CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP041055	Enterobacter hormaechei strain C126 plasmid unnamed1	0 crisprs	NA	0	0
NZ_CP041056	Enterobacter hormaechei strain C126 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0
NZ_CP041058	Enterobacter hormaechei strain C126 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0
NZ_CP041053	Enterobacter hormaechei strain C126 plasmid pEnC126OXA181, complete sequence	0 crisprs	NA	0	0
NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	0 crisprs	DEDDh	0	1
NZ_CP041060	Enterobacter hormaechei strain C126 plasmid unnamed6	0 crisprs	NA	0	0
NZ_CP041054	Enterobacter hormaechei strain C126 chromosome, complete genome	1 crisprs	DEDDh	1	4
NZ_CP041057	Enterobacter hormaechei strain C126 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
NZ_CP041059	Enterobacter hormaechei strain C126 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3804 : 59775

Escherichia_phage(27.78%)

transposase,integrase

attL 57507:57522|attR 62417:62432

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151405929.1\|3804_4809_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_151405931.1\|4887_7854_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	95.7
WP_151405932.1\|7857_8418_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.0e-57	96.0
WP_151406021.1\|8601_9036_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_151405933.1\|9006_9711_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.5e-138	99.1
WP_151406022.1\|10019_10832_+	NDM family subclass B1 metallo-beta-lactamase	NA	NA	NA	NA
WP_004201167.1\|10835_11201_+	bleomycin binding protein Ble-MBL	NA	NA	NA	NA
WP_015058923.1\|11205_11865_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_004193231.1\|12691_13567_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025999322.1\|13570_13936_-	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_052238321.1\|13828_14164_+	ethidium bromide resistance protein	NA	NA	NA	NA
WP_131086839.1\|14157_14997_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	6.5e-11	27.2
WP_151405934.1\|15401_16943_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_151405935.1\|17179_18016_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.3e-87	58.1
WP_000359986.1\|18341_19115_+	ArmA family 16S rRNA (guanine(1405)-N(7))-methyltransferase	NA	NA	NA	NA
WP_077252464.1\|19095_19377_-	hypothetical protein	NA	NA	NA	NA
WP_002026779.1\|19596_19782_-	hypothetical protein	NA	NA	NA	NA
WP_151405936.1\|19830_21015_+\|transposase	IS4-like element ISEc29 family transposase	A0A0F7LAS3	uncultured_marine_virus	4.2e-48	34.5
WP_000052512.1\|21413_22889_+	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_000155092.1\|22944_23829_+	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_004896925.1\|24187_24730_-	hypothetical protein	NA	NA	NA	NA
WP_001118618.1\|25543_26467_+\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	4.9e-177	99.7
WP_001067858.1\|26651_27356_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_001087810.1\|28060_28297_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_000995361.1\|28293_28659_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000761850.1\|28770_29409_-	organomercurial lyase MerB	NA	NA	NA	NA
WP_151405937.1\|29423_31109_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	4.8e-37	27.6
WP_000732290.1\|31180_31456_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294666.1\|31471_31822_-	mercuric transport protein MerT	NA	NA	NA	NA
WP_000414383.1\|31893_32328_+	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_151405938.1\|32427_33432_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_001326390.1\|34046_34448_+	hypothetical protein	NA	NA	NA	NA
WP_000988731.1\|34561_35287_+	hypothetical protein	NA	NA	NA	NA
WP_032410269.1\|35261_35465_-	hypothetical protein	NA	NA	NA	NA
WP_151405939.1\|35419_39673_+	RHS repeat protein	A0A2H4JHK7	uncultured_Caudovirales_phage	1.1e-18	47.6
WP_001326394.1\|39644_40085_+	hypothetical protein	NA	NA	NA	NA
WP_151406023.1\|40285_40708_+	hypothetical protein	NA	NA	NA	NA
WP_151406024.1\|40723_41326_-	hypothetical protein	NA	NA	NA	NA
WP_151405940.1\|41557_42418_-	TEM family class A beta-lactamase	Q1MVP3	Enterobacteria_phage	6.2e-158	98.6
WP_151406025.1\|43117_43942_-	class D beta-lactamase	NA	NA	NA	NA
WP_151405941.1\|44001_44790_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_151405943.1\|44859_45414_-	AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase	NA	NA	NA	NA
WP_151405945.1\|45647_46205_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	1.3e-92	97.8
WP_151405949.1\|48886_49591_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.9e-139	99.6
WP_063840321.1\|49734_50289_+	fluoroquinolone-acetylating aminoglycoside 6'-N-acetyltransferase AAC(6')-Ib-cr5	NA	NA	NA	NA
WP_151406026.1\|50419_51250_+	OXA-1 family class D beta-lactamase	NA	NA	NA	NA
WP_151406027.1\|51881_52586_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	3.4e-138	99.1
WP_151405951.1\|52576_53104_+\|transposase	transposase	A0A1B0VDR3	Salmonella_phage	5.5e-40	100.0
WP_151405954.1\|53359_54235_+	CTX-M family class A extended-spectrum beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.3e-123	81.7
WP_001393253.1\|54281_54614_-	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
57507:57522	attL	NA	NA	NA	NA
WP_151405956.1\|57606_57927_+	hypothetical protein	NA	NA	NA	NA
WP_000932879.1\|57945_58233_+	hypothetical protein	NA	NA	NA	NA
WP_000949433.1\|58225_58762_+	hypothetical protein	NA	NA	NA	NA
WP_134906290.1\|58764_59775_+\|integrase	tyrosine-type recombinase/integrase	A0A0K0N6I5	Gordonia_phage	4.0e-07	31.9
62417:62432	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041054

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041054_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041054_1

897559-897641

Orphan

Consensus_repeat	Method
TGGACACTGGCTGGACATCGGCTGGACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041054_1

>merge|NZ_CP041054|1|897559-897641|CRISPRCasFinder
TGGACACTGGCTGGACATCGGCTGGACACTCCACCTCCACAGGCATTGATATAACTGCGTTTGCGCTGGACACCGGCTGGACA

>NZ_CP041054|1|1|897559-897641|CRISPRCasFinder
TGGACACTGGCTGGACATCGGCTGGACA	CTCCACCTCCACAGGCATTGATATAAC
TGCGTTTGCGCTGGACACCGGCTGGACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041054.1\|WP_151406243.1\|874671_874863_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406248.1\|893471_893849_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406252.1\|909422_909695_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182245
NZ_CP041054.1\|WP_045626128.1\|902562_902817_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406254.1\|983496_983823_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185003
NZ_CP041054.1\|WP_151406253.1\|941804_942092_-\|Grx4-family-monothiol-glutaredoxin	unknown	unknown	gnl\|CDD\|182759
NZ_CP041054.1\|WP_151406244.1\|876224_876611_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406249.1\|894005_894518_-\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP041054.1\|WP_151406246.1\|889118_889301_-\|KilA-N-domain-containing-protein	unknown	unknown	gnl\|CDD\|367917
NZ_CP041054.1\|WP_003857623.1\|940570_940978_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|182358
NZ_CP041054.1\|WP_127341244.1\|901284_901680_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406250.1\|904953_905307_+\|regulator	unknown	unknown	unknown
NZ_CP041054.1\|WP_045618058.1\|878661_879015_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406251.1\|906924_907257_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_072199670.1\|914405_914567_+\|division-septum-protein-Blr	unknown	unknown	gnl\|CDD\|380226
NZ_CP041054.1\|WP_151406242.1\|874318_874672_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406245.1\|888506_888809_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_003857632.1\|945284_945374_-\|YnhF-family-membrane-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406241.1\|873548_873869_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041054.1\|WP_151406247.1\|892679_892850_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182029

Protein	Function_ID	Function_description	E-value
NZ_CP041054.1\|WP_151406246.1\|889118_889301_-\|KilA-N-domain-containing-protein	gnl\|CDD\|367917	pfam04383, KilA-N, KilA-N domain. The amino-terminal module of the D6R/N1R proteins defines a novel, conserved DNA-binding domain (the KilA-N domain) that is found in a wide range of proteins of large bacterial and eukaryotic DNA viruses. The KilA-N domain family also includes the previously defined APSES domain. The KilA-N and APSES domains may also share a common fold with the nucleic acid-binding modules of the LAGLIDADG nucleases and the amino-terminal domains of the tRNA endonuclease.	1.21806e-08
NZ_CP041054.1\|WP_003857623.1\|940570_940978_+\|lactoylglutathione-lyase	gnl\|CDD\|182358	PRK10291, PRK10291, glyoxalase I; Provisional.	5.95891e-86
NZ_CP041054.1\|WP_151406249.1\|894005_894518_-\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	1.66955e-12
NZ_CP041054.1\|WP_151406254.1\|983496_983823_-\|hypothetical-protein	gnl\|CDD\|185003	PRK15043, PRK15043, HTH-type transcriptional regulator MlrA.	2.46397e-05
NZ_CP041054.1\|WP_151406253.1\|941804_942092_-\|Grx4-family-monothiol-glutaredoxin	gnl\|CDD\|182759	PRK10824, PRK10824, Grx4 family monothiol glutaredoxin.	9.75764e-71
NZ_CP041054.1\|WP_072199670.1\|914405_914567_+\|division-septum-protein-Blr	gnl\|CDD\|380226	NF033231, small_Blr, division septum protein Blr. Members of this family are Blr, named beta-lactam resistance protein because mutants have heightened sensitivity to beta-lactam antibiotics, but actually involved in cell division. The protein is very small.	1.25143e-21
NZ_CP041054.1\|WP_151406247.1\|892679_892850_-\|hypothetical-protein	gnl\|CDD\|182029	PRK09689, PRK09689, prophage protein NinE; Provisional.	5.2655e-22
NZ_CP041054.1\|WP_151406252.1\|909422_909695_+\|hypothetical-protein	gnl\|CDD\|182245	PRK10110, PRK10110, PTS maltose transporter subunit IICB.	6.34227e-53

>NZ_CP041054.1|WP_151406249.1|894005_894518_-|DUF551-domain-containing-protein
MPEYVELERFQEAITNHTEDKLAMVDHSGDANEKVEPVTTAYKLPANTPCKDAPEHIWLQTAGVWPENGEFSELTWCSDNQHKDDTLYVRADVVSGNSPVIPDGWVACSEQMPEDEQEVIVQNKMGYRYVSYFDEHSGLFFDMRGGNQMNCIEHIFVTHWMPLPAAPQQK
>NZ_CP041054.1|WP_151406248.1|893471_893849_-|hypothetical-protein
MQGKQYLYETLKACAERANSYSKGKKGAEWSFHDAANIVRCLNLAMGSIINYSDTNNQDAMKGLKQFFISQLNMELFEELNYEVGPDAFFRGEELTSMTSDIYSQWLNIISFFNLMIVTDDDLAD
>NZ_CP041054.1|WP_151406247.1|892679_892850_-|hypothetical-protein
MNNPLARVITNEIFRVPARRQRKPAIKPSDIPTMKGYTARPVDQKWLRLAARRAHG
>NZ_CP041054.1|WP_151406246.1|889118_889301_-|KilA-N-domain-containing-protein
MKSLTLFNQPIRVGEDGMICLTDMWKASGKSDAESPYHYLRNKQTKEFLVELKKTTNLWF
>NZ_CP041054.1|WP_151406245.1|888506_888809_-|hypothetical-protein
MNNRVIECASRAGRDFSEFMKGEKDMMQVLASVDQFGEQLRLNGCVNHHFVSYMMRNSIMQAFMDMANAEKKEERRSKRAEAKRSSHYRSSLIEKTRAMK
>NZ_CP041054.1|WP_045618058.1|878661_879015_-|hypothetical-protein
MAIDYRRMRATATRLLTENGKAYQLTRGGTTTRDQYGKEVITEPITATVTGVITEYSTREIDGSLIATGDKKLAATFETEVRIGDIIDIDGQKWRVVQPNPVKPADVLISYNIQLRT
>NZ_CP041054.1|WP_151406244.1|876224_876611_-|hypothetical-protein
MSGTIEISEVGMTVNMAGGGKIVIGNWGDGPVNTAAARPPLTPEEELYGRGLCLLPDGWEDLSGDGHWQHQLTESLRQLWPSFSREQKMTIAYSINELSDELTNIAYEASGNNTSAHRTRTSKKVFQL
>NZ_CP041054.1|WP_151406243.1|874671_874863_-|hypothetical-protein
MEVFHHLSAPATQWRVGASGRPALIITFSPDVRVTRVEDAAACMADLQIMESEALKVMHKETK
>NZ_CP041054.1|WP_151406242.1|874318_874672_-|hypothetical-protein
MTDQIASITLRADVSDLKTASNELDKLSRAAAGAVDKADDLNSVFRAGAESAKQGSEGLKEQQNALKGLLENIDPVTKALNRPDEQQESLRKFQAKGFSDTETFQAYNKIRTTPVSS
>NZ_CP041054.1|WP_151406241.1|873548_873869_-|hypothetical-protein
MLRALRDALFGFNEESRETAESATNISDAAEGLNNTSEAAEKLGRAGGLLNTFNLAIAGSVGLLALLAGAAYSSSQQFDNVARSLILMGGLAFLHAATERRGKRCC
>NZ_CP041054.1|WP_127341244.1|901284_901680_-|hypothetical-protein
MLAISGLNRHSAASTHFSKTRTASGEHESVVALFTPKHDFHLSVCLPSAPRKELLVNRFAIIAALPEPAYGPTHGLLSRRSTDRISTSPLANFAQLSMFRFDGLKITLVMSDGNNLIYNINHISYKLMITK
>NZ_CP041054.1|WP_045626128.1|902562_902817_+|hypothetical-protein
MSKENHGGPAFPHIRKPVATGVEEVITNGGMSLRDYFAAKAMASIVRRWDGHSFGVGPESLQYKELAEDAYYIADAMLHAREAS
>NZ_CP041054.1|WP_151406250.1|904953_905307_+|regulator
MIQTRGRPVTSSEIAEKFGVTLIEFNRVANGITRGSGQIAQIVESEKWLNEDGICDRAFDLVTKPKVVTPQGKSRLFTRRAIEQSREGRRQECIERAARRRRLIAQGLYIDEMESVL
>NZ_CP041054.1|WP_151406251.1|906924_907257_+|hypothetical-protein
MVGKRPASFTDVIDKAYRVKMTDCYFLNLELSLMQEQDDTFNRHPPEQEKLLTDLYWEDIQELERIAQLSDFTLTPKASKLLNDFVKREPLLAQTLGMMPSIPLMALKRS
>NZ_CP041054.1|WP_151406252.1|909422_909695_+|hypothetical-protein
MSKVGSFAFSFLPVMFCIAIPLGLARENKGVAAFAGFVGYAVMNLAVNFWLTAKGILPTTDAAVLKANNIQSVIGIQSIDTGILGAVIAG
>NZ_CP041054.1|WP_072199670.1|914405_914567_+|division-septum-protein-Blr
MDKLQTQIMASIINRIIELAGWIVLGVSVVLLGIASHIDNYQPPEPVTVAQQK
>NZ_CP041054.1|WP_003857623.1|940570_940978_+|lactoylglutathione-lyase
MRLLHTMLRVGDLQRSIDFYTNVLGMKLLRTSENPEYKYSLAFVGYGPESDEAVIELTYNWGVDSYELGTAYGHIALEVDNAAEACERIRSNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEAKDAGRGLGN
>NZ_CP041054.1|WP_151406253.1|941804_942092_-|Grx4-family-monothiol-glutaredoxin
MKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDILIEMYQRGELQQLIKETAAKYKTEEPDAE
>NZ_CP041054.1|WP_003857632.1|945284_945374_-|YnhF-family-membrane-protein
MSTDLKFSLFTTIVVLALIVAGGLTAALH
>NZ_CP041054.1|WP_151406254.1|983496_983823_-|hypothetical-protein
MWLEAARLAYKGWHIDVLAEPIDSPRPELFPGKKSSSGPVKRLRLVNRSSSTTGVNRVSPFRSITDVKGPTVNRQCGILPSGDTTGYPRRCIASVPCHIVGLFHHQVV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041054_1	1.1\|897587\|27\|NZ_CP041054\|CRISPRCasFinder	897587-897613	27	NZ_LR134256	Klebsiella aerogenes strain NCTC9644 plasmid 3, complete sequence	1565-1591	4	0.852

1. spacer 1.1|897587|27|NZ_CP041054|CRISPRCasFinder matches to NZ_LR134256 (Klebsiella aerogenes strain NCTC9644 plasmid 3, complete sequence) position: , mismatch: 4, identity: 0.852

ctccacctccacaggcattgatataac	CRISPR spacer
ctccacctccgcaggcattggtactac	Protospacer
**********.*********.**. **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

683 : 4502

Enterobacteria_phage(50.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151406070.1\|683_1115_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	5.3e-49	88.6
WP_151406071.1\|1032_1317_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	1.5e-39	93.2
WP_151406072.1\|3226_3472_+	hypothetical protein	K7P7L6	Enterobacteria_phage	5.3e-30	97.2
WP_151406073.1\|3468_3603_+	hypothetical protein	K7P7L6	Enterobacteria_phage	6.9e-16	100.0
WP_151406074.1\|3689_3992_+	hypothetical protein	A0A2H4JHR1	uncultured_Caudovirales_phage	1.2e-28	68.7
WP_151406075.1\|4289_4502_+	hypothetical protein	K7PM96	Enterobacterial_phage	2.7e-30	100.0

DBSCAN-SWA_2

861071 : 866271

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151406227.1\|861071_861305_-	cor protein	E4WL42	Enterobacteria_phage	1.9e-29	78.9
WP_151406228.1\|863460_863853_-	hypothetical protein	K7PKM0	Enterobacterial_phage	5.6e-05	81.2
WP_151406229.1\|864121_864388_-	hypothetical protein	G8C7R4	Escherichia_phage	8.6e-18	97.6
WP_151406230.1\|864436_864646_-	hypothetical protein	G8C7R4	Escherichia_phage	4.0e-26	95.2
WP_151406231.1\|864660_865836_-	host specificity protein J	G8C7R4	Escherichia_phage	2.1e-209	91.6
WP_151406232.1\|866079_866271_-	hypothetical protein	G8C7R4	Escherichia_phage	1.3e-20	98.0

DBSCAN-SWA_3

869278 : 876611

Escherichia_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151406234.1\|869278_869626_-	hypothetical protein	G8C7R0	Escherichia_phage	2.3e-50	88.8
WP_045626275.1\|870064_870346_-	hypothetical protein	NA	NA	NA	NA
WP_151406235.1\|870412_870637_-	hypothetical protein	NA	NA	NA	NA
WP_151406236.1\|871546_871762_+	hypothetical protein	NA	NA	NA	NA
WP_151406237.1\|871909_872251_-	hypothetical protein	G8C7Q6	Escherichia_phage	1.6e-40	90.6
WP_151406238.1\|872502_872967_-	hypothetical protein	G8C7Q6	Escherichia_phage	5.2e-34	79.0
WP_151406239.1\|873056_873242_-	hypothetical protein	G8C7Q6	Escherichia_phage	1.7e-20	81.0
WP_151406240.1\|873258_873558_-	hypothetical protein	A0A0P0J001	Klebsiella_phage	8.5e-14	49.4
WP_151406241.1\|873548_873869_-	hypothetical protein	NA	NA	NA	NA
WP_151406242.1\|874318_874672_-	hypothetical protein	G8C7Q6	Escherichia_phage	1.1e-31	69.1
WP_151406243.1\|874671_874863_-	hypothetical protein	NA	NA	NA	NA
WP_151406244.1\|876224_876611_-	hypothetical protein	S4TTH3	Salmonella_phage	1.5e-39	73.8

DBSCAN-SWA_4

4457424 : 4462300

Colwellia_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151406591.1\|4457424_4457607_-	hypothetical protein	I3UMG3	Colwellia_phage	3.4e-18	75.0
WP_151406592.1\|4457555_4457996_-	hypothetical protein	A0A2I7S840	Vibrio_phage	1.3e-47	66.4
WP_151406593.1\|4458003_4458234_-	hypothetical protein	A0A2D1GNB1	Pseudoalteromonas_phage	1.3e-09	76.9
WP_151406594.1\|4458212_4458491_-	hypothetical protein	M4M9Q6	Vibrio_phage	5.1e-37	85.2
WP_151406595.1\|4458487_4458826_-	hypothetical protein	A0A1W5PTL2	Pseudoalteromonas_phage	1.2e-19	73.8
WP_151406596.1\|4458835_4459165_-	hypothetical protein	I3UMG3	Colwellia_phage	7.1e-30	74.1
WP_151406597.1\|4460377_4460845_+	hypothetical protein	G3M9Z5	Bacillus_virus	3.5e-30	50.4
WP_151406598.1\|4460849_4461062_+	hypothetical protein	A0A0K1LQ80	Klebsiella_phage	6.4e-08	47.4
WP_151406599.1\|4461036_4461216_+	hypothetical protein	NA	NA	NA	NA
WP_151406600.1\|4461193_4462300_+	hypothetical protein	A0A141HRZ7	Bacillus_phage	4.7e-17	22.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041052

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP041054

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection