CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP041050	Citrobacter sp. CF971 plasmid pBM527-4, complete sequence	0 crisprs	RT	0	1
NZ_CP041049	Citrobacter sp. CF971 plasmid pBM527-3, complete sequence	1 crisprs	NA	1	0
NZ_CP041051	Citrobacter sp. CF971 chromosome, complete genome	1 crisprs	DEDDh,WYL,DinG,cas3,csa3,PD-DExK	1	14
NZ_CP041048	Citrobacter sp. CF971 plasmid pBM527-2, complete sequence	0 crisprs	NA	0	2
NZ_CP041047	Citrobacter sp. CF971 plasmid pBM527-1, complete sequence	0 crisprs	csa3	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31695 : 78001

Escherichia_phage(50.0%)

transposase,integrase

attL 24371:24386|attR 81156:81171

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
24371:24386	attL	NA	NA	NA	NA
WP_135716487.1\|31695_32700_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_008322801.1\|33011_33203_+	DUF2767 family protein	NA	NA	NA	NA
WP_042201113.1\|33225_33993_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_042201111.1\|34311_35316_-	hypothetical protein	NA	NA	NA	NA
WP_008322807.1\|35312_35576_-	hypothetical protein	NA	NA	NA	NA
WP_053065240.1\|35991_36666_-	hypothetical protein	NA	NA	NA	NA
WP_042201108.1\|36928_38062_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_042201107.1\|38220_38961_-	abortive infection family protein	NA	NA	NA	NA
WP_042201105.1\|38996_39785_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_042201102.1\|39781_40402_-	hypothetical protein	NA	NA	NA	NA
WP_042201100.1\|40398_41010_-	DNA-binding protein	NA	NA	NA	NA
WP_048213817.1\|44479_45979_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.0e-44	31.7
WP_048213818.1\|46771_47041_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_048213819.1\|47044_47575_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_048213820.1\|47659_48664_-	hypothetical protein	NA	NA	NA	NA
WP_048213821.1\|48668_48914_-	hypothetical protein	NA	NA	NA	NA
WP_048213854.1\|49672_50695_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_048213822.1\|51049_51583_-	hypothetical protein	NA	NA	NA	NA
WP_048213823.1\|52245_54456_-	AAA family ATPase	NA	NA	NA	NA
WP_001568025.1\|55145_55364_+	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_139934942.1\|55365_55671_+	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_017899885.1\|55839_56235_+	hypothetical protein	NA	NA	NA	NA
WP_053389906.1\|56261_56576_+	hypothetical protein	NA	NA	NA	NA
WP_017899884.1\|56586_57603_+	hypothetical protein	NA	NA	NA	NA
WP_004197635.1\|57800_58595_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.5e-52	88.7
WP_077253981.1\|59034_59214_-	Par-like protein	NA	NA	NA	NA
WP_004197649.1\|59333_59960_-	ParA family plasmid-partitioning AAA ATPase	A0A222YXS3	Escherichia_phage	2.9e-40	43.6
WP_001067855.1\|60495_61200_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_106931107.1\|61233_61503_-	hypothetical protein	NA	NA	NA	NA
WP_032640602.1\|61594_62563_-	magnesium and cobalt transport protein CorA	NA	NA	NA	NA
WP_004099038.1\|62559_63264_-	glutathione S-transferase	NA	NA	NA	NA
WP_004099036.1\|63396_63936_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_004099035.1\|63937_64381_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_032425611.1\|64505_65537_+\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_018716209.1\|65682_66642_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004357650.1\|66786_68019_+	OsmC family protein	NA	NA	NA	NA
WP_025760400.1\|68021_68615_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_004357654.1\|68614_69640_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_026227539.1\|70036_70612_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004357657.1\|70847_71030_-	hypothetical protein	NA	NA	NA	NA
WP_004099027.1\|71088_71577_-	DUF417 family protein	NA	NA	NA	NA
WP_004099026.1\|71847_72234_+	hypothetical protein	NA	NA	NA	NA
WP_004099025.1\|72272_73232_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_004357616.1\|73258_73792_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_001067855.1\|74000_74705_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_139934944.1\|74992_78001_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	64.0
81156:81171	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041049

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041049_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041049_1

15852-15923

Orphan

Consensus_repeat	Method
GTAATACGCAGGGACTTGTCTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041049_1

>merge|NZ_CP041049|1|15852-15923|CRISPRCasFinder
GTAATACGCAGGGACTTGTCTCACGCATCTGAATCACCCGCAGCGGCCTGTAATACGCAGGGACTTGTCTCA

>NZ_CP041049|1|1|15852-15923|CRISPRCasFinder
GTAATACGCAGGGACTTGTCTCA	CGCATCTGAATCACCCGCAGCGGCCT
GTAATACGCAGGGACTTGTCTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041049.1\|WP_012585400.1\|10715_10964_-\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP041049.1\|WP_003159185.1\|10020_10587_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP041049.1\|WP_101975973.1\|11686_13300_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP041049.1\|WP_042046578.1\|13626_14061_+\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP041049.1\|WP_011178357.1\|17792_18014_-\|chromosome-partitioning-protein-ParB	unknown	unknown	gnl\|CDD\|117819
NZ_CP041049.1\|WP_000845039.1\|8659_9673_+\|class-1-integron-integrase-IntI1	unknown	unknown	gnl\|CDD\|185315
NZ_CP041049.1\|WP_139934937.1\|14116_15019_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP041049.1\|WP_128297849.1\|15545_15791_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041049.1\|WP_012658785.1\|7616_8480_-\|carbapenem-hydrolyzing-class-A-beta-lactamase-GES-5	unknown	unknown	gnl\|CDD\|185339
NZ_CP041049.1\|WP_038988888.1\|11114_11462_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041049.1\|WP_139934938.1\|17180_17717_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041049.1\|WP_106672696.1\|7031_7433_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240046

Protein	Function_ID	Function_description	E-value
NZ_CP041049.1\|WP_042046578.1\|13626_14061_+\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	2.89134e-06
NZ_CP041049.1\|WP_012585400.1\|10715_10964_-\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	5.72981e-36
NZ_CP041049.1\|WP_003159185.1\|10020_10587_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	6.14207e-62
NZ_CP041049.1\|WP_101975973.1\|11686_13300_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	1.12704e-29
NZ_CP041049.1\|WP_000845039.1\|8659_9673_+\|class-1-integron-integrase-IntI1	gnl\|CDD\|185315	PRK15417, PRK15417, integron integrase.	0
NZ_CP041049.1\|WP_011178357.1\|17792_18014_-\|chromosome-partitioning-protein-ParB	gnl\|CDD\|117819	pfam09274, ParG, ParG. Members of this family of plasmid partition proteins adopt a ribbon-helix-helix fold, with a core of four alpha-helices. They are an essential component of the DNA partition complex of the multidrug resistance plasmid TP228.	0.000285558
NZ_CP041049.1\|WP_139934937.1\|14116_15019_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	1.29442e-09
NZ_CP041049.1\|WP_012658785.1\|7616_8480_-\|carbapenem-hydrolyzing-class-A-beta-lactamase-GES-5	gnl\|CDD\|185339	PRK15442, PRK15442, beta-lactamase TEM; Provisional.	6.89349e-59
NZ_CP041049.1\|WP_106672696.1\|7031_7433_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240046	cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	6.02416e-41

>NZ_CP041049.1|WP_128297849.1|15545_15791_-|hypothetical-protein
MRVQETLDRLGLYWKRDPDFVPVKDAATVRLNVSIGGGGVELLATWPKWYDTRKEQGGGAIDLTMHLFRLSFVDAVKRLSP
>NZ_CP041049.1|WP_139934937.1|14116_15019_-|hypothetical-protein
MARQGITRDQVFTAADALVGDGQQPTINAIRERLGGTGSPNTIHKHLVQWREARPVAAVAAPELPQALTAAIAGEIEKAAAKARAEKEQELQQAQAEAAELGAAGEALEAERDELAEQVAVLTTERDTLAGKAAQQAADLAEAQQRIEREQQAAEAARVEVATARLKIEAQTERQTEQAAEIERLRAALAEAQQGRTAAEQQAAVLAAVLAAKLEACADRAEQIEQQAAKAAQAHDTARAAAAQEIRQAQAERDEARKVAAEAREQAARLAGQLEALQRQQDKAEAAEKATKAPKGKGGE
>NZ_CP041049.1|WP_042046578.1|13626_14061_+|conjugal-transfer-protein-TraD
MTQDKWLAERLAYLRGLKAPSDQQRLLLMLADKPDRTADDGRKLAALVRAEKAAERAQKARADAARIINAERAAERKARDHELYESAGLMILAGLIDTKTGKPTRDRGELLGALVSLAEAQVDDAKRAAWKAKGDALMAERARR
>NZ_CP041049.1|WP_101975973.1|11686_13300_-|MobA/MobL-family-protein
MPAWAQSNPLAFWQAADAYERKNGTTYREMEIALPRELSAAQRIELVREFVRQEIGDRHAYQWALHVPTAADGGEQPHFHLMFSERQVDGIDRDPEQYFKRYNAKAPEKGGARKGYGPSAGQTLTKAERAAELKELRGRWEAMCNAHLERAGVEQRIDMRSHAERGTGLEPERKQLPSAWRGEGRAQVIEFRAARAEVAQAAAELRRAVPDTGAEIIHLEAERQRREQAQREARERAEREKAQQERQRLERMSSRELAQEIARLRPPRVIDLVERDRAVLQAEAERQALQNQHTEAGSAAARARDQAQAWREAHKVQAWFHDKGIGHAPKLRELEQQREEHRAEWQRLGQRIEEASLRVQHVRQQAHQRITAEQEPTLAKLAELEALQKEKARQEREAEAKRLQQQRIEREREEESMAALEHRLAELRAAQEADATQPEPSDDDPRWAAFERTFMHAAQFEHYLSLTVLAAPLAGLKARFAAYMDTAAEQGMTPEMFAQACAKGMAEQERRAMQEQAARDADPKQPQEDSPVSTPTP
>NZ_CP041049.1|WP_038988888.1|11114_11462_-|hypothetical-protein
MKVWAFDENRADFVDAAPERMNADATGYYIIRRGDDVLVREHGQERPMPERLTVAGVPFDREQFEHTHPLPLRAEMKRDGQWARAQLQARDRAEIALPLELPIWVTKTPLTEGKA
>NZ_CP041049.1|WP_012585400.1|10715_10964_-|type-II-toxin-antitoxin-system-YafQ-family-toxin
MQSSIERTVSGVRCTNDDLKPVLVALATDQPLDVRYRDHDLSGDWAGYRECHIKPDLLLIYRKSDADTLRLARLGSHSELFG
>NZ_CP041049.1|WP_003159185.1|10020_10587_-|recombinase-family-protein
MALIGYARVSTAEQDTALQTDALRKAGCERVFEDTASGAKADRPGLADALAYLRDGDVLAVWRLDRLGRSMPHLIETIGALEARGVGFRSLTEAIDTTTPGGRLIFHVFGALGQFERDLIRERTKAGLTAAAARGRKGGRKPVVTADKLQRAREHIANGLNVREAATRLKVSKTALYTALQSTSAADS
>NZ_CP041049.1|WP_000845039.1|8659_9673_+|class-1-integron-integrase-IntI1
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLPTEQAYVHWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER
>NZ_CP041049.1|WP_012658785.1|7616_8480_-|carbapenem-hydrolyzing-class-A-beta-lactamase-GES-5
MRFIHALLLAGIAHSAYASEKLTFKTDLEKLEREKAAQIGVAIVDPQGEIVAGHRMAQRFAMCSTFKFPLAALVFERIDSGTERGDRKLSYGPDMIVEWSPATERFLASGHMTVLEAAQAAVQLSDNGATNLLLREIGGPAAMTQYFRKIGDSVSRLDRKEPEMSDNTPGDLRDTTTPIAMARTVAKVLYGGALTSTSTHTIERWLIGNQTGDATLRAGFPKDWVVGEKTGTCANGGRNDIGFFKAQERDYAVAVYTTAPKLSAVERDELVASVGQVITQLILSTDK
>NZ_CP041049.1|WP_106672696.1|7031_7433_-|NUDIX-domain-containing-protein
MTTHIDKLALFSILDKKLLVVRSKGKSLFYLPGGKRELNETDHEALLREISEELAINLIPSTITYAATLEAQADGKPEGLLVKLTCYFANYDGAPTPAAEIEELRYIDSNDIEICSKAAILCVDWLKASNYIN
>NZ_CP041049.1|WP_139934938.1|17180_17717_-|hypothetical-protein
MLMKYGAGYKVMVEMEPLSLEVLPPSHFKAFAKNAPHEIKGAVIENTERGLVIVLHVGNERRILGQYREASGFFALSMARRQCCGSMACCTGRRMQKAGFRELWKRRSGVQMDEKAKPRVAAGLGRGGTSQVALARTQRRNLYRQHPDMVCIVAPHLLPHKRKEGYGTGTATTFQPSR
>NZ_CP041049.1|WP_011178357.1|17792_18014_-|chromosome-partitioning-protein-ParB
MSSGKLGMKAGRPSAAKAGPTLSDLADKAATVRVNFDLDRAEHTKLKIYAAKTGRSITDILRELVRSLDEKSD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041049_1	1.1\|15875\|26\|NZ_CP041049\|CRISPRCasFinder	15875-15900	26	NZ_KX912255	Enterobacter cloacae strain H140960786 plasmid pJF-786, complete sequence	594-619	0	1.0
NZ_CP041049_1	1.1\|15875\|26\|NZ_CP041049\|CRISPRCasFinder	15875-15900	26	LC486677	Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence	1422-1447	0	1.0
NZ_CP041049_1	1.1\|15875\|26\|NZ_CP041049\|CRISPRCasFinder	15875-15900	26	NZ_CP041049	Citrobacter sp. CF971 plasmid pBM527-3, complete sequence	15875-15900	0	1.0
NZ_CP041049_1	1.1\|15875\|26\|NZ_CP041049\|CRISPRCasFinder	15875-15900	26	NZ_CP027261	Pectobacterium parmentieri strain IFB5427 plasmid pPAR01, complete sequence	22698-22723	5	0.808

1. spacer 1.1|15875|26|NZ_CP041049|CRISPRCasFinder matches to NZ_KX912255 (Enterobacter cloacae strain H140960786 plasmid pJF-786, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatctgaatcacccgcagcggcct	CRISPR spacer
cgcatctgaatcacccgcagcggcct	Protospacer
**************************

2. spacer 1.1|15875|26|NZ_CP041049|CRISPRCasFinder matches to LC486677 (Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatctgaatcacccgcagcggcct	CRISPR spacer
cgcatctgaatcacccgcagcggcct	Protospacer
**************************

3. spacer 1.1|15875|26|NZ_CP041049|CRISPRCasFinder matches to NZ_CP041049 (Citrobacter sp. CF971 plasmid pBM527-3, complete sequence) position: , mismatch: 0, identity: 1.0

cgcatctgaatcacccgcagcggcct	CRISPR spacer
cgcatctgaatcacccgcagcggcct	Protospacer
**************************

4. spacer 1.1|15875|26|NZ_CP041049|CRISPRCasFinder matches to NZ_CP027261 (Pectobacterium parmentieri strain IFB5427 plasmid pPAR01, complete sequence) position: , mismatch: 5, identity: 0.808

cgcatctgaatcacccgcagcggcct	CRISPR spacer
tgtccctgaatcacccgcagccgcct	Protospacer
.*. .**************** ****

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP041051

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041051_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041051_1

2227484-2227607

Orphan

Consensus_repeat	Method
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041051_1

>merge|NZ_CP041051|1|2227484-2227607|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTACGGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAACGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

>NZ_CP041051|1|1|2227484-2227607|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CGGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAA
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041051.1\|WP_089617520.1\|2239101_2240309_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|181829
NZ_CP041051.1\|WP_139935355.1\|2223782_2224838_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238562
NZ_CP041051.1\|WP_003836510.1\|2225825_2226578_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP041051.1\|WP_032935874.1\|2218995_2220258_+\|4-aminobutyrate-transaminase	unknown	unknown	gnl\|CDD\|182078
NZ_CP041051.1\|WP_016808123.1\|2234321_2236091_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379050
NZ_CP041051.1\|WP_139935358.1\|2228791_2229661_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP041051.1\|WP_003843507.1\|2214265_2216158_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|379192
NZ_CP041051.1\|WP_003843510.1\|2217413_2218889_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP041051.1\|WP_139935362.1\|2240668_2241712_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319265
NZ_CP041051.1\|WP_016150165.1\|2216161_2217370_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|379187
NZ_CP041051.1\|WP_016808126.1\|2231029_2231704_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|368603
NZ_CP041051.1\|WP_139935360.1\|2237301_2238510_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP041051.1\|WP_139935359.1\|2233523_2234126_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271188
NZ_CP041051.1\|WP_139935356.1\|2224824_2225829_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP041051.1\|WP_106902826.1\|2236279_2237197_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP041051.1\|WP_139935354.1\|2220471_2222604_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP041051.1\|WP_049014056.1\|2231696_2233220_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379114
NZ_CP041051.1\|WP_139935357.1\|2226564_2227287_-\|solute-binding-protein	unknown	unknown	gnl\|CDD\|270259
NZ_CP041051.1\|WP_048218989.1\|2222613_2223624_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238562
NZ_CP041051.1\|WP_106107326.1\|2227929_2228619_-\|amino-acid-racemase	unknown	unknown	gnl\|CDD\|224707

Protein	Function_ID	Function_description	E-value
NZ_CP041051.1\|WP_089617520.1\|2239101_2240309_-\|IS3-family-transposase	gnl\|CDD\|181829	PRK09409, PRK09409, IS2 transposase TnpB; Reviewed.	2.19722e-127
NZ_CP041051.1\|WP_139935355.1\|2223782_2224838_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238562	cd01142, TroA_e, Periplasmic binding protein TroA_e. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.45065e-81
NZ_CP041051.1\|WP_003836510.1\|2225825_2226578_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	4.26889e-80
NZ_CP041051.1\|WP_032935874.1\|2218995_2220258_+\|4-aminobutyrate-transaminase	gnl\|CDD\|182078	PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional.	0
NZ_CP041051.1\|WP_016808123.1\|2234321_2236091_+\|AAA-family-ATPase	gnl\|CDD\|379050	pfam13175, AAA_15, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	4.31192e-18
NZ_CP041051.1\|WP_139935358.1\|2228791_2229661_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.21244e-68
NZ_CP041051.1\|WP_003843507.1\|2214265_2216158_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|379192	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain.	2.80183e-06
NZ_CP041051.1\|WP_003843510.1\|2217413_2218889_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.2023e-138
NZ_CP041051.1\|WP_139935362.1\|2240668_2241712_+\|hypothetical-protein	gnl\|CDD\|319265	cd16408, ParB_N_like, ParB N-terminal, parA -binding, -like domain of bacterial and plasmid parABS partitioning systems. This family represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	0.000353553
NZ_CP041051.1\|WP_016150165.1\|2216161_2217370_+\|c-type-cytochrome	gnl\|CDD\|379187	pfam13442, Cytochrome_CBB3, Cytochrome C oxidase, cbb3-type, subunit III.	3.11379e-10
NZ_CP041051.1\|WP_016808126.1\|2231029_2231704_-\|HNH-endonuclease	gnl\|CDD\|368603	pfam05766, NinG, Bacteriophage Lambda NinG protein. NinG or Rap is involved in recombination. Rap (recombination adept with plasmid) increases lambda-by-plasmid recombination catalyzed by Escherichia coli's RecBCD pathway.	2.37424e-05
NZ_CP041051.1\|WP_139935360.1\|2237301_2238510_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.10606e-25
NZ_CP041051.1\|WP_139935359.1\|2233523_2234126_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271188	cd01188, INT_RitA_C_like, C-terminal catalytic domain of recombinase RitA, a component of the recombinase trio. Recombinases RitA (also known as pAE1), RitB, and RitC are encoded by three adjacent and overlapping genes. Collectively they are known as the Recombinase in Trio (RIT). This RitA family includes various bacterial integrases and integrases from the deletion-prone region of plasmid pAE1 of Alcaligenes eutrophus H1. All three integrases contain a catalytic motif, suggesting that they are all active enzymes. However, their specific roles are not fully understood. All three families belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.04502e-62
NZ_CP041051.1\|WP_139935356.1\|2224824_2225829_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	5.1495e-82
NZ_CP041051.1\|WP_106902826.1\|2236279_2237197_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.02014e-48
NZ_CP041051.1\|WP_139935354.1\|2220471_2222604_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	2.64571e-69
NZ_CP041051.1\|WP_049014056.1\|2231696_2233220_-\|ATP-binding-protein	gnl\|CDD\|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	5.32549e-11
NZ_CP041051.1\|WP_139935357.1\|2226564_2227287_-\|solute-binding-protein	gnl\|CDD\|270259	cd13541, PBP2_ModA_like_2, Substrate binding domain of molybdate-binding proteins;the type 2 periplasmic binding protein fold. This subfamily contains domains found in ModA proteins of putative ABC-type transporter. ModA proteins serve as initial receptors in the ABC transport of molybdate in eubacteria and archaea. Bacteria and archaea import molybdenum and tungsten from the environment in the form of the oxyanions molybdate (MoO(4) (2-)) and tungstate (WO(4) (2-)). After binding molybdate and tungstate with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ModA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.79922e-90
NZ_CP041051.1\|WP_048218989.1\|2222613_2223624_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238562	cd01142, TroA_e, Periplasmic binding protein TroA_e. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	9.50333e-69
NZ_CP041051.1\|WP_106107326.1\|2227929_2228619_-\|amino-acid-racemase	gnl\|CDD\|224707	COG1794, RacX, Aspartate racemase [Cell envelope biogenesis, outer membrane].	7.59676e-74

>NZ_CP041051.1|WP_139935357.1|2226564_2227287_-|solute-binding-protein
MPSSILLFAAGSLRPAFTPLISQFTRMSGIDVKIEYGPAGLLRERIETGEPCELFASANREHPQNLLVRNKAVSTHTFCWNKLSLVSNRIGTWLDLLRDPTLRPGTSTPGCDPSGDYTWAFFDNMDVLEPGLGRQLRVRAIPLVGGRDTVKIPQGELASAWILRQGLADLFIGYAHYAHALHAMTDVHYVAIPDEHNICCEYQLAVLDASKEVMALVEFILSRSGQAFLTAAGFLPLNAE
>NZ_CP041051.1|WP_003836510.1|2225825_2226578_+|ABC-transporter-ATP-binding-protein
MIPAALRVNQLSYGYRAPLFEPLTFCCQKGDIWAVLGRNGLGKSTLLDTLTGTLPALGGSIENNGGIGIVAQHSHLPFPYTVSDVVLMGRAQHVKLFAQPSQQDQQRAMQALEQLSIAHLASSSFGSLSGGQQQLVMIARALVTECQTLLLDEPCSALDLANQQVVLQLISDLAHQQGCSILFSTHDPLHALQVASHTLLLLPEGKWRAGPTDSIVTEENLFLAYGLPLRKLSVENHPTPFIAPLFSIRR
>NZ_CP041051.1|WP_139935356.1|2224824_2225829_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MQLSNRFLPQQPLLIVVVLLLGVSSLCLGQYPLSLGEVFYHLTHYSDAEGIASQVIWTVRLPRILMALLAGGALGLCGATLQGVFHNPLVDPHIIGVTSGAAFGGTLAILLGLSPLLMMGSTFFFGLTALILVYAVAALQGLENTLVLILSGIILSGFFAALVSLIQYQADTEETLPNIVFWLLGSFATANWHKVLLLAVPVGIAATVLFQLRWRINLLSLNDKDARALGVTVVPLRRSVLVCCAFLVAAQVAVSGSIAWVGLVIPHLARLLVGVDHRRLLPCAFWLGGGFMIVVDDIARTLMHAEIPLGIITALFGAPLFAFLLIRTSRREKS
>NZ_CP041051.1|WP_139935355.1|2223782_2224838_+|ABC-transporter-substrate-binding-protein
MLTFRSFVLVCASMLFAFSAQADRTITDQLGRQVTIPDHVDKVVVLQHQTLNILVQLNAQQDIVGVMSSWKKQLGPEFARFMPTITTLPTPGDLTSVNIESLLAIHPQVVFVANYAPAEMIQQIQNAGIPVVAISLRKDADGQQNKMNPTMADEEQVYNEGLKQGIRLIADVVGRKPQAETLIDYVFAARAKFNAPVANIPDAQKVRIYMANPDLMTYGSGKYTGLMMQHAGGLNVAAASVKGARQVALEQVLAWNPQVIFVQDRYPQVVTQIQNDSNWQGIDAVKNHRVWLMPEYAKAWGYPMPEALAIGELWMAKKLYPDAYKDVDVDAQAQDYYQRFYRVNWQSDAAK
>NZ_CP041051.1|WP_048218989.1|2222613_2223624_+|ABC-transporter-substrate-binding-protein
MKTCHTWLLCVWLAFPALATRQVVDDAGHTVTVPTHVERIADGWFAHHSVLMTLGAGRNIVVTVNHEDNQPWMFKINPSLRQALQIRGTSFNTEDLLARHVDVVFVAKGKGDAQSYSQAGIPALEMAFTDYASMEKSVTTTAEVLGTGQARARATAYNQYLNRVLADVQAKTAKLSADQRPRVLHIQSLNPLKVDGRNTLIDTWITLTGGRNAADEVDGNMKEVSPERVLYWQPQVIILGAGCGDIASSPYAALFKELDAVKQGNVWRNPAGVFPWDRYGTESALQLQWAASKLHPTLFSGLDMVSVTRDFYRQFFDYSLTPAQAMRILNALPPQE
>NZ_CP041051.1|WP_139935354.1|2220471_2222604_+|TonB-dependent-siderophore-receptor
MLNNKITPVASGLLTFACLSTAVTAHAEDTVIVSAPATSQSSLSEHEPPASEKKATLGSLGERELIDVPWSVQTLSKKVLDQQQIKDVKDAYRYLPSVQGDGVRPQTRGMQGSVVQNHMIDGLNAVSTTEYSTEQSQNIEVLSGIAGSLYGPANPAGMFNLVSKRPVDTPLHRVTVGQGTGSGTLTSMDFSGPIDAGDRVKYRLNLLNDEGHSYTTDSHVRRQYAGLGLDFQLTDQTVLESNFSYYHYYEKGMPGSFALAKGVHFPAAFDPTDSKYGQSYAGHDDETTTVDMHIKHDFDGNWMLDLGALHQVADRESTAVTNTLTNNQGDYTTTTANSAASRFIINSYLANLTGSVDTGWLTQDIATGMRGFVWKNYNPRNGGTFTLGHSSLNQHPDYPRPPYPDFNDRYHSATTTQHAFLLSDTLHFSPQWSLLLSGSENLFTVSNYNKAGHESSRQKDNGMSGSTSLMYKPVENVTLYTTWADSLQQGDTAPAGARNAGQVLDPYRSRQIEVGAKYAPVKDLLLTAALFEAKRPFAYTNDNGDFAQDGTQKNRGLELMADGHITHNLRVLGGGAWLDPTLHNTAASNADGKQVVGLPRFASNILAIYTIERVPGLDVDTNVHYVGRRATDNANDSWVGSYTTVDIGTRYATRLWNTPTTLRFDITNLTDRHYWTNIVPGALTGYTGAGAASAQLGAPRQAQVSVQVDF
>NZ_CP041051.1|WP_032935874.1|2218995_2220258_+|4-aminobutyrate-transaminase
MNNKNLQQRRLDATPRGVGVMCDFYAQSAENSTITDIEGNQYIDFAAGIAVLNTGHRHPRLVQAVEAQLQAFTHTAYQIVPYESYVSLAEKINAVAPIDGKRKTTFFTTGAEAVENAVKIARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKKGFGPFPGSVYHAPYPSELQGISTADSLKAIERLFKADIDPTQVAAIIFEPVQGEGGFVVAPPEFVAAIRRICDEHGIVMIADEVQSGFARTGQLFAMDHYADKADLMTMAKSLAGGMPLSGVVGKAEIMDAPAPGGLGGTYAGNPLSIAAAHAVLDIIHDEQLCQRAAALGEQLRAALTDAQAGCPELAEVRGLGSMIAAEFCDPATGEPNASAAQRVQKKALEQGLLLLTCGQYGNVIRFLYPLTIPQDQFAKALQIIKAATK
>NZ_CP041051.1|WP_003843510.1|2217413_2218889_-|PLP-dependent-aminotransferase-family-protein
MRSLAGDVIKHAFSQQTDEKLHRRLYAAICSCILEGSLKPATRMPPSRDLAGELMLSRNTVLRVYEQLQAEGYISARTSSGTFVTDSVLDNLNLRPNKEPVAAALEDHTRLSARCLELLGNASASPRQWGAFIPGVPDVEHFPHRVLKKIQDRLARRLRPEFLTYDAAGGVNELKEALADYLRTARGVRCSPEQILITEGIHQALDLVTRTLCNPGDHAWIEEPGYWGIKNILRINAVNFSAIPVDEQGMVPPDAGETPPKLIFVTPSHQYPLGSVMSLSRRRQLIFRARETRSWIVEDDYDSEFRFSGQPIPSLQGLEEETPVIYIGTFSKTLYPALRLGYVVLPKSLAAPLKKVHNDLYRGGHLLIQAALAEFIREGYYAAHIRKMRQLYSRRRQMLVELISRQLGEHYLGSFSSNAGLHMILQLPAGSDDAVIAQQANAQGLLVRPLSRYYVNEEKRSGLLLGFASIEEHEMSAAFTRLADIIRVNTV
>NZ_CP041051.1|WP_016150165.1|2216161_2217370_+|c-type-cytochrome
MRNVTILAACLFTASVSAAESNGEYIARISDCVACHTAEGGAAMAGGKKFPTPVGDIYSTNITPDKAQGIGNYSYEDFEKAVRQGIAKDGHPLYPAMPYPSYAKLSDEDVQALYRYFMHDVTPSAQPNKENAIPWLLSARWPLHIWNWLFTDAPATTVDSAKPDDNTALIKRGAYLVEGPGHCGSCHTPRGMAMNEKAYTHADAEYLSGAMIDGWYAPSLRGSGMSEQALKSLLLTGKSKHAAVSGSMAEVVTQSTQYLTDEDATAIAQYLLSLKSAKPETVRAAATTASWSNSPEAGKVTYNRYCSTCHGLEGKGTDDNAPSLVNNPLVMVDDPTPLFRVIAHGAETPTTRGSVSFKMPAYGGMLSDNEMRDVINYVRKTWGEGNGEVSHEDLAGIKKASH
>NZ_CP041051.1|WP_003843507.1|2214265_2216158_+|NAD(P)/FAD-dependent-oxidoreductase
MAITRRDFLNGVAVTIAAGLTPLEWVRATGKGNAFIDGNYYPPALTGLRGNHPGSFEMAHALGREQKHFDLNALPVEEEYDLVIVGGGISGLAAGCFWRQVAGQNSRVLILDNHDDFGGHAKRNEFTSSGKKLLGYGGSEAFQSPAHNFSPEVQKLMETVGVSVTRLKESFDVNFYPDWQLSRGVFFDKKNFGVTKIVSGDPGRAVSDDIPPDRLNGRKIEDFINDFPLGENDRKALIDLHVRPGDYLPGMTVDEKMEWLDTHSYSEFLATKVGLSKMALLYFQQRSNDFFAIGIEGISCSDARACALPGMEGMGLPPLDGESLADLEEPYVYHFPDGNAGLARLLVRYMLPDALPGNTMEDSVLARLHYEKLDLPENTTRLRLNSTVINAANVQDGVVVTYLRDGKMHRVRGKNTIMAGYNMMIPYLVPEMPEQQQADLKLNVKAPLVYTNVVVKNWQAFKQLGVHEFYSPAAPYSRVKLDYPVSIGGYQHPASPDDPMVIHMVYVPTYPGSNLSAREQFRLGRAYLLGTTFAAHEEMIRSQLQEMFGSTGFDNQRDISAITVNRWAHGYAYYANSLFDDMDKMPEIIERARQPVGRIAIANSDSDWSAYAHTAIDQAWRAVNELKDMG
>NZ_CP041051.1|WP_106107326.1|2227929_2228619_-|amino-acid-racemase
MKKLGLIGGTGPESTLLYYRKFVYEANKRIGDTFFPSLTIESINVYDVLSMCGREDYEALTKYLAKAVGNLVAAGAEVVALTGNTPHIVFNELQSCTTVPLVSIIESTCAEVQTQGLKKVGLVGTRFTMEADFFKRPFTEAGIQVVIPHGDEIDYIADKIHDELERGIIKPQTRDKFTAVIERMCQDEGIEAIILGCTELPLLFVGTELPVKALDTVDIHIETLFKALQ
>NZ_CP041051.1|WP_139935358.1|2228791_2229661_+|LysR-family-transcriptional-regulator
MDITDFRTIIALVETGTITAAANVLCRVPSAITTRVQNLESQLGTTLFVKSGRRFLPTNEGQMLYDNALKIIELVTLAEQQMVKPVPGGRFRLGALDSMAATRLPEPLARLYQQHQSVSVELVTGISRTLLDAVLSHELDAAFIADAPADDRLERMAVYKEELVIIAAANFPPIHAAADLTHTTLLVFSDGCSYRDRLTTWFREAGIRPYRLAEMSSYHAILGGVSAGMGAGVIPTPILDTFPTRELITIHPFESENSQITTELIWRKGGLTANTCALIDILSSNIGIA
>NZ_CP041051.1|WP_016808126.1|2231029_2231704_-|HNH-endonuclease
MINRPIVYSATAQEFVDTFNGDASHWDGTCAVRKAFRKEVRDYHRDEQEFTCPYCGRLREEFHGGQWDIDHIIPKSSYPQYLYTPRNLAVTCKDCNTHKSKKNPLLITLDSGAPYPENTVSYKIIHPHFDSYNEHITLRKDKKGRSYHEVITDKGRETFLMCNLIRFSEVICGTSEFIPELGTEIGITNSFSESVQVWLADYDDLNPVDAEIALQALMQKISLR
>NZ_CP041051.1|WP_049014056.1|2231696_2233220_-|ATP-binding-protein
MFRINSIMNDSRDKVRVHDFSEDSHNNYYTILTGDNASGKSSLLSKAINFFLFSNVNNNDRNPAVELECLSERNPSKIIAICNSKFDRFTSNKILNDKLNNKEATQITMSYIHPEVNDNTRRGISGIVDQCIKNSLRHKNIRGLQDANRVKEAFMMFGLQSDLHLKCTLNTQNIKYVLSILSSLVNGGVILSDEGITHTKKIDYSKNEELKNKNFKLDKSIEIILRESEYKNHLDGLYDTLLMLDAGKFTQGNFSSIYFSVAEGTISTESKYLFDDLNEAEIINILFVLDVINVSDIQVMHLNSKKEVNIVSLSSGQRTLFGNAIVLSGYVEKNCMICIDEPENSLHPEWQLNFMRFISLLCPDTLEAHILIATHSPQIISGMQFDNGCVLSLENRDNFDSIIRKENKYEEDGFYELQPLKAYREQSAGKQLTGVFKSPGYKNDFIIKKLLLILSKISKKIALTKDDNEFMDEISILIDKKRIPEGDPVQLIFKQILSFEYARNSDD
>NZ_CP041051.1|WP_139935359.1|2233523_2234126_-|tyrosine-type-recombinase/integrase
MNTSPWNKDRIIGQKRPLQISHIWGFRIRLELEGKTRDLALFNMALDSKLRGCDLVKLKVSDVAYGSSVSSRATVLQQKTGSPVQFEITKGTREAVSALIKLGNLHSKDYLFRSRVGTNQHISPRQYNRIFHGWLAKIGLEDSLYSTHSMRRTKPYLIYKKTKNLRVIQLLLGHKKLESTVRYLGIEVDDALEISESIEV
>NZ_CP041051.1|WP_016808123.1|2234321_2236091_+|AAA-family-ATPase
MTVRLNKVSITNFRSCKYTEAFLRPYTALVGYNNAGKSNIILAIKWLLDGSLLSDADMYDPQNPVRVEGVIEGITDDTLTLLSEENQQKIAPFIIDKTLRFARKQDREVVDGDKLKVKKTLEVFDGTTWKKNPGGIDGAISNLFPEPIHIPAMSDAVEDATKNKAGTTIAKILAAIVSEIKKEYEVKFSENISEIGKYLAHDGSTRLDGLNKIDSGVSQKVNQFFPDVSVKLHFPTPTLDEIFKSGTLKVFEERAGSSIMQDISRFGHGTQRSIQMALIQYLADIKKRSDDTKKSNTLIFIDEPELYLHPSAINSVRESLVALSDLGFQVIISTHSASMLSAKHACNAIQVFKSSEGTIARKTISEKIQELYEASSPQLHSAFTLSNSSFFLFSEEVLLVEGKTETNVLCALYKKIRNNELNPTKTSIVAVDGKGSLLKMANVINSIGIRTRILADCDFLSILLTTSHNEVLSSECDELLSSLTNLSDPQSLQLTNPIISIDSLKSSSSKDFIKICNHHEVKASIKKIHDKLKSDGIYIWKSGDIEQVYGFGKKQSEWDNLLDCLSDDEKEVRAIIKNYDEMEDFILWI
>NZ_CP041051.1|WP_106902826.1|2236279_2237197_-|LysR-family-transcriptional-regulator
MRPALDFITLKVFIAVVERESFVGAAKALEMPTSNVSRCISQLEEKLNLQLIERSTRHMKLTQAGQLLYTRARPLLEALEQTESELTQGQVQLKGPLRICIPNEIGPALLGSVIADFACQHPDVEISCVTNLSGLESLREDLDLAIIVSRGQLDDSDYIARHLVTIPCTIVAAPSVIRRYGAPSHIRQFETLPCITTVSALKGAPWQFVSAKGRFETIAVKGHYRVNSGEMAGRAAVAGVGFAILSKQACQPYINDGRLIEIVLNQSAAPLHLFALYSNRRYLPAKTRVLIDFIHQKLSHLPLVT
>NZ_CP041051.1|WP_139935360.1|2237301_2238510_+|MFS-transporter
MPQVTQIFNHKTLIRIAIIIAFIQFTNALEYMAFTPIFSFMAEAFSVPVSFSGYVSGMYTLGSVLSGVAAFYWVDRFDKKRFLIQNMLLLGTLTFVSTFTTNFDALLALRFCAGLVGGTTMGVGTSILINYSPVNMRGKMLATVIASFSMVSIVGMPAIIYFCTHYGWHISLWSISFLCLLSLPLIAYFIPKDSAQSRAKNKLSIDAQTLLFASCNALVQFSSMLIIPILTPLMTHYLGAQQNQLPLLFLSGGIAGYLSTKITGVLTSRFSALMLSTISTLLFVLSLLIPAAGYHNAVLFITLFLGASYSRLVSSSSVTIQYPADEQRASFSSLQTAIMSLITTFAFFLSSLLLPDHGITTQNLDRLLAVCALAATGFPLMVMVLQKKLAKRIHQPDYVVID
>NZ_CP041051.1|WP_089617520.1|2239101_2240309_-|IS3-family-transposase
MTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSHVARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEVEILKEAVEYGQSPKMDSARALVAKGRGIAMVSRTMGVSRAQLSLRINRSADWQDRRCNRRNEEADAEILSAILNIISDMPSYGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLLLLHHKPERPKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAASTGGYDSSTVQDVMLRSVEKRFGDRLPDTAVQWLTDNGSAYTAYETRRFARELNLEPCTTAVSSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAVAFTHYNENHPHSALGYHSPREYRRQRTSLT
>NZ_CP041051.1|WP_139935362.1|2240668_2241712_+|hypothetical-protein
MTDYWWKDLVDRNNQWQGLELTFKENQRTEPAMEMLSGHFGRMALRLAGEPLFWASMLEDHSGVWLVFNADHPRSQVMLPAVTSEDIERIKAKGELMWIGEWCRYFVRQLMNAPAPLLPPQRWLIRPMLPIQRSSRYSSPQSVALENWRFAAPESTENINCQWTLYGEDFPVLTQPENVRLVDWWWGGYLLLGRYAIQPNTGRLKWWRKKCREGTLPPILVWYIAGLGSYVILDGHYRLQAAIEKQIPPLFLVLSGLTEKEYPADAVNQLRIVQSLEKQLANNPNYSVNAVNQTLISLYDRRYLYASTHSRATLGEGTQWATEVERYLQKHHLDAYRDKIFQRVKGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041051_1	1.1\|2227527\|38\|NZ_CP041051\|CRISPRCasFinder	2227527-2227564	38	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	113727-113764	3	0.921

1. spacer 1.1|2227527|38|NZ_CP041051|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 3, identity: 0.921

cggacgcaagatggtgcgttcaattggactcgaaccaa	CRISPR spacer
cagacgcagaatggtgcgttcaattggactcgaaccaa	Protospacer
*.******..****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

355064 : 427841

Enterobacteria_phage(26.09%)

transposase,tRNA,protease,terminase,integrase,portal,holin,tail

attL 364375:364391|attR 425166:425182

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020838469.1\|355064_355238_+	hypothetical protein	K7PJQ2	Enterobacteria_phage	1.7e-22	98.2
WP_020838472.1\|355303_355576_-	Pyocin activator protein PrtN	S5MQM5	Escherichia_phage	1.2e-38	89.8
WP_139935004.1\|357575_357830_-	hypothetical protein	NA	NA	NA	NA
WP_001253786.1\|357826_358003_-	hypothetical protein	NA	NA	NA	NA
WP_139935005.1\|357990_358530_-	HD family hydrolase	A0A192Y8M4	Salmonella_phage	2.1e-79	80.4
WP_139935006.1\|358658_359486_-	DUF2303 family protein	Q8HAA2	Salmonella_phage	5.6e-140	90.9
WP_001515608.1\|359542_359914_-	hypothetical protein	Q8HAA1	Salmonella_phage	1.1e-58	92.7
WP_139935007.1\|360189_360558_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_139935008.1\|360796_361429_-	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	5.4e-34	43.6
WP_139935009.1\|361526_361751_+	helix-turn-helix domain-containing protein	Q716D6	Shigella_phage	2.4e-13	54.7
WP_139935010.1\|361785_362352_+	DNA-binding protein	A0A1C9II13	Salmonella_phage	1.1e-57	60.5
WP_103848493.1\|362524_362704_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	6.6e-14	71.2
WP_139935011.1\|362693_363575_+	GntR family transcriptional regulator	U5P0A0	Shigella_phage	2.0e-34	87.8
WP_139935012.1\|363571_364891_+	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	3.3e-118	52.5
364375:364391	attL	NA	NA	NA	NA
WP_000780154.1\|364887_365286_+	RusA family crossover junction endodeoxyribonuclease	Q8HA93	Salmonella_phage	4.7e-60	90.2
WP_139935894.1\|365459_366257_+	ORF6N domain-containing protein	F1C5A3	Cronobacter_phage	4.2e-60	47.2
WP_069219404.1\|366253_366775_+	hypothetical protein	Q8W639	Enterobacteria_phage	3.3e-05	39.7
WP_071681477.1\|366785_367841_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.6e-118	57.3
WP_139935013.1\|367856_368687_+	antitermination protein	K7P7B9	Enterobacteria_phage	2.7e-57	46.9
WP_134393419.1\|368810_369347_+	hypothetical protein	NA	NA	NA	NA
WP_008784467.1\|369435_369822_+	membrane protein	A0A192Y8P2	Salmonella_phage	1.0e-56	92.2
WP_000250463.1\|369808_370090_+\|holin	phage holin family protein	A0A0U2SHD1	Escherichia_phage	3.1e-18	50.0
WP_139935014.1\|370089_370707_+	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	2.2e-93	80.4
WP_139935015.1\|370703_371243_+	DUF2514 family protein	A0A0A0P0G7	Enterobacteria_phage	2.1e-07	42.2
WP_127790516.1\|371458_371947_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	3.4e-76	93.2
WP_139935016.1\|371946_374049_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	86.4
WP_001082414.1\|374045_374261_+	hypothetical protein	A5LH28	Enterobacteria_phage	1.5e-25	82.9
WP_044700357.1\|374257_375766_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	6.0e-257	86.3
WP_139935017.1\|375710_377723_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	0.0e+00	86.3
WP_048217461.1\|377814_378141_+	DUF2190 family protein	K7PJY3	Enterobacterial_phage	1.9e-30	60.2
WP_139935018.1\|378133_378409_+	ATP-binding protein	K7PH43	Enterobacteria_phage	2.9e-24	60.4
WP_071667532.1\|378421_378976_+\|tail	phage tail protein	K7P7A8	Enterobacteria_phage	4.8e-63	78.5
WP_008784478.1\|378972_379371_+\|tail	tail protein	K7PHM6	Enterobacterial_phage	4.0e-43	62.8
WP_139935019.1\|379378_380116_+\|tail	phage tail protein	O64327	Escherichia_phage	3.1e-81	62.0
WP_003826205.1\|380152_380560_+\|tail	phage minor tail protein G	K7PM17	Enterobacteria_phage	1.7e-25	58.6
WP_071596416.1\|380568_380889_+\|tail	phage tail assembly protein T	K7PHE1	Enterobacteria_phage	9.4e-35	70.8
WP_139935020.1\|380866_383383_+\|tail	phage tail tape measure protein	K7PKR0	Enterobacteria_phage	0.0e+00	70.3
WP_103014282.1\|383838_384345_+	hypothetical protein	NA	NA	NA	NA
WP_139935021.1\|384448_384697_+	hypothetical protein	Q6UAW3	Klebsiella_phage	5.0e-12	41.5
WP_139935022.1\|384756_385356_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	7.8e-75	73.5
WP_139935023.1\|388715_389660_+	hypothetical protein	H6WRW5	Salmonella_phage	5.6e-120	67.4
WP_139935024.1\|389670_391029_+\|tail	phage tail protein	A0A1V0E5M2	Salmonella_phage	2.4e-111	52.3
WP_139935025.1\|391164_391407_-	DinI-like family protein	Q6UAW0	Klebsiella_phage	1.5e-29	77.9
WP_020838546.1\|391485_391875_+	DNA repair protein	Q1MVE7	Enterobacteria_phage	9.3e-53	73.6
WP_047722298.1\|391906_393001_-\|integrase	site-specific integrase	S5MDN5	Escherichia_phage	2.1e-179	85.0
WP_103798251.1\|393088_394126_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_003031713.1\|394259_394502_+	envelope stress response protein PspG	NA	NA	NA	NA
WP_003841359.1\|394803_395787_-	quinone oxidoreductase	NA	NA	NA	NA
WP_003826610.1\|395851_397267_+	replicative DNA helicase	O80281	Escherichia_phage	1.8e-199	77.9
WP_003844721.1\|397283_398363_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.2e-30	28.5
WP_087879458.1\|398491_399685_+	aromatic amino acid transaminase	NA	NA	NA	NA
WP_044702294.1\|399933_400647_+	acid phosphatase AphA	NA	NA	NA	NA
WP_003031719.1\|400774_401131_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_003031720.1\|401246_404069_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.6
WP_003826621.1\|404320_404845_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	1.1e-53	94.5
WP_139935026.1\|405326_407636_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_003844730.1\|407719_408001_-	hypothetical protein	NA	NA	NA	NA
WP_003841054.1\|408554_410141_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003031731.1\|410143_410467_-	superoxide response transcriptional regulator SoxS	NA	NA	NA	NA
WP_003031733.1\|410553_411012_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_003031735.1\|411736_413086_+	guanine/hypoxanthine transporter GhxP	A0A0R6PHV4	Moraxella_phage	8.8e-159	71.4
WP_003031737.1\|413243_414890_+	Na+/H+ antiporter	NA	NA	NA	NA
WP_003844732.1\|414973_415864_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003031742.1\|415965_416376_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_003031745.1\|416368_417058_+	LrgB family protein	NA	NA	NA	NA
WP_003031747.1\|417104_418754_-	cation/acetate symporter ActP	NA	NA	NA	NA
WP_003031750.1\|418750_419065_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_139935027.1\|419302_421261_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.2e-92	41.5
WP_003031758.1\|423175_423742_+	cytochrome c nitrite reductase pentaheme subunit	NA	NA	NA	NA
WP_005132585.1\|423738_424410_+	cytochrome c nitrite reductase Fe-S protein	NA	NA	NA	NA
WP_139935028.1\|424406_425363_+	cytochrome c nitrite reductase subunit NrfD	NA	NA	NA	NA
425166:425182	attR	NA	NA	NA	NA
WP_094309343.1\|426836_427841_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

515631 : 579818

Vibrio_phage(23.08%)

transposase,tRNA,protease,integrase,holin

attL 509450:509464|attR 526229:526243

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
509450:509464	attL	NA	NA	NA	NA
WP_045332247.1\|515631_516939_+\|integrase	tyrosine-type recombinase/integrase	Q9T1P3	Pseudomonas_phage	5.2e-23	32.0
WP_103015402.1\|517024_518938_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.1e-16	26.8
WP_053520772.1\|518987_519344_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_045332297.1\|519399_520584_-\|integrase	site-specific integrase	A0A221SAN4	Ralstonia_phage	3.6e-31	31.7
WP_016245729.1\|521128_523126_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	2.6e-21	26.2
WP_003036928.1\|523190_524468_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_003843774.1\|524743_525094_+	Morphinone reductase	NA	NA	NA	NA
WP_042111466.1\|525575_525989_+	hypothetical protein	NA	NA	NA	NA
WP_042111470.1\|526276_526843_+	hypothetical protein	NA	NA	NA	NA
526229:526243	attR	NA	NA	NA	NA
WP_042111475.1\|527362_528241_+	DUF3644 domain-containing protein	NA	NA	NA	NA
WP_085950818.1\|528326_529446_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_052672191.1\|529670_530468_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_045332109.1\|530563_532192_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_045332107.1\|532251_533985_-	alpha-glucosidase	NA	NA	NA	NA
WP_000019450.1\|535287_536268_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.8e-185	99.1
WP_045268678.1\|536756_537215_-	hypothetical protein	NA	NA	NA	NA
WP_003025441.1\|538092_538668_-	transcriptional regulator	NA	NA	NA	NA
WP_121540680.1\|538704_540414_-	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_003025447.1\|540389_540737_-	divalent cation tolerance protein CutA	NA	NA	NA	NA
WP_003025449.1\|540864_542166_-	anaerobic C4-dicarboxylate transporter DcuA	NA	NA	NA	NA
WP_003025452.1\|542281_543718_-	aspartate ammonia-lyase	NA	NA	NA	NA
WP_003025457.1\|544056_544533_+	membrane protein FxsA	NA	NA	NA	NA
WP_003844990.1\|544582_545848_-	L-methionine/branched-chain amino acid transporter	NA	NA	NA	NA
WP_000027827.1\|546123_546417_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	1.2e-12	43.3
WP_003025464.1\|546460_548107_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.9e-188	68.1
WP_003025468.1\|548241_548595_+	DUF4156 domain-containing protein	NA	NA	NA	NA
WP_087879107.1\|548774_549638_-	hypothetical protein	NA	NA	NA	NA
WP_139935039.1\|549822_550851_-	EF-P beta-lysylation protein EpmB	NA	NA	NA	NA
WP_003025478.1\|550892_551459_+	elongation factor P	NA	NA	NA	NA
WP_003830568.1\|551516_551651_+	lipoprotein antitoxin entericidin A	NA	NA	NA	NA
WP_003025482.1\|551758_551905_+	lipoprotein toxin entericidin B	NA	NA	NA	NA
WP_003025485.1\|551935_552535_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000118520.1\|552790_553108_+	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
WP_003025522.1\|553104_553638_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.6e-47	54.8
WP_063859877.1\|553730_554876_-	class C beta-lactamase CMY-85	NA	NA	NA	NA
WP_016149439.1\|555007_555883_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003025535.1\|555925_556282_-	fumarate reductase subunit FrdD	NA	NA	NA	NA
WP_003025537.1\|556292_556688_-	fumarate reductase subunit FrdC	NA	NA	NA	NA
WP_003025540.1\|556698_557433_-	fumarate reductase iron-sulfur protein	NA	NA	NA	NA
WP_003025543.1\|557425_559216_-	fumarate reductase (quinol) flavoprotein subunit	NA	NA	NA	NA
WP_003830517.1\|559540_560518_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	8.1e-29	29.1
WP_139935040.1\|560732_562235_+	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_110249121.1\|562371_565686_-	miniconductance mechanosensitive channel MscM	NA	NA	NA	NA
WP_003844975.1\|565703_566672_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_003025561.1\|566764_567817_-	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
WP_003839477.1\|567922_568468_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-28	41.0
WP_044699183.1\|569342_570482_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_139935041.1\|570480_572028_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_003025570.1\|571999_572461_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_016149446.1\|572477_573809_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	1.1e-17	30.1
WP_003844967.1\|573818_575684_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.9e-61	42.4
WP_016149447.1\|575676_576627_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003025584.1\|576711_577020_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_003025589.1\|577094_578375_+	GTPase HflX	NA	NA	NA	NA
WP_003025593.1\|578564_579818_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA

DBSCAN-SWA_3

1070413 : 1078042

Lactobacillus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031421.1\|1070413_1071772_-	murein transglycosylase D	A0A0A7NU10	Lactobacillus_phage	8.9e-10	28.6
WP_139935120.1\|1071843_1072599_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_049016139.1\|1072632_1073355_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003838896.1\|1073351_1073819_-	ribonuclease HI	J9Q745	Salmonella_phage	6.5e-53	60.1
WP_003031410.1\|1073883_1074612_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	3.1e-41	40.7
WP_139935121.1\|1074872_1075823_-	phosphoglycerate dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.1e-19	27.3
WP_139935122.1\|1075896_1076493_-	SIS domain-containing protein	A0A2P0VNK5	Tetraselmis_virus	2.4e-23	33.7
WP_089617520.1\|1076834_1078042_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	5.7e-101	62.9

DBSCAN-SWA_4

2017256 : 2023303

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841892.1\|2017256_2018507_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.9e-22	96.3
WP_139935307.1\|2018642_2019152_-	DedA family protein	NA	NA	NA	NA
WP_003840850.1\|2019326_2019569_-	DinI family protein	Q6UAW0	Klebsiella_phage	1.5e-29	77.9
WP_139935308.1\|2019647_2019881_+	DNA polymerase V	A0A222YZE2	Escherichia_phage	4.3e-21	78.8
WP_139935309.1\|2019957_2020656_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	6.5e-89	67.7
WP_003030762.1\|2020741_2021062_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	3.2e-19	44.8
WP_071684642.1\|2021106_2022396_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	1.2e-165	70.2
WP_003030760.1\|2022408_2022834_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	7.3e-51	70.7
WP_075206724.1\|2023090_2023303_+	isocitrate dehydrogenase	Q77Z09	Phage_21	4.6e-22	90.7

DBSCAN-SWA_5

2116780 : 2120578

Stx2-converting_phage(28.57%)

integrase

attL 2116579:2116601|attR 2125328:2125350

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2116579:2116601	attL	NA	NA	NA	NA
WP_139935331.1\|2116780_2117989_+\|integrase	tyrosine-type recombinase/integrase	I6R9B6	Salmonella_phage	1.5e-181	76.7
WP_032936075.1\|2117946_2118183_-	hypothetical protein	A0A1P8DTG1	Proteus_phage	3.3e-13	53.7
WP_139935332.1\|2118285_2118450_-	DUF551 domain-containing protein	NA	NA	NA	NA
WP_139935333.1\|2118442_2118922_-	AP2 domain-containing protein	A0A2I7R856	Vibrio_phage	5.5e-39	49.7
WP_139935334.1\|2118923_2119139_-	TraR/DksA family transcriptional regulator	A0A0P0ZCX5	Stx2-converting_phage	1.7e-16	62.3
WP_139935335.1\|2119230_2119617_-	DUF2591 family protein	A0A1J0GUX1	Halomonas_phage	2.9e-06	35.1
WP_022650956.1\|2119613_2119805_-	DUF1382 family protein	A0A0P0ZC60	Stx2-converting_phage	4.1e-14	66.1
WP_168199046.1\|2119801_2120578_-	MmcB family DNA repair protein	A9YWY3	Burkholderia_phage	4.4e-46	39.0
2125328:2125350	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2128928 : 2138966

Brazilian_cedratvirus(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003832580.1\|2128928_2129912_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.4e-33	38.5
WP_003030574.1\|2129927_2132315_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003030571.1\|2132319_2132619_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_003832584.1\|2132772_2133753_+	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	6.7e-15	24.8
WP_137348238.1\|2133813_2134365_+	glutathione peroxidase	NA	NA	NA	NA
WP_003030567.1\|2134364_2135114_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	9.3e-09	30.3
WP_003836644.1\|2135191_2135656_+	lipoprotein nlpC	A0A1V0DZX6	Clostridioides_phage	3.5e-14	38.2
WP_003836643.1\|2135972_2136686_+	EAL domain-containing protein	NA	NA	NA	NA
WP_016150131.1\|2136747_2138190_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	7.7e-52	35.3
WP_058842631.1\|2138186_2138966_-	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.1e-10	26.4

DBSCAN-SWA_7

2806117 : 2881957

Shigella_phage(29.55%)

transposase,protease,capsid,portal,tRNA,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089617520.1\|2806117_2807324_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	5.7e-101	62.9
WP_003844127.1\|2807395_2808433_+	hypothetical protein	NA	NA	NA	NA
WP_041162689.1\|2808638_2809073_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	8.8e-20	39.2
WP_003034964.1\|2809130_2810012_-\|protease	protease HtpX	NA	NA	NA	NA
WP_049002329.1\|2810204_2812253_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	1.6e-87	33.7
WP_003034957.1\|2812272_2812959_-	RNA chaperone ProQ	NA	NA	NA	NA
WP_003034953.1\|2813055_2813553_-	GAF domain-containing protein	NA	NA	NA	NA
WP_139935480.1\|2813681_2814965_+	membrane integrity lipid transport subunit YebS	NA	NA	NA	NA
WP_016150396.1\|2814933_2817567_+	PqiB family protein	NA	NA	NA	NA
WP_139935481.1\|2817646_2819068_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
WP_029139506.1\|2819168_2819405_+	DUF1480 family protein	NA	NA	NA	NA
WP_003034941.1\|2819507_2819699_+	YebW family protein	NA	NA	NA	NA
WP_003034937.1\|2819699_2820341_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	8.7e-56	50.5
WP_003034934.1\|2820753_2821092_-	YebY family protein	NA	NA	NA	NA
WP_003844135.1\|2821112_2821985_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_003844136.1\|2821988_2822363_-	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_003844137.1\|2822621_2822831_-	hypothetical protein	NA	NA	NA	NA
WP_164562674.1\|2822994_2823576_+	hypothetical protein	NA	NA	NA	NA
WP_008322661.1\|2824068_2824260_+	hypothetical protein	NA	NA	NA	NA
WP_003844140.1\|2824579_2825482_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.5e-16	34.0
WP_071684716.1\|2825835_2826414_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	4.2e-17	37.2
WP_071684717.1\|2826727_2827420_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_019076528.1\|2827864_2829616_-	recombinase family protein	Q3HQV4	Burkholderia_phage	7.2e-44	33.3
WP_003034925.1\|2829764_2829995_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.0e-14	60.3
WP_003841657.1\|2830101_2830758_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_003844144.1\|2830781_2831444_+	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	2.0e-07	39.3
WP_032939143.1\|2831446_2833525_-	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	8.3e-31	36.3
WP_003844146.1\|2833587_2834247_-	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_003034909.1\|2834341_2834695_-	hypothetical protein	NA	NA	NA	NA
WP_003034906.1\|2834816_2835107_-	DNA damage-inducible protein YebG	NA	NA	NA	NA
WP_003844149.1\|2835238_2836417_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_003034901.1\|2836484_2837126_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_003841668.1\|2837160_2838972_-	phosphogluconate dehydratase	NA	NA	NA	NA
WP_003034896.1\|2839205_2840681_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.3e-78	37.1
WP_003034893.1\|2841048_2841918_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003034890.1\|2842036_2843479_+	pyruvate kinase	NA	NA	NA	NA
WP_003841672.1\|2843523_2844495_-	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
WP_003034883.1\|2844614_2845934_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	36.8
WP_049002353.1\|2845949_2846894_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_003034877.1\|2846972_2847728_+	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	6.5e-18	28.3
WP_003034874.1\|2847724_2848510_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_003034872.1\|2848588_2849599_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.6e-08	25.4
WP_003034869.1\|2849607_2850219_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003034867.1\|2850299_2850821_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
WP_003034865.1\|2850855_2851599_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003844155.1\|2851627_2852071_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_049002340.1\|2852072_2853845_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_003841685.1\|2854111_2854678_+	hydrolase	NA	NA	NA	NA
WP_139935482.1\|2855031_2855271_+	DinI-like family protein	K7PKR6	Enterobacteria_phage	9.7e-37	98.7
WP_139935483.1\|2855356_2855767_-	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_000506745.1\|2855958_2856291_-	hypothetical protein	K7PGV5	Enterobacterial_phage	5.2e-20	53.1
WP_000661045.1\|2857880_2858150_-\|tail	phage tail assembly protein	M1FPE4	Enterobacteria_phage	4.9e-37	80.9
WP_049015471.1\|2858149_2858506_-\|tail	tail protein	U5P076	Shigella_phage	8.8e-58	89.8
WP_139935484.1\|2858505_2859999_-\|tail	phage tail protein	Q8SBH2	Shigella_phage	8.7e-208	73.7
WP_046671236.1\|2859995_2860178_-	DUF2635 domain-containing protein	Q8SBH3	Shigella_phage	3.7e-12	61.8
WP_139935485.1\|2860185_2860746_-	hypothetical protein	Q8SBH4	Shigella_phage	5.2e-81	76.9
WP_109862846.1\|2860745_2861249_-	hypothetical protein	Q8SBH5	Shigella_phage	6.1e-81	89.2
WP_139935486.1\|2861223_2861637_-\|head	phage head closure protein	U5P0R0	Shigella_phage	1.9e-48	69.3
WP_139935487.1\|2861633_2861957_-\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	6.1e-34	63.6
WP_139935488.1\|2862030_2863248_-\|capsid	phage major capsid protein	A0A1W6JP20	Morganella_phage	1.0e-166	73.8
WP_045888755.1\|2863257_2863857_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	4.3e-89	80.0
WP_168199050.1\|2863849_2865259_-\|portal	phage portal protein	Q8SBI0	Shigella_phage	9.7e-201	88.4
WP_048221270.1\|2866077_2866944_-	GntR family transcriptional regulator	U5P0A0	Shigella_phage	1.9e-34	87.8
WP_003034732.1\|2866933_2867113_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	3.0e-14	73.1
WP_053390030.1\|2867285_2867837_-	hypothetical protein	Q8SBF4	Shigella_phage	1.2e-45	53.5
WP_115601843.1\|2867865_2868063_-	hypothetical protein	K7PHB1	Enterobacterial_phage	2.6e-19	73.8
WP_115602402.1\|2868162_2868819_+	helix-turn-helix domain-containing protein	K7PLZ5	Enterobacterial_phage	1.8e-85	66.5
WP_096757391.1\|2869153_2869345_-	hypothetical protein	S5FM78	Shigella_phage	8.9e-25	92.1
WP_085049599.1\|2869657_2870575_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.0e-106	64.7
WP_046669975.1\|2870960_2871500_+	hypothetical protein	A0A192Y8M4	Salmonella_phage	9.5e-80	80.4
WP_001253787.1\|2871487_2871664_+	hypothetical protein	NA	NA	NA	NA
WP_139935489.1\|2871660_2871915_+	hypothetical protein	NA	NA	NA	NA
WP_139935490.1\|2872358_2872652_+	hypothetical protein	A0A1V0E5L2	Salmonella_phage	2.7e-44	88.7
WP_139935491.1\|2872648_2873257_+	hypothetical protein	A0A192Y6F5	Salmonella_phage	3.8e-29	70.6
WP_139935492.1\|2873258_2873828_+	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	9.6e-91	81.8
WP_003839185.1\|2873868_2874105_+	excisionase family protein	Q8W657	Enterobacteria_phage	4.6e-39	89.7
WP_139935493.1\|2874163_2875477_+	DUF3596 domain-containing protein	Q8W658	Enterobacteria_phage	3.9e-236	90.1
WP_168199061.1\|2875455_2876229_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.8e-55	78.0
WP_003034689.1\|2876281_2876677_+	membrane protein	NA	NA	NA	NA
WP_003034686.1\|2876717_2877461_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	3.2e-25	31.3
WP_003839177.1\|2877457_2878426_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_016150525.1\|2878669_2879416_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_071684724.1\|2879418_2879985_-	VOC family protein	NA	NA	NA	NA
WP_003034673.1\|2880223_2881957_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	1.7e-85	33.6

DBSCAN-SWA_8

3089367 : 3098945

Bacillus_phage(28.57%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844344.1\|3089367_3090771_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	5.0e-32	29.2
WP_003036797.1\|3090767_3091490_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	9.2e-30	32.7
WP_003841759.1\|3091625_3091958_+	YegP family protein	NA	NA	NA	NA
WP_003844346.1\|3092117_3093479_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.1e-204	92.9
WP_003036804.1\|3093748_3096025_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.1
WP_003036810.1\|3096055_3096376_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-13	45.7
WP_003036813.1\|3096699_3096924_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_003840216.1\|3096998_3098945_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.4e-40	41.8

DBSCAN-SWA_9

3148273 : 3156691

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027344.1\|3148273_3150307_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.0e-54	27.6
WP_003840158.1\|3150512_3150971_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	5.1e-50	68.0
WP_003027346.1\|3151013_3151484_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.9e-64	76.9
WP_003840155.1\|3151530_3152250_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_003027348.1\|3152246_3153932_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-281	91.6
WP_049002964.1\|3154157_3154889_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.8e-105	93.5
WP_003027354.1\|3154940_3155048_+	protein YohO	NA	NA	NA	NA
WP_086539162.1\|3155028_3155760_-	ABC transporter permease	NA	NA	NA	NA
WP_032949638.1\|3155743_3156691_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.4e-22	29.2

DBSCAN-SWA_10

3375149 : 3401923

Enterobacteria_phage(53.33%)

tail,integrase

attL 3370521:3370535|attR 3379509:3379523

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3370521:3370535	attL	NA	NA	NA	NA
WP_003839292.1\|3375149_3376091_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	7.5e-149	89.3
WP_139935608.1\|3376401_3377559_+\|integrase	tyrosine-type recombinase/integrase	Q9AZ40	Salmonella_phage	2.8e-190	82.3
WP_139935609.1\|3378361_3378775_-\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	2.7e-26	48.9
WP_139935610.1\|3379604_3380339_-	DUF2612 domain-containing protein	A0A0M5M1K4	Salmonella_phage	5.6e-59	83.6
3379509:3379523	attR	NA	NA	NA	NA
WP_116291301.1\|3380335_3380452_-	hypothetical protein	NA	NA	NA	NA
WP_139935611.1\|3380448_3380808_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	2.4e-63	95.8
WP_139935612.1\|3380804_3381095_-	DUF1364 family protein	K7PGZ6	Enterobacteria_phage	4.1e-45	90.5
WP_054626103.1\|3381087_3381258_-	hypothetical protein	G8C7V4	Escherichia_phage	2.9e-11	60.0
WP_032180568.1\|3381257_3381695_-	recombination protein NinB	G8C7V3	Escherichia_phage	2.6e-59	77.9
WP_139935613.1\|3383088_3383307_-	DUF4014 family protein	Q5G8V0	Enterobacteria_phage	5.0e-32	91.7
WP_139935614.1\|3383311_3383878_-	hypothetical protein	K7P858	Enterobacteria_phage	3.5e-16	56.4
WP_139935616.1\|3384215_3384620_-	hypothetical protein	NA	NA	NA	NA
WP_139935617.1\|3384621_3385245_-	phage replication protein	K7PM39	Enterobacteria_phage	1.4e-95	84.8
WP_139935618.1\|3385371_3386085_+	helix-turn-helix domain-containing protein	M1FN96	Enterobacteria_phage	4.1e-99	75.9
WP_106931048.1\|3386140_3386395_+	hypothetical protein	NA	NA	NA	NA
WP_106931050.1\|3386391_3386904_+	hypothetical protein	NA	NA	NA	NA
WP_139935619.1\|3387057_3387282_-	hypothetical protein	K7P7I0	Enterobacteria_phage	2.1e-17	67.6
WP_139935620.1\|3387617_3387983_+	antitermination protein	C6ZR44	Salmonella_phage	5.5e-39	68.6
WP_139935621.1\|3387985_3388723_+	keratin	A0A088CC14	Shigella_phage	8.4e-63	53.5
WP_139935622.1\|3388763_3389027_+	hypothetical protein	NA	NA	NA	NA
WP_139815595.1\|3389070_3389301_+	hypothetical protein	NA	NA	NA	NA
WP_003833690.1\|3389442_3389601_+	hypothetical protein	M9NZI5	Enterobacteria_phage	5.3e-15	75.0
WP_003833696.1\|3389597_3389804_+	hypothetical protein	K7P6H3	Enterobacteria_phage	3.9e-26	84.4
WP_139935623.1\|3389813_3390650_+	hypothetical protein	M9NYX5	Enterobacteria_phage	2.5e-143	92.1
WP_139935624.1\|3390744_3391713_+	hypothetical protein	M9P0E1	Enterobacteria_phage	6.3e-34	70.0
WP_139935625.1\|3391720_3392005_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.6e-46	91.5
WP_139935626.1\|3392023_3392869_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	2.8e-70	61.2
WP_139935627.1\|3392865_3393546_+	YqaJ viral recombinase family protein	M9NZE1	Enterobacteria_phage	4.3e-130	97.8
WP_071701032.1\|3394098_3394371_+	DUF5405 family protein	K7P7M4	Enterobacteria_phage	1.1e-20	61.2
WP_139935628.1\|3394367_3394589_+	TraR/DksA family transcriptional regulator	A0A0N7C211	Escherichia_phage	1.4e-13	53.7
WP_139935629.1\|3394588_3394951_+	hypothetical protein	G8C7S4	Escherichia_phage	3.7e-56	92.0
WP_139935630.1\|3394913_3395153_+	DUF4222 domain-containing protein	M1FPC8	Enterobacteria_phage	7.8e-10	46.2
WP_139935631.1\|3395162_3395780_+	DUF5420 family protein	A0A075B8I7	Enterobacteria_phage	1.2e-89	77.1
WP_023294204.1\|3395919_3396120_+	transcriptional regulator	K7P7V0	Enterobacteria_phage	5.3e-28	84.8
WP_003839291.1\|3396231_3396861_-	hypothetical protein	NA	NA	NA	NA
WP_139935632.1\|3397035_3398934_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-14	24.3
WP_139935633.1\|3399452_3399707_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_003845054.1\|3399830_3400424_+	Slp family lipoprotein	NA	NA	NA	NA
WP_139935634.1\|3400954_3401485_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_139935635.1\|3401533_3401923_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.7e-18	44.1

DBSCAN-SWA_11

3518413 : 3533256

Salmonella_phage(75.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139935653.1\|3518413_3518617_+	DUF2633 family protein	G9L6F2	Escherichia_phage	7.3e-17	69.8
WP_003838477.1\|3518981_3519860_+	small-conductance mechanosensitive channel MscS	NA	NA	NA	NA
WP_139935654.1\|3520082_3520565_-	DUF2514 family protein	Q858E9	Salmonella_phage	6.1e-70	91.2
WP_139935655.1\|3520561_3521188_-	glycoside hydrolase family 19 protein	T1SBJ3	Salmonella_phage	7.5e-113	94.2
WP_139935656.1\|3521177_3521486_-\|holin	phage holin family protein	T1SA10	Salmonella_phage	3.2e-48	98.0
WP_001275998.1\|3521472_3521877_-	membrane protein	T1SA79	Salmonella_phage	9.9e-66	100.0
WP_139935657.1\|3522049_3523075_+	acyltransferase family protein	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	3.1e-23	28.3
WP_003847193.1\|3525451_3525712_+	hypothetical protein	T1SA06	Salmonella_phage	7.6e-43	100.0
WP_045719437.1\|3525761_3525902_-	hypothetical protein	T1SA77	Salmonella_phage	1.1e-13	93.5
WP_139935658.1\|3525912_3528387_-	hypothetical protein	T1S9I6	Salmonella_phage	0.0e+00	98.3
WP_139935659.1\|3528391_3530194_-	hypothetical protein	T1SAQ5	Salmonella_phage	1.1e-289	92.2
WP_139935660.1\|3530190_3532701_-	hypothetical protein	A0A193GYI3	Enterobacter_phage	0.0e+00	82.7
WP_139935661.1\|3532713_3533256_-	hypothetical protein	T1SA02	Salmonella_phage	1.4e-70	98.9

DBSCAN-SWA_12

3537157 : 3554193

Salmonella_phage(56.52%)

terminase,integrase

attL 3542149:3542163|attR 3567600:3567614

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052922682.1\|3537157_3537751_-\|terminase	terminase small subunit	T1SBI8	Salmonella_phage	5.7e-102	98.5
WP_139935663.1\|3537854_3538193_-	hypothetical protein	Q858C6	Salmonella_phage	7.5e-51	91.1
WP_139935664.1\|3538463_3538706_-	hypothetical protein	NA	NA	NA	NA
WP_139935665.1\|3538702_3539470_-	DUF551 domain-containing protein	A0A192Y7X3	Salmonella_phage	5.0e-18	54.1
WP_125112488.1\|3539480_3539756_-	hypothetical protein	NA	NA	NA	NA
WP_139935666.1\|3539757_3540315_-	ead/Ea22-like family protein	A0A075B8K3	Enterobacteria_phage	2.6e-08	32.1
WP_139935667.1\|3540311_3540566_-	hypothetical protein	A2I2Z5	Vibrio_virus	2.2e-10	40.7
WP_168199040.1\|3540562_3540958_-	hypothetical protein	A0A0F6N6A6	Escherichia_phage	1.2e-07	32.8
WP_139935669.1\|3541459_3542512_-	DNA cytosine methyltransferase	Q858D4	Salmonella_phage	5.8e-158	72.6
3542149:3542163	attL	NA	NA	NA	NA
WP_139935670.1\|3542856_3543090_-	hypothetical protein	T1SAR5	Salmonella_phage	5.0e-38	96.1
WP_139935671.1\|3543245_3543842_+	helix-turn-helix domain-containing protein	Q858D7	Salmonella_phage	3.2e-105	98.0
WP_001198622.1\|3544066_3544216_+	hypothetical protein	T1SA20	Salmonella_phage	1.1e-14	70.2
WP_139935672.1\|3544212_3545205_+	hypothetical protein	M9P0E1	Enterobacteria_phage	4.3e-54	75.4
WP_052930710.1\|3545212_3545515_+	hypothetical protein	T1SA88	Salmonella_phage	3.8e-46	97.0
WP_139935673.1\|3545511_3546333_+	exodeoxyribonuclease VIII	A0A193GYK2	Enterobacter_phage	2.7e-158	96.7
WP_109174198.1\|3546329_3547211_+	recombinase RecT	T1SBJ5	Salmonella_phage	3.9e-155	94.9
WP_000816432.1\|3547257_3547506_+	AlpA family phage regulatory protein	A0A0F6TJ45	Escherichia_coli_O157_typing_phage	1.5e-32	81.7
WP_000041117.1\|3547615_3547915_+	PerC family transcriptional regulator	T1S9J5	Salmonella_phage	4.0e-48	99.0
WP_139935674.1\|3547907_3548066_+	DUF1317 family protein	T1SAR0	Salmonella_phage	1.1e-17	82.7
WP_139935675.1\|3548062_3548635_+	morphogenetic protein	Q71T76	Escherichia_phage	3.6e-45	47.4
WP_139935676.1\|3548631_3548823_+	DUF1382 family protein	G9L698	Escherichia_phage	6.8e-17	76.3
WP_139935677.1\|3548819_3549467_+	adenine methylase	A0A193GYV6	Enterobacter_phage	8.3e-123	95.3
WP_168199052.1\|3549463_3549631_+	hypothetical protein	T1SA82	Salmonella_phage	8.0e-22	98.2
WP_139935678.1\|3549639_3550893_-\|integrase	tyrosine-type recombinase/integrase	T1S9J3	Salmonella_phage	9.5e-232	96.4
WP_003037760.1\|3551085_3552663_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_003037756.1\|3552726_3554193_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	5.7e-87	38.5
3567600:3567614	attR	NA	NA	NA	NA

DBSCAN-SWA_13

3712403 : 3719894

Escherichia_phage(33.33%)

integrase

attL 3697674:3697687|attR 3721877:3721890

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3697674:3697687	attL	NA	NA	NA	NA
WP_139935915.1\|3712403_3712613_-	hypothetical protein	G8C7R9	Escherichia_phage	3.5e-22	68.1
WP_139935694.1\|3712682_3712976_+	hypothetical protein	A0A1V0E5L2	Salmonella_phage	7.7e-44	89.6
WP_139935695.1\|3713822_3714392_+	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	2.1e-90	81.3
WP_139935696.1\|3714597_3715770_+	DUF3596 domain-containing protein	I6PDJ1	Cronobacter_phage	9.7e-146	66.2
WP_139935697.1\|3715814_3716615_+	hypothetical protein	NA	NA	NA	NA
WP_023337654.1\|3716825_3718055_+\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	6.7e-206	85.8
WP_047743978.1\|3718337_3719894_+	recombinase family protein	A0A0A7RTP8	Clostridium_phage	3.2e-19	30.0
3721877:3721890	attR	NA	NA	NA	NA

DBSCAN-SWA_14

4382332 : 4389983

Pseudoalteromonas_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139935814.1\|4382332_4383310_+	calcium/sodium antiporter	A0A2D1GNI8	Pseudoalteromonas_phage	8.1e-05	23.0
WP_003025063.1\|4383323_4384310_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.9e-38	31.5
WP_003025065.1\|4384330_4384897_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	4.2e-54	76.3
WP_003025068.1\|4384893_4385469_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003025070.1\|4385437_4385986_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_003025073.1\|4385992_4386718_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-22	28.4
WP_003025074.1\|4386764_4388198_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003025078.1\|4388220_4388508_+	ribosome hibernation promoting factor	A0A0M7QCF2	Escherichia_phage	4.2e-10	43.2
WP_003025083.1\|4388591_4389083_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003025085.1\|4389128_4389983_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP041048

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

85116 : 116454

Salmonella_phage(38.46%)

integrase,transposase

attL 82997:83012|attR 119340:119355

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
82997:83012	attL	NA	NA	NA	NA
WP_000608644.1\|85116_86379_+\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
WP_011091028.1\|86713_87589_+	class A extended-spectrum beta-lactamase CTX-M-3	A0A1B0VBP7	Salmonella_phage	5.4e-125	82.1
WP_013023839.1\|87635_88112_-	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
WP_000027057.1\|88370_89231_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_001235713.1\|89413_89971_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_001143760.1\|90134_93140_+\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	100.0
WP_000575656.1\|93440_93722_+	hypothetical protein	NA	NA	NA	NA
WP_001132404.1\|93740_94304_+	hypothetical protein	NA	NA	NA	NA
WP_039272368.1\|94306_95311_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	1.3e-42	35.5
WP_039272366.1\|95675_95927_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024134513.1\|95936_97244_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_039272364.1\|97240_97735_+	hypothetical protein	NA	NA	NA	NA
WP_044596315.1\|97909_98848_-	hypothetical protein	NA	NA	NA	NA
WP_031611419.1\|99046_100687_+	hypothetical protein	NA	NA	NA	NA
WP_031611417.1\|101058_101361_-	hypothetical protein	NA	NA	NA	NA
WP_001138014.1\|102488_105455_-\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0
WP_001161490.1\|105458_106019_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
WP_001323888.1\|106007_106175_+	hypothetical protein	A0A1B0V7I9	Salmonella_phage	2.3e-24	98.2
WP_000454193.1\|106194_106545_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000845039.1\|106747_107761_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_013263789.1\|107927_108728_+	subclass B1 metallo-beta-lactamase VIM-1	NA	NA	NA	NA
WP_003159191.1\|108835_109390_+	aminoglycoside N-acetyltransferase AAC(6')-Ib4	NA	NA	NA	NA
WP_019407932.1\|109460_110255_+	aminoglycoside O-phosphotransferase APH(3')-XV	Q75ZG1	Hepacivirus	1.3e-40	39.4
WP_001206317.1\|110371_111163_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_012477387.1\|111215_111848_+	type B-2 chloramphenicol O-acetyltransferase CatB2	M1HKK6	Paramecium_bursaria_Chlorella_virus	4.1e-26	44.4
WP_000679427.1\|112016_112364_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|112357_113197_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000376623.1\|113324_113825_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011899345.1\|113881_114781_-	AAA family ATPase	NA	NA	NA	NA
WP_139934932.1\|114783_116454_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
119340:119355	attR	NA	NA	NA	NA

DBSCAN-SWA_2

123309 : 131086

Escherichia_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|123309_124014_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_002904004.1\|124150_125011_+	class A extended-spectrum beta-lactamase SHV-12	A0A077SL40	Escherichia_phage	2.2e-155	99.3
WP_002210513.1\|125031_125793_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_001067855.1\|126633_127338_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001549892.1\|127730_127970_-	hypothetical protein	I6PD82	Cronobacter_phage	4.4e-21	55.1
WP_000343760.1\|128071_129292_+\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_001549893.1\|129380_130043_-	recombinase family protein	M9Q1K0	Clostridium_phage	9.7e-10	29.1
WP_000516402.1\|130423_131086_+	peptidyl-arginine deiminase	E5FFJ3	Burkholderia_phage	2.6e-07	25.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP041047

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2884 : 52005

Escherichia_phage(50.0%)

transposase,holin,integrase

attL 1731:1744|attR 17999:18012

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1731:1744	attL	NA	NA	NA	NA
WP_032425611.1\|2884_3916_+\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_039265231.1\|5994_6525_-	hypothetical protein	NA	NA	NA	NA
WP_048213827.1\|6859_7639_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	1.7e-50	89.3
WP_048213826.1\|7635_8202_-	hypothetical protein	NA	NA	NA	NA
WP_048213825.1\|8264_8624_-	hypothetical protein	NA	NA	NA	NA
WP_168199034.1\|8762_9224_-	hypothetical protein	NA	NA	NA	NA
WP_001261282.1\|9180_9411_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001044770.1\|9407_9824_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_001348075.1\|9897_10134_+	AAA family ATPase	NA	NA	NA	NA
WP_059331711.1\|10180_10885_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	4.0e-139	99.6
WP_139934917.1\|10830_11646_-	AAA family ATPase	NA	NA	NA	NA
WP_033488203.1\|11635_13297_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_021242984.1\|13280_13841_-	recombinase family protein	A0A1W5LU24	Ralstonia_phage	1.9e-30	41.8
WP_089617520.1\|14132_15339_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	5.7e-101	62.9
WP_001567386.1\|15530_16007_-	DM13 domain-containing protein	NA	NA	NA	NA
WP_001567387.1\|16099_16366_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_001567388.1\|16506_17127_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001567390.1\|17587_18457_-	DMT family transporter	NA	NA	NA	NA
17999:18012	attR	NA	NA	NA	NA
WP_004729622.1\|18697_19450_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_135716487.1\|19889_20894_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_094309343.1\|23021_24026_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_001567377.1\|24746_25241_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_001567378.1\|25230_25692_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_021243014.1\|25715_25853_-	hypothetical protein	NA	NA	NA	NA
WP_001567380.1\|25926_26433_-	DUF417 family protein	NA	NA	NA	NA
WP_001567381.1\|26463_26724_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_001567382.1\|26936_27494_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001567383.1\|27590_27857_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_000427623.1\|28230_29235_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001067855.1\|30951_31656_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_012695450.1\|33324_33909_+	recombinase family protein	A0A219YA40	Aeromonas_phage	2.0e-22	36.1
WP_000108589.1\|34093_34651_+	OsmC family protein	NA	NA	NA	NA
WP_020277920.1\|34792_35374_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020277919.1\|35378_35717_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002431133.1\|35746_36076_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.3e-10	34.7
WP_006687059.1\|36289_37396_+	alkene reductase	NA	NA	NA	NA
WP_020277918.1\|37461_38163_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_020277917.1\|38228_39002_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_001067855.1\|39099_39804_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001097412.1\|41205_41769_-	hypothetical protein	NA	NA	NA	NA
WP_001348195.1\|41792_42167_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001515734.1\|42231_42795_-\|transposase	transposase	NA	NA	NA	NA
WP_000046891.1\|43037_43373_+	thermonuclease family protein	G8DH70	Emiliania_huxleyi_virus	2.8e-05	35.7
WP_000624775.1\|43988_44222_-	hypothetical protein	NA	NA	NA	NA
WP_139934918.1\|44246_44951_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.0e-135	100.0
WP_001067855.1\|44987_45692_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001752509.1\|46018_46519_+	non-heme ferritin-like protein	NA	NA	NA	NA
WP_000019445.1\|46835_47816_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
WP_000780222.1\|48093_48375_-	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_000493286.1\|48355_48685_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_000625672.1\|50097_51375_-	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_168199035.1\|51438_52005_-\|holin	choline transporter	NA	NA	NA	NA

DBSCAN-SWA_2

118667 : 163100

Escherichia_phage(28.57%)

transposase,integrase

attL 123794:123808|attR 137516:137530

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000019445.1\|118667_119648_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
WP_077260398.1\|119646_120354_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_046499110.1\|120380_120767_-	plasmid stability protein	NA	NA	NA	NA
WP_046499539.1\|120780_121743_-	plasmid stabilization protein	A0A222YXF2	Escherichia_phage	9.6e-59	41.1
WP_139212154.1\|122533_123853_+\|integrase	site-specific integrase	NA	NA	NA	NA
123794:123808	attL	NA	NA	NA	NA
WP_071199356.1\|123842_125393_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_071199357.1\|125389_127753_+	hypothetical protein	NA	NA	NA	NA
WP_008786699.1\|128426_130154_+	AAA family ATPase	NA	NA	NA	NA
WP_008786698.1\|130150_131566_+	AAA family ATPase	NA	NA	NA	NA
WP_032941625.1\|131696_132326_-	hypothetical protein	NA	NA	NA	NA
WP_020996176.1\|132989_133883_-	hypothetical protein	NA	NA	NA	NA
WP_008786695.1\|134550_134808_-	molecular chaperone DnaJ	NA	NA	NA	NA
WP_008786694.1\|134880_136077_-	hypothetical protein	NA	NA	NA	NA
WP_020996177.1\|136460_137240_-	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_008786692.1\|137578_137968_-	hypothetical protein	NA	NA	NA	NA
137516:137530	attR	NA	NA	NA	NA
WP_008786691.1\|137964_139338_-	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.0e-41	33.6
WP_008786690.1\|139694_140273_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_008786689.1\|140607_141570_+	hypothetical protein	NA	NA	NA	NA
WP_008786688.1\|141573_142002_+	universal stress protein	NA	NA	NA	NA
WP_008786687.1\|142017_143304_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.0e-124	54.3
WP_159060712.1\|143379_143517_-	hypothetical protein	NA	NA	NA	NA
WP_020996179.1\|143622_144309_+	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_008786685.1\|144343_144718_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	9.6e-31	62.0
WP_008786684.1\|144828_147165_+	HAD-IC family P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	7.6e-33	24.0
WP_008786683.1\|147229_148750_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	6.7e-06	26.4
WP_059331711.1\|149134_149839_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	4.0e-139	99.6
WP_139934922.1\|150153_151845_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	6.7e-39	45.9
WP_032309857.1\|151957_152077_+	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|152412_153117_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001000602.1\|153309_154461_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	6.7e-99	53.7
WP_007372347.1\|155915_157529_-	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	2.2e-07	37.0
WP_016241542.1\|158108_158375_+	hypothetical protein	NA	NA	NA	NA
WP_007372345.1\|158586_158805_-	hypothetical protein	NA	NA	NA	NA
WP_007372343.1\|159087_159411_+	hypothetical protein	NA	NA	NA	NA
WP_007372342.1\|159446_160370_-	hypothetical protein	NA	NA	NA	NA
WP_007372341.1\|160550_160778_-	hypothetical protein	NA	NA	NA	NA
WP_048213831.1\|161130_161928_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.5e-137	94.7
WP_048213832.1\|161927_163100_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.3e-219	94.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage