544012.1\|5054060_5054333_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP029454.1\|WP_048655553.1\|5047319_5048201_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP029454.1\|WP_001207165.1\|5049317_5050019_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP029454.1\|WP_087965184.1\|5056688_5057531_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP029454.1\|WP_087965182.1\|5057711_5058719_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP029454.1\|WP_000393157.1\|5050008_5050752_-\|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|226453
NZ_CP029454.1\|WP_048655554.1\|5048442_5049210_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NZ_CP029454.1\|WP_000672663.1\|5058818_5059838_-\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP029454.1\|WP_000057889.1\|5062144_5062381_-\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|227173
NZ_CP029454.1\|WP_080348301.1\|5046622_5047303_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP029454.1\|WP_000411274.1\|5060044_5061349_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP029454.1\|WP_000931959.1\|5052036_5052471_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP029454.1\|WP_048655555.1\|5051015_5051693_-\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP029454.1\|WP_002005985.1\|5061388_5062099_-\|YwmB-family-TATA-box-binding-protein	unknown	unknown	gnl\|CDD\|370056
NZ_CP029454.1\|WP_000457978.1\|5052898_5053900_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP029454.1\|WP_000008903.1\|5054641_5054776_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP029454.1\|WP_000568227.1\|5065604_5067467_-\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP029454.1\|WP_061655619.1\|5064105_5065608_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622

Protein	Function_ID	Function_description	E-value
NZ_CP029454.1\|WP_000144442.1\|5055984_5056689_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	0.000949194
NZ_CP029454.1\|WP_087965178.1\|5062583_5064104_-\|NADH-quinone-oxidoreductase-subunit-NuoN	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	1.06603e-148
NZ_CP029454.1\|WP_000544012.1\|5054060_5054333_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	1.17272e-38
NZ_CP029454.1\|WP_048655553.1\|5047319_5048201_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	0
NZ_CP029454.1\|WP_001207165.1\|5049317_5050019_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	9.26469e-84
NZ_CP029454.1\|WP_087965184.1\|5056688_5057531_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.35466e-90
NZ_CP029454.1\|WP_087965182.1\|5057711_5058719_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.37128e-31
NZ_CP029454.1\|WP_000393157.1\|5050008_5050752_-\|capsular-polysaccharide-biosynthesis-protein	gnl\|CDD\|226453	COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane].	3.02692e-83
NZ_CP029454.1\|WP_048655554.1\|5048442_5049210_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.25857e-103
NZ_CP029454.1\|WP_000672663.1\|5058818_5059838_-\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	5.80584e-135
NZ_CP029454.1\|WP_000057889.1\|5062144_5062381_-\|DUF1146-domain-containing-protein	gnl\|CDD\|227173	COG4836, COG4836, Predicted membrane protein [Function unknown].	1.23409e-23
NZ_CP029454.1\|WP_080348301.1\|5046622_5047303_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	7.40499e-88
NZ_CP029454.1\|WP_000411274.1\|5060044_5061349_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP029454.1\|WP_000931959.1\|5052036_5052471_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.26499e-95
NZ_CP029454.1\|WP_048655555.1\|5051015_5051693_-\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	3.07196e-82
NZ_CP029454.1\|WP_002005985.1\|5061388_5062099_-\|YwmB-family-TATA-box-binding-protein	gnl\|CDD\|370056	pfam08680, DUF1779, TATA-box binding. TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).	5.16446e-34
NZ_CP029454.1\|WP_000457978.1\|5052898_5053900_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP029454.1\|WP_000568227.1\|5065604_5067467_-\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP029454.1\|WP_061655619.1\|5064105_5065608_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	5.05772e-177

>NZ_CP029454.1|WP_000008903.1|5054641_5054776_-|hypothetical-protein
MSFLFVLSTAIILLFVLFTLYYYIAGKKEVPHHQLLEEELEREE
>NZ_CP029454.1|WP_000544012.1|5054060_5054333_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELANEVKEILDYHKSIRHLRGGEATKQKYRKEDVEKPVRQ
>NZ_CP029454.1|WP_000457978.1|5052898_5053900_-|rod-shape-determining-protein
MFARDIGIDLGTANVLIHVKGKGIVLNEPSVVAIDRNSGKVLAVGEEARSMVGRTPGNIVAIRPLKDGVIADFEITEAMLKYFINKLDVKSFFSKPRILICCPTNITSVEQKAIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQPSGNMVVDIGGGTTDIAVLSMGDIVTSSSIKMAGDKFDMEILNYIKRKYKLLIGERTSEDIKIKVGTVFPGARSEELEIRGRDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPPELSADIIDRGVILTGGGALLHGIDMLLAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR
>NZ_CP029454.1|WP_000931959.1|5052036_5052471_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MLNIEQIKEIIPHRYPFLLVDKILEVDEGKRAVGIKNVSANEEFFNGHFPDYAVMPGVLIVEALAQVGAVAVLKKEENRGRLAFFAGIDNCRFKKQVRPGDQLRLEVEMTRVRGPIGKGKAIATVDGEVACEAEITFAIGDKKE
>NZ_CP029454.1|WP_048655555.1|5051015_5051693_-|CpsD/CapB-family-tyrosine-protein-kinase
MFGRKKRKPLRQLITHKEPKSRITEQYRNIRTNIEFTSVDNHVRSIIVTSADPGDGKTTTIANLAVVFGQQGKKVLLIGADLRKPTIQNLFAIHSSNGLTNLLSGQAKLVQCIQKTDIENVYLMAAGPIPPNPAELLGSRAMDEALLEAYNMFDIILIDTPPVLAVTDAQILANKCDGIVLVVRSEKTEKDKIVKAKQILDKASGKLLGVVLNDKREEKEQYGYY
>NZ_CP029454.1|WP_000393157.1|5050008_5050752_-|capsular-polysaccharide-biosynthesis-protein
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQTNIQLTNTYKVIIKSPVILEQVNEKLNLNMTAQELTKKVNVANEKDSQVIAVTAEDKDPKIARDIANATADVFKGEVAKIMNVDNVTVISKAEVAENQSPIKPAPMLNVAIAFIVGLMASVGLAFLLEYLDNTVKKEEDVETLLGLPVLGIVARMDEETMNVKSHAPSSRKVRGQTIGS
>NZ_CP029454.1|WP_001207165.1|5049317_5050019_-|CpsD/CapB-family-tyrosine-protein-kinase
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>NZ_CP029454.1|WP_048655554.1|5048442_5049210_-|tyrosine-protein-phosphatase
MIDLHCHILHGIDDGAQTVTDSLAMAQQAVSEGIHTIVATPHHQNGKYINERTSIIHHVKQLNDELQQHNIPLTILPGQEIRLYGDLLEDYEAGKIVTLNETNKYIFIEFPSNHVPRYAEHLLYELRVKGMIPIIVHPERNAELIERPDKLYNLVNKGALTQVTAGSLLGKFGKKIKKFSLQLVEHNLTHMVASDAHNITSRGFHLAESYELIEKEFGMNVMSDLKENPYLLISGKAIYKEDPEQIRRKKLFGIF
>NZ_CP029454.1|WP_048655553.1|5047319_5048201_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQSLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIVQADTPCLRQLMDQYEGTQSSVIGVQTVSENETHRYGIIDPVEQNERRYQVRQFVEKPVQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEMALQHKELKDELLEYMTELIKIENIHV
>NZ_CP029454.1|WP_080348301.1|5046622_5047303_-|sugar-transferase
MEERGLIHKSVEKEISVVKKTSIFYAFFKRTLDIIGAIVGLIVFSPFFIIIPILYMRGDAKGPVFFRQSRIGKDGKVFGIYKFRSMVVNAEEKLEKNEVLYKKYVDNNYKLEPEEDPRITNIGRFLRRTSLDELPQFINVLKGDMSLVGPRPVIQEELKEYGSKTSDFLSVSPGLTGYWQVSGRSDVGYPERVDIELYYVYNQSLKLDIIILFKTVLLVVLRKGAY
>NZ_CP029454.1|WP_000144442.1|5055984_5056689_-|ABC-transporter-permease
MTFSMRRVSAIFRKEVQDFKTNSQVLLMAFLPIILSFLFSRFGAGKEMLGITTITAFLFVAGFVQSMVIAEEKEKHTLRVLMLSPASSVEVLLGKSILTACLTLGICIVNLFILDQFSGNLLLLGFIFLCGTILFIVIGTMIGLLAASVPQTSIIGMPILMTMYLAVQFEPMVENKVIKTMIGYLPTSHIVKALNSLVGGAGFSSISGHVLNVAVWLIISLFVCLIVYKKKQLD
>NZ_CP029454.1|WP_087965184.1|5056688_5057531_-|ABC-transporter-ATP-binding-protein
MTLAIEMKDVMKSFNEKTALRNVNIEVKQGEIFGFLGPSGSGKTTTVKILTSQLLHSVGTVRVLGKDITGPSSIDYKRIGILTDNSGLYERLSIYDNLLLFCDLYDCKKERIDEVLAQVNLLDDKKTPVKKLSKGMKQRVTLARAILHKPDILFLDEPTSALDPVNVQNIHKILKDLNKEGTTIFLTTHNMDEAETLCNRIAFLCGGEIVALDTPENLRLQYAKDQIQVVLKDKKKETVHKDELGAKRISEWMNKGELLSIHSHEPTLGDIFIEVTGRGL
>NZ_CP029454.1|WP_087965182.1|5057711_5058719_-|ATP-binding-cassette-domain-containing-protein
MALLELKQLGKANQLPEMELKVEKGQCIVLQCNNHTAKVLHRIIIGQEEASTGNVLFEGEAIGKKNYSRIGFCFLKDEAYDRLKVKEYFKFLIGLYESKISIEEVVQSVGLLDKLNVKIEKLSFSEKRRLHIGRVMIHNPDLIILEEPEQNVDIESTVIIRKAIMKMKEQGKAIFITSSFLSDALSLTEDVYILNNDGVKKVEIEQEEVEEVDEEKVVQIIPQMKLERIPAKVNDKIILLDPMEIHFIETQNGVTHIHVREGDFVCALTLGELEARLTGFGFFRCHRSYLVNLQRVREVITWTRNSFSLILDDERKSSIPLSKGRMDELKGVIGL
>NZ_CP029454.1|WP_000672663.1|5058818_5059838_-|stage-II-sporulation-protein-D
MKFSKPLFITVALLIALVIIVPAALVIPFAKAKVGEETASKTPPAIESIPAPGKVDTAVQVAVYREKQKKVETLPVEEYVTGVVASEMNASFEIEALKAQALAARTFVVQRMLSGGKKNNADVTDTVKDQVYKSKDELKKQWGNNYENNLKKIEEAVSKTAGQVLTYDGKPISASFFSTSNGRTENAADYWGNDYPYLKSVDSPWDQASPKFTSEQTFTVADFQKRLGVKVLADGKVGNIKDLTEGKRVKDVAFQGKTLTGKEVREKLDLRSSDFTWKQQGDKIIVTTKGFGHGVGMSQYGANGMAAEGKKYTDIVAHYYKGVEIKTMNDYEGKLMVKK
>NZ_CP029454.1|WP_000411274.1|5060044_5061349_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTFMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVAATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVNFHKKLAALGATIERVNEKVEEVKEQEVSDLHA
>NZ_CP029454.1|WP_002005985.1|5061388_5062099_-|YwmB-family-TATA-box-binding-protein
MKLKLKAILIVALSVVLFLVGYREMKPISDEQKMESMIKALEKNDAKVEKWSWLARETKTISNIHTFQKLLNDVKEKANIQKWEVEQSPDGYKATSYKKLSSYEERVVVTWSKENTKENTFIIFEVSGAKWDPKYVQNMNKIFSEKPIIYTCVQGVLNDKIEGVLQNKTNQVLKDLSARAIEQVEERAFVSVSAYNKKWDDALSTNREKINVQIAIRSTDNKDTIVVGTPIITSEY
>NZ_CP029454.1|WP_000057889.1|5062144_5062381_-|DUF1146-domain-containing-protein
MAQLLGQQALIAIVSHLLFITITWWALQGIHIERLMKSGKVLQTRVLLILITIAIGTSVSNFFLDYLGYSKSLTYLVK
>NZ_CP029454.1|WP_087965178.1|5062583_5064104_-|NADH-quinone-oxidoreductase-subunit-NuoN
MDMNTLLSLSWYLMVPEFIILGAAILLSICDLFFKLNHRYVALGAIAAIVLAIVSLITLYSEPAGDILNGSFVLDGFSKGFKTLLLGASALILCTAMSDDKKNPIEDKGEYYYLFLMALLGAMFMASSVDFITFFVGLELLSLSSYILVGIRKKSRASNEAAMKYVISGGIGTAITLFGMSYLYGITGSTNIVDMQKVLTGELASGIQLLLALAFLLLLVGLSFKIATVPFHMWAPDVYEGAATPVTAFLGTISKIAGFLLIIRLFLMVFASVLIQGDMQSLYGHMSIYIAVLASITMIVGNVVALKQYNIKRLFAYSGIAHAGYLLVPLVALSPFTMDSMWFYMLAYMLMNIGAFAIIHGLILQNDEENITIFTGLYKRSPFAAIMMTIFILSLAGIPGTAGFIGKINIFLGALHVEPAHYVLASIMMGTTVVSFVYYFRILQQMFFRTGETEERIRLPLNIKVVMSLCAISIVILGIMPMIGYNFFYEYFPLMKDFFFLGNVVQ
>NZ_CP029454.1|WP_061655619.1|5064105_5065608_-|NADH-quinone-oxidoreductase-subunit-M
MNDLLLTFFIFSPLLGILLLVLTPKKELRTVRALGLFGTALPFGIAIVLACTYASGKNLSLFDEKVKWIKFGDFTAVDKRWFSIYYELGIDGLSLVMMVLTALLAMLAAIAAFSIKRNLKAFYMLLLMLEIGMLGVFAAQNLMLFFIFFEITLPPMFLLIGKWGKLSSEKAAYSYLIYNGIGSAILLIVFSILFAKTGTTNIVELKEILRSINAEGALVIPSSLQLSVFIAIMIAFAIKLPVFPLHRWMVNVHIEAHPAVVMLHAGVLLKIGAYGIIRFGKGLFPEYFHDVATLIAILGVINLLYGAFLALIQTDFRKVLAYSSISHMGIVLMGLASLNAPGTQGALFQVVSHGLIAALLFFLLGVIEQRFGTSDITVLGGLAKSVPILSGFFLAGGMASLGLPGMSGFVSEFLAFLGLFQGEPVIAAVGVIGIILTAVYVLRATLQVTFGKKEWEAKTDIHGWEYVPVLLLIFCIIAIGVMPEILGDPLQNTLKTLGVK
>NZ_CP029454.1|WP_000568227.1|5065604_5067467_-|NADH-quinone-oxidoreductase-subunit-L
MIDYAWLIPLFPLVSFLLLIIFGKKIREGSSVLSIFFVFLSFILAVLVLIERFSEASVKHKWVWLRAGDVDISFGFEVTALGALMLFIVTLVSLLVHVYSKGYMKGDERLPTFYAYLGLFTFAMLGLVISTNLLQLYIFWELVGLGSFLLIGFYFFKEEAKAAAKKAFIMTRIGDVGLFIGMILIFWYAGSFEYDAIFRAIYTGDLPPYMITITAILIFIGAMGKSGQFPLHTWLPDAMEGPTPVSALIHAATMVAAGVYLVATMFPLFSASTVAMQTVAIVGAFTAIFAASIGLVQTDIKRVLAYSTVSQLGYMMLALGSAGYVAGIFHLTTHAFFKALLFLAAGSVIHAVHTQNINKMGGLQKKMKVTGTLFLIGTLAISGVPLLSGFFSKDEILAATWMNGNYVLFTLAVIAAFLTAFYMFRLYFLVFTGETKTKEEVHESPRVMTYPMIVLGVLAVVAGYINTPWFGTFLGDWLTKDVGFKVEEAHGPVWIMIVATLVSFAGIALAYFIYGKKSISRNWAGGTETSLYNLLKEKYYVDELYNMTVIPITKGIAHVLRLFEVYVVEGIAVLIGSVVKGTSNLGSKLQNGNVQVYGTVTAVSLAVLVIILLYTGGDLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP029454_1	1.1\|1056630\|31\|NZ_CP029454\|CRISPRCasFinder	1056630-1056660	31	NZ_CP029454.1	1107425-1107455	2	0.935

1. spacer 1.1|1056630|31|NZ_CP029454|CRISPRCasFinder matches to position: 1107425-1107455, mismatch: 2, identity: 0.935

cgagttgcgctgatatattcagaaaaacgct	CRISPR spacer
cgagttgcgctgatatattcaaaaaatcgct	Protospacer
*********************.**** ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP029454_2	2.16\|3548476\|27\|NZ_CP029454\|CRT	3548476-3548502	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	3	0.889
NZ_CP029454_2	2.16\|3548476\|27\|NZ_CP029454\|CRT	3548476-3548502	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	3	0.889
NZ_CP029454_2	2.19\|3548611\|27\|NZ_CP029454\|CRT	3548611-3548637	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	3	0.889
NZ_CP029454_2	2.19\|3548611\|27\|NZ_CP029454\|CRT	3548611-3548637	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	3	0.889
NZ_CP029454_2	2.22\|3548737\|27\|NZ_CP029454\|CRT	3548737-3548763	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	3	0.889
NZ_CP029454_2	2.22\|3548737\|27\|NZ_CP029454\|CRT	3548737-3548763	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	3	0.889
NZ_CP029454_2	2.25\|3548872\|27\|NZ_CP029454\|CRT	3548872-3548898	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	3	0.889
NZ_CP029454_2	2.25\|3548872\|27\|NZ_CP029454\|CRT	3548872-3548898	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	3	0.889
NZ_CP029454_2	2.15\|3548431\|27\|NZ_CP029454\|CRT	3548431-3548457	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	4	0.852
NZ_CP029454_2	2.16\|3548476\|27\|NZ_CP029454\|CRT	3548476-3548502	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.17\|3548521\|27\|NZ_CP029454\|CRT	3548521-3548547	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	4	0.852
NZ_CP029454_2	2.18\|3548566\|27\|NZ_CP029454\|CRT	3548566-3548592	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	4	0.852
NZ_CP029454_2	2.19\|3548611\|27\|NZ_CP029454\|CRT	3548611-3548637	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.20\|3548656\|27\|NZ_CP029454\|CRT	3548656-3548682	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	4	0.852
NZ_CP029454_2	2.22\|3548737\|27\|NZ_CP029454\|CRT	3548737-3548763	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.23\|3548782\|27\|NZ_CP029454\|CRT	3548782-3548808	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.23\|3548782\|27\|NZ_CP029454\|CRT	3548782-3548808	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.23\|3548782\|27\|NZ_CP029454\|CRT	3548782-3548808	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.23\|3548782\|27\|NZ_CP029454\|CRT	3548782-3548808	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.24\|3548827\|27\|NZ_CP029454\|CRT	3548827-3548853	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	4	0.852
NZ_CP029454_2	2.25\|3548872\|27\|NZ_CP029454\|CRT	3548872-3548898	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.26\|3548917\|27\|NZ_CP029454\|CRT	3548917-3548943	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.26\|3548917\|27\|NZ_CP029454\|CRT	3548917-3548943	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.26\|3548917\|27\|NZ_CP029454\|CRT	3548917-3548943	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.26\|3548917\|27\|NZ_CP029454\|CRT	3548917-3548943	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.30\|3549079\|27\|NZ_CP029454\|CRT	3549079-3549105	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.30\|3549079\|27\|NZ_CP029454\|CRT	3549079-3549105	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.30\|3549079\|27\|NZ_CP029454\|CRT	3549079-3549105	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.30\|3549079\|27\|NZ_CP029454\|CRT	3549079-3549105	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.32\|3549160\|27\|NZ_CP029454\|CRT	3549160-3549186	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.32\|3549160\|27\|NZ_CP029454\|CRT	3549160-3549186	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.32\|3549160\|27\|NZ_CP029454\|CRT	3549160-3549186	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.32\|3549160\|27\|NZ_CP029454\|CRT	3549160-3549186	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.34\|3549259\|27\|NZ_CP029454\|CRT	3549259-3549285	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.34\|3549259\|27\|NZ_CP029454\|CRT	3549259-3549285	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.34\|3549259\|27\|NZ_CP029454\|CRT	3549259-3549285	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.34\|3549259\|27\|NZ_CP029454\|CRT	3549259-3549285	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.35\|3549304\|27\|NZ_CP029454\|CRT	3549304-3549330	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.35\|3549304\|27\|NZ_CP029454\|CRT	3549304-3549330	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.35\|3549304\|27\|NZ_CP029454\|CRT	3549304-3549330	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.35\|3549304\|27\|NZ_CP029454\|CRT	3549304-3549330	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.37\|3549403\|27\|NZ_CP029454\|CRT	3549403-3549429	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.37\|3549403\|27\|NZ_CP029454\|CRT	3549403-3549429	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.37\|3549403\|27\|NZ_CP029454\|CRT	3549403-3549429	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.37\|3549403\|27\|NZ_CP029454\|CRT	3549403-3549429	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.38\|3549448\|27\|NZ_CP029454\|CRT	3549448-3549474	27	MN163280	Klebsiella phage KpGranit, complete genome	83374-83400	4	0.852
NZ_CP029454_2	2.38\|3549448\|27\|NZ_CP029454\|CRT	3549448-3549474	27	MN163280	Klebsiella phage KpGranit, complete genome	84577-84603	4	0.852
NZ_CP029454_2	2.38\|3549448\|27\|NZ_CP029454\|CRT	3549448-3549474	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.38\|3549448\|27\|NZ_CP029454\|CRT	3549448-3549474	27	MN101228	Klebsiella phage KPN4, complete genome	27719-27745	4	0.852
NZ_CP029454_2	2.40\|3549538\|27\|NZ_CP029454\|CRT	3549538-3549564	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.43\|3549682\|27\|NZ_CP029454\|CRT	3549682-3549708	27	JQ691611	Cronobacter phage CR9, complete genome	9701-9727	4	0.852
NZ_CP029454_2	2.23\|3548782\|27\|NZ_CP029454\|CRT	3548782-3548808	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	5	0.815
NZ_CP029454_2	2.23\|3548782\|27\|NZ_CP029454\|CRT	3548782-3548808	27	MN693673	Marine virus AFVG_250M950, complete genome	35647-35673	5	0.815
NZ_CP029454_2	2.26\|3548917\|27\|NZ_CP029454\|CRT	3548917-3548943	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	5	0.815
NZ_CP029454_2	2.26\|3548917\|27\|NZ_CP029454\|CRT	3548917-3548943	27	MN693673	Marine virus AFVG_250M950, complete genome	35647-35673	5	0.815
NZ_CP029454_2	2.30\|3549079\|27\|NZ_CP029454\|CRT	3549079-3549105	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	5	0.815
NZ_CP029454_2	2.30\|3549079\|27\|NZ_CP029454\|CRT	3549079-3549105	27	MN693673	Marine virus AFVG_250M950, complete genome	35647-35673	5	0.815
NZ_CP029454_2	2.32\|3549160\|27\|NZ_CP029454\|CRT	3549160-3549186	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	5	0.815
NZ_CP029454_2	2.32\|3549160\|27\|NZ_CP029454\|CRT	3549160-3549186	27	MN693673	Marine virus AFVG_250M950, complete genome	35647-35673	5	0.815
NZ_CP029454_2	2.34\|3549259\|27\|NZ_CP029454\|CRT	3549259-3549285	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	5	0.815
NZ_CP029454_2	2.34\|3549259\|27\|NZ_CP029454\|CRT	3549259-3549285	27	MN693673	Marine virus AFVG_250M950, complete genome	35647-35673	5	0.815
NZ_CP029454_2	2.37\|3549403\|27\|NZ_CP029454\|CRT	3549403-3549429	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81956-81982	5	0.815
NZ_CP029454_2	2.37\|3549403\|27\|NZ_CP029454\|CRT	3549403-3549429	27	MN693673	Marine virus AFVG_250M950, complete genome	35647-35673	5	0.815
NZ_CP029454_2	2.39\|3549493\|27\|NZ_CP029454\|CRT	3549493-3549519	27	MF042360	Pseudomonas phage Phabio, complete genome	140404-140430	7	0.741
NZ_CP029454_2	2.40\|3549538\|27\|NZ_CP029454\|CRT	3549538-3549564	27	MF042360	Pseudomonas phage Phabio, complete genome	140404-140430	7	0.741
NZ_CP029454_2	2.43\|3549682\|27\|NZ_CP029454\|CRT	3549682-3549708	27	MF042360	Pseudomonas phage Phabio, complete genome	140404-140430	7	0.741
NZ_CP029454_2	2.41\|3549583\|36\|NZ_CP029454\|CRT	3549583-3549618	36	MH171094	Streptomyces phage Nabi, complete genome	17436-17471	8	0.778
NZ_CP029454_2	2.41\|3549583\|36\|NZ_CP029454\|CRT	3549583-3549618	36	KX507343	Streptomyces phage Lorelei, complete genome	17436-17471	8	0.778
NZ_CP029454_2	2.41\|3549583\|36\|NZ_CP029454\|CRT	3549583-3549618	36	MH171093	Streptomyces phage Rana, complete genome	17436-17471	8	0.778
NZ_CP029454_3	3.1\|5054987\|31\|NZ_CP029454\|CRISPRCasFinder	5054987-5055017	31	JX238501	Bacillus phage phiAGATE, complete genome	124559-124589	8	0.742

1. spacer 2.16|3548476|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

2. spacer 2.16|3548476|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

3. spacer 2.19|3548611|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

4. spacer 2.19|3548611|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

5. spacer 2.22|3548737|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

6. spacer 2.22|3548737|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

7. spacer 2.25|3548872|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

8. spacer 2.25|3548872|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
* *****.******** **********

9. spacer 2.15|3548431|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

gtgctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

10. spacer 2.16|3548476|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
* **************.*** ****.*

11. spacer 2.17|3548521|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

gtgctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

12. spacer 2.18|3548566|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

gtgctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

13. spacer 2.19|3548611|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
* **************.*** ****.*

14. spacer 2.20|3548656|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

gtgctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

15. spacer 2.22|3548737|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
* **************.*** ****.*

16. spacer 2.23|3548782|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

17. spacer 2.23|3548782|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

18. spacer 2.23|3548782|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .**************** ****.*

19. spacer 2.23|3548782|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
** .***.******** **********

20. spacer 2.24|3548827|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

gtgctcaaggtaacacgggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

21. spacer 2.25|3548872|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gacctcaaggtaacacgggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
* **************.*** ****.*

22. spacer 2.26|3548917|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

23. spacer 2.26|3548917|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

24. spacer 2.26|3548917|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .**************** ****.*

25. spacer 2.26|3548917|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
** .***.******** **********

26. spacer 2.30|3549079|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

27. spacer 2.30|3549079|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

28. spacer 2.30|3549079|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .**************** ****.*

29. spacer 2.30|3549079|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
** .***.******** **********

30. spacer 2.32|3549160|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

31. spacer 2.32|3549160|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

32. spacer 2.32|3549160|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .**************** ****.*

33. spacer 2.32|3549160|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
** .***.******** **********

34. spacer 2.34|3549259|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

35. spacer 2.34|3549259|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

36. spacer 2.34|3549259|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .**************** ****.*

37. spacer 2.34|3549259|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
** .***.******** **********

38. spacer 2.35|3549304|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
*. * **.*******************

39. spacer 2.35|3549304|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
*. * **.*******************

40. spacer 2.35|3549304|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
*. ***************** ****.*

41. spacer 2.35|3549304|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

42. spacer 2.37|3549403|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

43. spacer 2.37|3549403|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
** . **.*******************

44. spacer 2.37|3549403|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .**************** ****.*

45. spacer 2.37|3549403|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
** .***.******** **********

46. spacer 2.38|3549448|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
*. * **.*******************

47. spacer 2.38|3549448|27|NZ_CP029454|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtccacagggtaacacaggtgctactg	Protospacer
*. * **.*******************

48. spacer 2.38|3549448|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
*. ***************** ****.*

49. spacer 2.38|3549448|27|NZ_CP029454|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

gcgctcaaggtaacacaggtgctactg	CRISPR spacer
gtcctcagggtaacactggtgctactg	Protospacer
*. ****.******** **********

50. spacer 2.40|3549538|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggcgctaccg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .***************. ******

51. spacer 2.43|3549682|27|NZ_CP029454|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

gtgttcaaggtaacacaggcgctaccg	CRISPR spacer
gtcctcaaggtaacacaggtcctaccg	Protospacer
** .***************. ******

52. spacer 2.23|3548782|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. .***.******** **********

53. spacer 2.23|3548782|27|NZ_CP029454|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtgttcaaggtaacagaggtgaggcta	Protospacer
*************** *****  .**.

54. spacer 2.26|3548917|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. .***.******** **********

55. spacer 2.26|3548917|27|NZ_CP029454|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtgttcaaggtaacagaggtgaggcta	Protospacer
*************** *****  .**.

56. spacer 2.30|3549079|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. .***.******** **********

57. spacer 2.30|3549079|27|NZ_CP029454|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtgttcaaggtaacagaggtgaggcta	Protospacer
*************** *****  .**.

58. spacer 2.32|3549160|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. .***.******** **********

59. spacer 2.32|3549160|27|NZ_CP029454|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtgttcaaggtaacagaggtgaggcta	Protospacer
*************** *****  .**.

60. spacer 2.34|3549259|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. .***.******** **********

61. spacer 2.34|3549259|27|NZ_CP029454|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtgttcaaggtaacagaggtgaggcta	Protospacer
*************** *****  .**.

62. spacer 2.37|3549403|27|NZ_CP029454|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gccctcagggtaacactggtgctactg	Protospacer
*. .***.******** **********

63. spacer 2.37|3549403|27|NZ_CP029454|CRT matches to MN693673 (Marine virus AFVG_250M950, complete genome) position: , mismatch: 5, identity: 0.815

gtgttcaaggtaacacaggtgctactg	CRISPR spacer
gtgttcaaggtaacagaggtgaggcta	Protospacer
*************** *****  .**.

64. spacer 2.39|3549493|27|NZ_CP029454|CRT matches to MF042360 (Pseudomonas phage Phabio, complete genome) position: , mismatch: 7, identity: 0.741

gtgttcaaggtaacacaggcgctactg	CRISPR spacer
ttgttcaaggtaacataggcgcggtac	Protospacer
 **************.****** ..

65. spacer 2.40|3549538|27|NZ_CP029454|CRT matches to MF042360 (Pseudomonas phage Phabio, complete genome) position: , mismatch: 7, identity: 0.741

gtgttcaaggtaacacaggcgctaccg	CRISPR spacer
ttgttcaaggtaacataggcgcggtac	Protospacer
 **************.****** ..

66. spacer 2.43|3549682|27|NZ_CP029454|CRT matches to MF042360 (Pseudomonas phage Phabio, complete genome) position: , mismatch: 7, identity: 0.741

gtgttcaaggtaacacaggcgctaccg	CRISPR spacer
ttgttcaaggtaacataggcgcggtac	Protospacer
 **************.****** ..

67. spacer 2.41|3549583|36|NZ_CP029454|CRT matches to MH171094 (Streptomyces phage Nabi, complete genome) position: , mismatch: 8, identity: 0.778

gtgttcaaggtaacacgggtgctactggcgctactg	CRISPR spacer
gtgacaccggcaacacgggtgcgactggcgctacgg	Protospacer
*** .   **.*********** *********** *

68. spacer 2.41|3549583|36|NZ_CP029454|CRT matches to KX507343 (Streptomyces phage Lorelei, complete genome) position: , mismatch: 8, identity: 0.778

gtgttcaaggtaacacgggtgctactggcgctactg	CRISPR spacer
gtgacaccggcaacacgggtgcgactggcgctacgg	Protospacer
*** .   **.*********** *********** *

69. spacer 2.41|3549583|36|NZ_CP029454|CRT matches to MH171093 (Streptomyces phage Rana, complete genome) position: , mismatch: 8, identity: 0.778

gtgttcaaggtaacacgggtgctactggcgctactg	CRISPR spacer
gtgacaccggcaacacgggtgcgactggcgctacgg	Protospacer
*** .   **.*********** *********** *

70. spacer 3.1|5054987|31|NZ_CP029454|CRISPRCasFinder matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.742

ttcttcttttttgtcactagttgaaccgctt	CRISPR spacer
ctaaccttttttgccactagttaaaccgccc	Protospacer
.*  .********.********.******..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

254297 : 262245

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917311.1\|254297_254582_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_001029993.1\|254620_256255_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.5e-157	58.0
WP_000743906.1\|256661_258200_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.8e-22	31.7
WP_000833096.1\|258585_259911_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.1e-44	29.4
WP_087964884.1\|260054_260756_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-39	35.6
WP_000719210.1\|260739_262245_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	7.8e-31	30.0

DBSCAN-SWA_2

306808 : 315184

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|306808_308116_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170544.1\|308204_308924_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000278823.1\|308916_309171_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666787.1\|309167_309851_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_016111304.1\|309834_312054_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.6e-163	41.0
WP_000879032.1\|312038_313454_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.2
WP_001262439.1\|313559_314600_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
WP_000088596.1\|314596_315184_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	36.4

DBSCAN-SWA_3

1824318 : 1832470

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755525.1\|1824318_1825599_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5
WP_087968019.1\|1825698_1826463_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453861.1\|1826703_1828464_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-273	98.0
WP_000612414.1\|1828550_1829228_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-122	99.1
WP_001231621.1\|1829224_1830298_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	6.1e-187	98.0
WP_000818979.1\|1830587_1831307_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_087968017.1\|1831597_1832470_+	aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	1.3e-65	44.8

DBSCAN-SWA_4

2454221 : 2526194

Bacillus_phage(73.33%)

integrase,tail,terminase,head,capsid,protease,bacteriocin,holin,portal

attL 2466846:2466866|attR 2531612:2531632

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001071364.1\|2454221_2454542_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_098290865.1\|2455031_2455517_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_061139255.1\|2455826_2456498_+	DUF3962 domain-containing protein	NA	NA	NA	NA
WP_061139254.1\|2456566_2457676_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	4.9e-147	78.8
WP_139894484.1\|2458322_2459531_+	hypothetical protein	D2XQ10	Bacillus_virus	1.2e-79	44.9
WP_071740166.1\|2459527_2459713_+	hypothetical protein	NA	NA	NA	NA
WP_000425256.1\|2459973_2460324_-	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	7.4e-17	39.7
WP_061139252.1\|2460507_2460804_+	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	1.1e-08	46.5
WP_000522024.1\|2461019_2461286_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	1.6e-35	90.6
WP_139894485.1\|2461660_2462407_+	DnaD domain protein	A0A1B0T6C0	Bacillus_phage	1.9e-78	81.2
WP_139894486.1\|2462345_2463221_+	ATP-binding protein	Q2I8C8	Bacillus_phage	2.9e-62	45.5
WP_139894487.1\|2463236_2463431_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.1e-25	85.9
WP_139894488.1\|2463447_2463726_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	8.7e-13	59.3
WP_139894489.1\|2463718_2464078_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	2.4e-31	52.5
WP_089171096.1\|2464096_2464264_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	2.3e-13	66.0
WP_139894490.1\|2464289_2464541_+	helix-turn-helix domain containing protein	A0A0K2CNP4	Brevibacillus_phage	3.8e-07	42.2
WP_139894491.1\|2464560_2465016_+	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	1.2e-22	50.9
WP_139894492.1\|2465229_2465955_-	exosporium leader peptide-containing protein	A0A288WFW9	Bacillus_phage	1.9e-19	39.8
WP_139894493.1\|2466136_2466496_-	septum formation initiator family protein	NA	NA	NA	NA
2466846:2466866	attL	NA	NA	NA	NA
WP_065212698.1\|2467017_2467212_-	hypothetical protein	NA	NA	NA	NA
WP_139894494.1\|2467740_2467986_+	hypothetical protein	NA	NA	NA	NA
WP_139894495.1\|2469247_2469463_-	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	6.3e-27	85.9
WP_139894496.1\|2469694_2469892_+	hypothetical protein	NA	NA	NA	NA
WP_139894497.1\|2470206_2470671_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	4.6e-67	81.8
WP_139894498.1\|2471702_2473241_+	S8 family serine peptidase	NA	NA	NA	NA
WP_139894724.1\|2473267_2473390_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_098522156.1\|2473697_2474171_+	ArpU family transcriptional regulator	A0A1B1P7X5	Bacillus_phage	4.1e-79	96.2
WP_098522155.1\|2474167_2474710_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	1.0e-94	98.9
WP_098522154.1\|2475051_2475900_-	DUF346 domain-containing protein	NA	NA	NA	NA
WP_139894499.1\|2476253_2476451_+	hypothetical protein	NA	NA	NA	NA
WP_139894500.1\|2476443_2476827_+	hypothetical protein	A0A1B1P7Q2	Bacillus_phage	3.5e-20	70.3
WP_048567684.1\|2476827_2477040_+	hypothetical protein	H0USV9	Bacillus_phage	2.1e-30	98.6
WP_048567683.1\|2477176_2477431_+	hypothetical protein	H0USW0	Bacillus_phage	1.3e-39	90.5
WP_086403181.1\|2477420_2477798_+	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	3.4e-60	84.8
WP_086691942.1\|2477927_2478431_+\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	1.1e-87	98.8
WP_139894501.1\|2478432_2480127_+\|terminase	terminase large subunit	H0USW3	Bacillus_phage	3.1e-310	97.2
WP_139894502.1\|2480315_2481569_+\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	4.1e-235	97.1
WP_139894503.1\|2481555_2482266_+\|protease	Clp protease ClpP	A0A2H4JC29	uncultured_Caudovirales_phage	8.2e-124	96.6
WP_139894504.1\|2482303_2483476_+\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	3.5e-196	91.3
WP_139894505.1\|2483496_2483793_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	3.0e-43	97.9
WP_139894506.1\|2483770_2484094_+\|head	phage head closure protein	H0USW8	Bacillus_phage	7.0e-54	94.4
WP_139894507.1\|2484086_2484521_+	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	3.7e-74	95.1
WP_098522148.1\|2484517_2484877_+	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	6.1e-59	95.8
WP_097820525.1\|2484877_2485483_+\|tail	phage tail protein	A0A0S2GLI0	Bacillus_phage	2.9e-93	94.5
WP_075717239.1\|2485531_2485849_+	hypothetical protein	A0A288WFU6	Bacillus_phage	3.5e-50	93.3
WP_139894508.1\|2486070_2487387_+\|tail	phage tail tape measure protein	A0A0S2GLG8	Bacillus_phage	9.8e-163	92.9
WP_139894509.1\|2487567_2490186_+\|tail	phage tail tape measure protein	A0A2H4J380	uncultured_Caudovirales_phage	5.3e-253	93.2
WP_098770087.1\|2490200_2491682_+\|tail	phage tail protein	H0USX4	Bacillus_phage	2.2e-275	92.1
WP_139894510.1\|2491678_2495710_+	hypothetical protein	W8CYT7	Bacillus_phage	0.0e+00	88.8
WP_000390479.1\|2495837_2496062_+	hypothetical protein	A0A1B1P780	Bacillus_phage	8.5e-27	89.2
WP_139894511.1\|2496137_2496563_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	8.5e-68	93.6
WP_139894512.1\|2496562_2497384_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.4e-144	85.6
WP_033667424.1\|2498112_2498376_+	hypothetical protein	NA	NA	NA	NA
WP_139894513.1\|2498611_2499397_+	hypothetical protein	NA	NA	NA	NA
WP_000626123.1\|2499941_2501624_+	RNAseH domain-containing protein	NA	NA	NA	NA
WP_000732183.1\|2501831_2502599_+	DUF3959 family protein	NA	NA	NA	NA
WP_000905571.1\|2502738_2503155_+	DUF3995 domain-containing protein	NA	NA	NA	NA
WP_000878372.1\|2503275_2503479_+	hypothetical protein	NA	NA	NA	NA
WP_000416828.1\|2503807_2504020_-	hypothetical protein	NA	NA	NA	NA
WP_000565683.1\|2504228_2505233_+	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_000282680.1\|2505378_2505783_+	hypothetical protein	NA	NA	NA	NA
WP_000062127.1\|2505943_2507179_+	cytochrome P450	NA	NA	NA	NA
WP_071686438.1\|2507240_2507423_-	hypothetical protein	NA	NA	NA	NA
WP_000106392.1\|2507446_2508730_+	MFS transporter	NA	NA	NA	NA
WP_001069249.1\|2508719_2509352_+	Vat family streptogramin A O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.6e-25	43.1
WP_000046095.1\|2509422_2509578_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_000289122.1\|2509680_2510178_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000168014.1\|2510318_2511533_+	cytochrome P450	NA	NA	NA	NA
WP_000954437.1\|2511641_2512220_+	cysteine dioxygenase	NA	NA	NA	NA
WP_000766385.1\|2512395_2513247_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_139894514.1\|2513698_2515486_+	PAS domain-containing protein	NA	NA	NA	NA
WP_000743768.1\|2515720_2517847_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_030025712.1\|2517923_2518454_+	signal peptidase I	NA	NA	NA	NA
WP_000932142.1\|2518713_2519901_+	UDP-glucosyltransferase	A0A2H4ZK81	Cryptophlebia_leucotreta_granulosis_virus	2.4e-06	24.6
WP_000864394.1\|2519980_2520661_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_001038208.1\|2521070_2521619_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_139894515.1\|2521629_2523330_+	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	4.0e-15	29.0
WP_000556377.1\|2523322_2524123_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_000120182.1\|2524259_2524367_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_139894516.1\|2524468_2525728_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-24	29.1
WP_083320215.1\|2525861_2526194_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6A8	Bacillus_phage	1.2e-16	49.5
2531612:2531632	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2532971 : 2539620

Bacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001139345.1\|2532971_2533187_-	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	3.4e-25	83.8
WP_000369348.1\|2533423_2533555_+	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	2.9e-11	79.1
WP_000097509.1\|2533919_2534720_+	C1 family peptidase	A0A2K9L1Z4	Tupanvirus	1.0e-37	37.2
WP_002005147.1\|2534739_2534952_+	hypothetical protein	NA	NA	NA	NA
WP_002061469.1\|2535016_2535217_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.0e-15	90.9
WP_139894518.1\|2535354_2536236_-	protein kinase	NA	NA	NA	NA
WP_000372690.1\|2536363_2536873_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	1.4e-16	36.0
WP_000411453.1\|2536990_2537521_+	hypothetical protein	NA	NA	NA	NA
WP_001163828.1\|2537533_2538208_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-28	30.7
WP_087966411.1\|2538204_2539620_+	HAMP domain-containing histidine kinase	A0A1V0SKH0	Klosneuvirus	8.2e-06	23.1

DBSCAN-SWA_6

3528472 : 3538993

Bacillus_phage(45.45%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000413738.1\|3528472_3529093_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
WP_087967682.1\|3529185_3529989_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000031383.1\|3529989_3530532_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_001102627.1\|3530524_3530848_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000392443.1\|3531220_3531451_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.7e-25	77.6
WP_087967680.1\|3531512_3532415_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	2.0e-74	48.1
WP_087967678.1\|3532690_3533533_-	M23 family metallopeptidase	A0A218KCJ1	Bacillus_phage	9.7e-31	45.5
WP_139894728.1\|3533689_3534676_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	4.9e-34	43.3
WP_087967674.1\|3534914_3535301_-	DUF1492 domain-containing protein	A0A288WG73	Bacillus_phage	2.2e-46	70.6
WP_048567460.1\|3535709_3536597_-	DnaD domain protein	A0A2H4J394	uncultured_Caudovirales_phage	7.4e-98	66.6
WP_001189064.1\|3536749_3536944_-	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	5.9e-16	71.0
WP_048567458.1\|3536955_3537714_-	antirepressor	A0A2H4JBC7	uncultured_Caudovirales_phage	5.4e-97	69.8
WP_000283431.1\|3537916_3538129_-	hypothetical protein	A6M975	Geobacillus_virus	1.6e-11	63.0
WP_033683142.1\|3538333_3538993_+	helix-turn-helix domain-containing protein	A0A2H4J441	uncultured_Caudovirales_phage	8.7e-35	41.0

DBSCAN-SWA_7

3611632 : 3712814

104

Bacillus_phage(54.35%)

integrase,tail,terminase,head,capsid,protease,portal,holin,tRNA,coat

attL 3641675:3641691|attR 3687577:3687593

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001288799.1\|3611632_3612175_-\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_000870461.1\|3612302_3612734_-	hypothetical protein	NA	NA	NA	NA
WP_001005389.1\|3612737_3614267_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_000190155.1\|3614697_3615564_-	2-oxoacid:ferredoxin oxidoreductase subunit beta	NA	NA	NA	NA
WP_000625417.1\|3615550_3617308_-	2-oxoacid:acceptor oxidoreductase subunit alpha	NA	NA	NA	NA
WP_087967635.1\|3617497_3618421_-	membrane dipeptidase	NA	NA	NA	NA
WP_000404341.1\|3618479_3618740_-	stage V sporulation protein SpoVS	J9PTX7	Bacillus_phage	8.4e-10	43.8
WP_001221095.1\|3618889_3619684_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_000204911.1\|3619846_3621409_-	ribonuclease Y	NA	NA	NA	NA
WP_001115373.1\|3621890_3622316_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.7e-45	68.9
WP_087967633.1\|3622581_3623205_-	topoisomerase I	NA	NA	NA	NA
WP_000990688.1\|3624055_3625294_-	competence/damage-inducible protein CinA	NA	NA	NA	NA
WP_001052967.1\|3625314_3625893_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_000137476.1\|3625957_3626869_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000574107.1\|3626890_3627676_-	DUF3388 domain-containing protein	NA	NA	NA	NA
WP_000114450.1\|3627814_3628063_-	DUF3243 domain-containing protein	NA	NA	NA	NA
WP_000759606.1\|3628138_3628852_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_139894622.1\|3628952_3630239_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	2.9e-10	28.9
WP_000772405.1\|3630239_3631514_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	1.2e-56	30.1
WP_000008857.1\|3631723_3632683_-	ABC transporter permease	NA	NA	NA	NA
WP_001085254.1\|3632683_3633742_-	ABC transporter permease	NA	NA	NA	NA
WP_000456908.1\|3633734_3635267_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.8e-12	26.6
WP_000725771.1\|3635384_3636470_-	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000114182.1\|3636562_3637288_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_071686378.1\|3637734_3637884_-	cell division protein FtsK	NA	NA	NA	NA
WP_001118776.1\|3637825_3640207_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.0e-89	51.4
WP_000605020.1\|3640419_3640623_-	ribonuclease	NA	NA	NA	NA
WP_000139806.1\|3640619_3641369_-	translocation-enhancing protein TepA	NA	NA	NA	NA
WP_000823096.1\|3641470_3643141_-	ribonuclease J	NA	NA	NA	NA
3641675:3641691	attL	NA	NA	NA	NA
WP_000564763.1\|3643877_3644756_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_000692451.1\|3644767_3646000_-	aspartate kinase	NA	NA	NA	NA
WP_000414846.1\|3646023_3647070_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_139894623.1\|3647220_3647475_-	dipicolinate synthase	NA	NA	NA	NA
WP_098963450.1\|3647770_3648046_+	TIGR04197 family type VII secretion effector	NA	NA	NA	NA
WP_139894624.1\|3648087_3648450_+	DUF3958 family protein	NA	NA	NA	NA
WP_001108706.1\|3649961_3650387_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_016118526.1\|3651138_3651645_+	hypothetical protein	NA	NA	NA	NA
WP_139894625.1\|3651843_3652653_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.9e-151	90.0
WP_139894626.1\|3652652_3653078_-\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	2.4e-70	95.7
WP_098794702.1\|3653164_3653926_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_098794703.1\|3654071_3654437_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	1.4e-34	57.4
WP_139894627.1\|3654453_3658773_-	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	63.7
WP_139894628.1\|3658769_3660239_-\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	8.8e-229	77.9
WP_139894629.1\|3660280_3663907_-	DUF2207 domain-containing protein	A0A2H4JAI2	uncultured_Caudovirales_phage	4.0e-182	85.5
WP_000415912.1\|3664140_3664503_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	2.4e-42	70.8
WP_001004907.1\|3664507_3665095_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.1e-87	82.1
WP_065845257.1\|3665095_3665431_-	hypothetical protein	D2XR22	Bacillus_phage	1.5e-51	90.8
WP_065845256.1\|3665427_3665772_-	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	3.1e-44	78.8
WP_139894630.1\|3665773_3666127_-\|head	phage head closure protein	A0A2H4JGG7	uncultured_Caudovirales_phage	2.8e-56	91.4
WP_000450783.1\|3666128_3666422_-	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	3.8e-43	87.6
WP_097877224.1\|3666427_3667579_-\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	1.3e-208	96.1
WP_139894631.1\|3667582_3668326_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	5.4e-110	84.2
WP_065845253.1\|3668325_3669471_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	1.1e-181	82.2
WP_086389440.1\|3669479_3671147_-\|terminase	terminase large subunit	D2XR15	Bacillus_phage	4.2e-304	90.3
WP_000301142.1\|3671143_3671455_-\|terminase	terminase	D2XR14	Bacillus_phage	7.9e-47	98.1
WP_139894632.1\|3671578_3671914_-	HNH endonuclease	D2XR61	Bacillus_phage	1.7e-55	95.5
WP_139894633.1\|3671910_3672315_-	hypothetical protein	Q2I8B8	Bacillus_phage	5.1e-30	52.5
WP_139894634.1\|3672595_3673471_-	hypothetical protein	NA	NA	NA	NA
WP_139894635.1\|3673537_3673726_-	ATPase	NA	NA	NA	NA
WP_139894636.1\|3674158_3674812_-	hypothetical protein	NA	NA	NA	NA
WP_000434821.1\|3675420_3675621_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.4e-20	71.2
WP_050822079.1\|3675741_3676284_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	5.0e-89	91.7
WP_050822080.1\|3676283_3676748_-	ArpU family transcriptional regulator	D2XR57	Bacillus_phage	3.0e-74	92.9
WP_050822081.1\|3677030_3677330_+	hypothetical protein	NA	NA	NA	NA
WP_015945882.1\|3677730_3678399_+	hypothetical protein	NA	NA	NA	NA
WP_001281634.1\|3678295_3678574_-	hypothetical protein	NA	NA	NA	NA
WP_139894637.1\|3678623_3678845_-	hypothetical protein	A0A1U9WQL9	Geobacillus_phage	3.1e-13	54.3
WP_139894638.1\|3679531_3679909_+	DUF1093 domain-containing protein	A0A0K2CYS5	Paenibacillus_phage	3.3e-15	41.5
WP_139894639.1\|3680050_3680236_-	hypothetical protein	NA	NA	NA	NA
WP_137000112.1\|3680250_3680436_-	hypothetical protein	A0A0A7AR03	Bacillus_phage	4.3e-16	62.3
WP_000512857.1\|3680474_3680666_-	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	1.1e-14	61.9
WP_139894640.1\|3680738_3681101_-	cell division protein SepF	D2XR47	Bacillus_phage	2.4e-55	90.0
WP_000926798.1\|3681075_3681264_-	hypothetical protein	D2XR45	Bacillus_phage	9.7e-16	85.5
WP_139894641.1\|3681271_3682594_-	replicative DNA helicase	D2XR44	Bacillus_phage	1.8e-236	95.5
WP_139894642.1\|3682590_3683541_-	DnaD domain protein	D2XR43	Bacillus_phage	4.6e-69	58.1
WP_043937853.1\|3683821_3684106_-	hypothetical protein	D2XR42	Bacillus_phage	4.3e-23	54.3
WP_139894643.1\|3684288_3684510_-	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_000537278.1\|3684523_3685111_-	hypothetical protein	D2XR41	Bacillus_phage	8.4e-74	69.2
WP_097854400.1\|3685201_3685450_-	hypothetical protein	NA	NA	NA	NA
WP_058839516.1\|3685505_3685697_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000172329.1\|3685865_3686276_+	helix-turn-helix transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	1.1e-32	53.8
WP_097999623.1\|3686288_3686723_+	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	6.7e-60	77.8
WP_139894644.1\|3686763_3687396_+	hypothetical protein	NA	NA	NA	NA
WP_139894645.1\|3687722_3688469_+	hypothetical protein	A0A1C8E993	Bacillus_phage	2.7e-53	65.1
3687577:3687593	attR	NA	NA	NA	NA
WP_139894646.1\|3688533_3689457_+	hypothetical protein	NA	NA	NA	NA
WP_139894647.1\|3689542_3691090_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	2.7e-143	53.6
WP_000954735.1\|3691544_3692447_-	dipicolinic acid synthetase subunit A	NA	NA	NA	NA
WP_087967427.1\|3692617_3692869_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000592989.1\|3693003_3694245_-	insulinase family protein	G3MBJ8	Bacillus_virus	4.4e-56	34.5
WP_087967425.1\|3694331_3695231_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000076737.1\|3695385_3697524_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_001229392.1\|3697684_3697954_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_000766704.1\|3698054_3699026_-	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	2.5e-06	32.7
WP_087967423.1\|3699069_3699993_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_000776437.1\|3700079_3700436_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_000582367.1\|3700451_3700733_-	DUF503 family protein	NA	NA	NA	NA
WP_000036343.1\|3700729_3702790_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.8e-20	25.9
WP_001286524.1\|3702794_3703106_-	YlxQ family RNA-binding protein	NA	NA	NA	NA
WP_000071127.1\|3703106_3703379_-	YlxR family protein	NA	NA	NA	NA
WP_000102604.1\|3703390_3704497_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_000359096.1\|3704514_3704985_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_087967422.1\|3705321_3709623_-	PolC-type DNA polymerase III	A0A0A8WJ41	Clostridium_phage	4.1e-24	39.6
WP_000814299.1\|3709747_3711448_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_001090243.1\|3711557_3712814_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA

DBSCAN-SWA_8

4366720 : 4374405

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221066.1\|4366720_4367644_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-45	43.5
WP_049107067.1\|4367769_4368705_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-21	24.8
WP_000018029.1\|4368706_4369399_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_001014310.1\|4369741_4369936_+	YwbE family protein	NA	NA	NA	NA
WP_087875794.1\|4369974_4371174_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.6e-71	41.2
WP_000587818.1\|4371468_4371792_+	heme oxygenase	NA	NA	NA	NA
WP_001086123.1\|4371864_4372629_-	class B sortase	NA	NA	NA	NA
WP_044306745.1\|4372661_4373432_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.6e-14	27.9
WP_001036848.1\|4373421_4374405_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.1e-17	27.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP029457

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP029456

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP029455

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP029454

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection