CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
NZ_CP041071	Bacillus tropicus strain LM1212-W3 chromosome, complete genome	4 crisprs	DinG,csa3,WYL,cas3,cas14j,RT,DEDDh,cas14k,c2c9_V-U4	1	16
NZ_CP041081	Bacillus tropicus strain LM1212-W3 plasmid p8, complete sequence	0 crisprs	NA	0	0
NZ_CP041078	Bacillus tropicus strain LM1212-W3 plasmid p5, complete sequence	0 crisprs	NA	0	0
NZ_CP041079	Bacillus tropicus strain LM1212-W3 plasmid p6, complete sequence	0 crisprs	NA	0	0
NZ_CP041075	Bacillus tropicus strain LM1212-W3 plasmid p2, complete sequence	0 crisprs	RT,cas14j,csa3	0	2
NZ_CP041080	Bacillus tropicus strain LM1212-W3 plasmid p7, complete sequence	0 crisprs	NA	0	0
NZ_CP041072	Bacillus tropicus strain LM1212-W3 plasmid p9, complete sequence	0 crisprs	NA	0	0
NZ_CP041077	Bacillus tropicus strain LM1212-W3 plasmid p4, complete sequence	0 crisprs	NA	0	0
NZ_CP041074	Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence	0 crisprs	csa3	0	2
NZ_CP041073	Bacillus tropicus strain LM1212-W3 plasmid p10, complete sequence	0 crisprs	NA	0	0
NZ_CP041076	Bacillus tropicus strain LM1212-W3 plasmid p3, complete sequence	0 crisprs	csa3,WYL	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041071_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041071_1

489203-489303

Orphan

Consensus_repeat	Method
GGTCCGCCTGGTGGGCCAACAGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP041071_1

>merge|NZ_CP041071|1|489203-489303|CRISPRCasFinder
GGTCCGCCTGGTGGGCCAACAGGAACAACCGGTCCCATTGGTCCGTCTAGTGGAGTGACTGGTCCATCTGGTCCACCCGGTCCACCTGGTGGGCCAACAGG

>NZ_CP041071|1|1|489203-489303|CRISPRCasFinder
GGTCCGCCTGGTGGGCCAACAGG	AACAACCGGTCCCATT
GGTCCGTCTAGTGGAGTGACTGG	TCCATCTGGTCCACCC
GGTCCACCTGGTGGGCCAACAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041071.1\|WP_029439016.1\|485583_486771_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP041071.1\|WP_029439005.1\|500682_501063_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319905
NZ_CP041071.1\|WP_118991741.1\|490898_493403_+\|collagen-like-protein	unknown	unknown	gnl\|CDD\|367362
NZ_CP041071.1\|WP_029439021.1\|480499_481282_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NZ_CP041071.1\|WP_029439014.1\|487467_488223_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP041071.1\|WP_029439008.1\|498690_499254_+\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP041071.1\|WP_000945246.1\|493474_493618_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029439015.1\|486883_487426_+\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378696
NZ_CP041071.1\|WP_000285639.1\|481535_481943_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NZ_CP041071.1\|WP_061687307.1\|484724_484964_-\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806
NZ_CP041071.1\|WP_000539730.1\|494495_494744_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP041071.1\|WP_029439019.1\|483443_483857_+\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP041071.1\|WP_029439006.1\|499592_500621_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP041071.1\|WP_000402271.1\|482062_483391_+\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP041071.1\|WP_118991742.1\|497467_498505_+\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NZ_CP041071.1\|WP_080449714.1\|485040_485436_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029439012.1\|493896_494358_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP041071.1\|WP_029439010.1\|495958_497116_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|237107
NZ_CP041071.1\|WP_000938438.1\|484055_484604_+\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NZ_CP041071.1\|WP_029439011.1\|494807_495929_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701

Protein	Function_ID	Function_description	E-value
NZ_CP041071.1\|WP_029439016.1\|485583_486771_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.3898e-70
NZ_CP041071.1\|WP_029439005.1\|500682_501063_+\|hypothetical-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.88451e-63
NZ_CP041071.1\|WP_118991741.1\|490898_493403_+\|collagen-like-protein	gnl\|CDD\|367362	pfam03157, Glutenin_hmw, High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.	2.82664e-07
NZ_CP041071.1\|WP_029439021.1\|480499_481282_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.56902e-09
NZ_CP041071.1\|WP_029439014.1\|487467_488223_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.93307e-22
NZ_CP041071.1\|WP_029439008.1\|498690_499254_+\|maltose-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.89995e-101
NZ_CP041071.1\|WP_029439012.1\|493896_494358_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.82658e-14
NZ_CP041071.1\|WP_029439015.1\|486883_487426_+\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	4.13757e-18
NZ_CP041071.1\|WP_000285639.1\|481535_481943_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	5.12621e-60
NZ_CP041071.1\|WP_061687307.1\|484724_484964_-\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	2.73962e-12
NZ_CP041071.1\|WP_000539730.1\|494495_494744_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.47241e-09
NZ_CP041071.1\|WP_029439019.1\|483443_483857_+\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.43588e-07
NZ_CP041071.1\|WP_029439006.1\|499592_500621_+\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	6.74694e-23
NZ_CP041071.1\|WP_000402271.1\|482062_483391_+\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	9.10675e-161
NZ_CP041071.1\|WP_118991742.1\|497467_498505_+\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0
NZ_CP041071.1\|WP_029439010.1\|495958_497116_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|237107	PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NZ_CP041071.1\|WP_000938438.1\|484055_484604_+\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NZ_CP041071.1\|WP_029439011.1\|494807_495929_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	1.57902e-58

>NZ_CP041071.1|WP_029439014.1|487467_488223_+|class-I-SAM-dependent-methyltransferase
MEGTQMLALNKKCWDTVAPYFFQVDCLPKYGPYTASEDEIHLFDSIRNKKVLDIGCGSGHSLQYMAEHGAEELWGLDLSSEQIKTANETLKSWNSKLICGAMEEEGDIPKEYFDIVYSIYALGWTSDLRKTLELIYSYVKPGGSFVFSWEHPVYSNLMYGTEEIALSSSYHEETPITFETFKGEDVQATLYKRKISTYINELNRAGFTIERIEEPAPASSFAGETAEPSTKYYSLYKARMVPTTFIIKARK
>NZ_CP041071.1|WP_029439015.1|486883_487426_+|CGNR-zinc-finger-domain-containing-protein
MNQNAPNELEYIREFLNTWRIPNDTREPIDLLQTEEDIKLFMKEYFDEELPFHTIEELKSFREDIRMVIEGEESLHKWLEKYPFQVNVREDMKGITYEPVLEENMYTKVLSIVLTAIQENLWGRLKACPDCRWVFYDHSRNGSKRWCGMYAGEEGGRACGTIAKVKNYRAKRKGRSGYNV
>NZ_CP041071.1|WP_029439016.1|485583_486771_-|MFS-transporter
MKSFSTPIRFMLISSFFMSFGYFAVYAFLAIYLLNFLYFSAFQVGTVLTVMIITSRVIPLFSGLIADKIGYIIMMIAGLFLRGIGFIALGICSDFYTISISSALIGFGTAFYEPAARAIFGSQPAHLRKNLFTYLNLSFNCGAIIGPIAGGFLLLLDPIYAFSLTGSLMLLFAFIFYLLKNHFQVTTENTSITLGIQAILQNKLFLLFSFIMIFFYIMFTQLTVALPLHMKNISNSNQLATLVITINAITGVIFMVLFRKLFLKYNTLSFIKYGVLLMSISFLLIPLFQHPYWLFICVILFTIGETLVLPNADIAIANYSNESYTATYFGFYQLSLAFGFIIGNYTGTWFTSNLNGMYTPWLIFGGIGLIGFISLHILNIKKERSKEDIYLLEKY
>NZ_CP041071.1|WP_080449714.1|485040_485436_-|hypothetical-protein
MESGDVMKKKLLVLLFTGIILSGCSTIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDNDDGEIVTFKQVRYTVKN
>NZ_CP041071.1|WP_061687307.1|484724_484964_-|DUF3923-family-protein
MKKRWISWWIGNIFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSISLIVILIAFIIPVFFQVIWLIINLRMSKKNNYTI
>NZ_CP041071.1|WP_000938438.1|484055_484604_+|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NZ_CP041071.1|WP_029439019.1|483443_483857_+|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANMQLVKEEEKKREHASKNIEL
>NZ_CP041071.1|WP_000402271.1|482062_483391_+|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKVRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAERVTLLLAGPLMMFYKVMYPFIWVLNGSARVVTGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NZ_CP041071.1|WP_000285639.1|481535_481943_+|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHRLEVELTELKPLLDELTDSQREKISKSLSGQTTALIQTLALLL
>NZ_CP041071.1|WP_029439021.1|480499_481282_-|glycosyltransferase-family-2-protein
MINMRKTLISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLFAPHWEVRDSRFLEFDPTNTDIEVMEIEREVSGWKMVLNTTEFLCCNNVEEFFSSLHTLGQNMYAIRMIVMIDKHDYNYPKLRYSIPLVEQRYHGLFPYKPEIGCAWRFIHNHLDGAYLPGRHFTRHQPIVYNSPSFIFKFYFSPWNEHAKARKLQITPTLSKKGIRMGLQAHYGQSLEQLETRFLELSSITQDLRKHPEYQQLFPKFKP
>NZ_CP041071.1|WP_118991741.1|490898_493403_+|collagen-like-protein
MLVKDQDKCSKFQAPIPFPASGITGPTGPTGPTGSLGGPTGPQGIQGVQGPIGPTGPTGIQGVQGVQGEIGPTGPTGLTGPRGAQGSQGPMGEQGPQGIQGVQGMQGERGPTGPTGNQGIQGIPGPMGQVGLTGIQGIQGIQGEIGPTGPTGIQGIQGVQGEIGPTGPTGNTGIQGVQGNLGNSGLQGVTGIQGIQGPIGPTGPTGSQGIQGEQGPMGPTGATGVQGLQGPQGEMGLTGPTGSQGIQGVQGVIGPTGPTGLQGDPGPTGSTGPTGVTGPTGSATGPTGATGPTGPPGGPTGPTGPAGSPGGPTGPTGATGATGATGATGATGIQGVQGIQGPTGVTGLTGLQGVQGPMGATGPTGDQGIQGPQGVMGVTGPTGLQGLQGIQGPVGTTGPTGPQGVQGAQGPIGPTGPQGIQGIQGEQGVRGATGPTGLQGLQGIQGIQGPTGPQGIQGVQGPSGITGPTGPQGIQGIQGPQGNIGPTGATGIQGVQGPEGPTGPTGATGPQGIQGIQGLQGPTGPQGIQGIQGIQGPIGPTGPTGPQGIQGITGATGPTGATGATGATGVTGPQGPQGIQGPQGVTGQAGATGPTGATGPQGVQGIQGPQGVTGQAGATGPTGVTGPQGIQGIQGAQGVTGATGATGATGATGPTGTQGIQGITGATGGTGVTGPTGATGPTGLTGATGSSAISTGGGYFFSTSTSTIAANANIPINSGSTVYGTGVSLTSATTVTVTTPGIYLVSYYFQGDANGGNETVSVRLLLNGTQLAGSFIQNVTTSTVVIEPAISNTLLVNVTSANSTLILQNGPLGVGHVTTIAGAITASLNVVRIL
>NZ_CP041071.1|WP_000945246.1|493474_493618_-|hypothetical-protein
MLRLSDHAIKMMEQRLRLEQHRTYQANKVVDNLHHKYFFQHIFQPKR
>NZ_CP041071.1|WP_029439012.1|493896_494358_-|GNAT-family-N-acetyltransferase
MIQKLITTSHNTAASILNIQIPAYEIEAKYINSTAIPRLYDTVTDIQSCDEIFYGYFYENTLAGFISFKIDEEEIDIHRLVVSPDHFHKGIATKLLLYLFDMFSSSKTYIVQTGKGNTPALSLYKKHGFIEVQNIVLPDGVILTSLKKTENNK
>NZ_CP041071.1|WP_000539730.1|494495_494744_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGRLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NZ_CP041071.1|WP_029439011.1|494807_495929_+|AI-2E-family-transporter
MEKLNIRKRDKLKKFFREHNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVASMVKDYTVDFTKSLSSVTGNVTGFLSTLTEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRRPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NZ_CP041071.1|WP_029439010.1|495958_497116_-|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATKELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDLEKFPCLQYAYECGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEANQWARQYANQLLIKKS
>NZ_CP041071.1|WP_118991742.1|497467_498505_+|tryptophan--tRNA-ligase
MRGSFYFEKGGVRMSDKIMLTGIKPTGYPHLGNYIGAIKPALQMSKKNEGKALYFIADYHALNAVHNPSQFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGMTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEKEKLRKLIFKIKTDSSLPNEPKELETLFTIYKEFATEDEMQSMRGKYETGIGWGDVKKELFCVVDRELAGPREKYAMYMDEANLLYEALEKGAKQAREIAKANLAEIKKRIGFEGGR
>NZ_CP041071.1|WP_029439008.1|498690_499254_+|maltose-O-acetyltransferase
MKTEKEKMLAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRYTLLNQLLGSSADGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NZ_CP041071.1|WP_029439006.1|499592_500621_+|ROK-family-protein
MSEQFVTQKSIKETILRGIRTALLERGSATKVELSNALEISFPTISKFIENMKQDGEVTLVGLDDSSGGRRAKRYAYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSMLIDTGVNVLSKHIEGLIATFPKISSISIGVPGSVDNGRIFYIPGYENFQNFNLKSHLEQQFSIPVVIENDMNAAVLGYYKNTGNYDDSSLVYLYSGKNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHAFIFCDDEVNQFVIEQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NZ_CP041071.1|WP_029439005.1|500682_501063_+|hypothetical-protein
MKIEHVAIWVNDLEGMRDFYKQYFNGEENSLYHNPKKQFESYFITFEGGARLELMKQVGIDDVLQTQTIGYAHIAFSVGSEEKVNELTNTLREAGYPVLNGPRTTGDGYYESVVSDPEGNQIEITI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041071_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041071_2

857268-857423

Orphan

Consensus_repeat	Method
AGGAATGAATATTCATTCCGGAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP041071_2

>merge|NZ_CP041071|2|857268-857423|CRISPRCasFinder
AGGAATGAATATTCATTCCTAAATAGAATTAAAAAATGAGAGTAGGAGAGGGTATTTGTGCAACTAAAGGAATGAATATTCATTCCGGAAAGACTAGTTTAATAGAGTTTACAAAATAATGTAATAAAATGATAGGAATGAATATTCATTCCGTAA

>NZ_CP041071|2|2|857268-857423|CRISPRCasFinder
AGGAATGAATATTCATTCCTAAA	TAGAATTAAAAAATGAGAGTAGGAGAGGGTATTTGTGCAACTAA
AGGAATGAATATTCATTCCGGAA	AGACTAGTTTAATAGAGTTTACAAAATAATGTAATAAAATGAT
AGGAATGAATATTCATTCCGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041071.1\|WP_029438733.1\|853869_855159_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP041071.1\|WP_029438728.1\|869527_869797_+\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99905
NZ_CP041071.1\|WP_029438736.1\|849109_850186_+\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614
NZ_CP041071.1\|WP_118991767.1\|861013_861862_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
NZ_CP041071.1\|WP_001107307.1\|856680_857247_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP041071.1\|WP_029438729.1\|867408_869514_+\|BglG-family-transcription-antiterminator	unknown	unknown	gnl\|CDD\|226234
NZ_CP041071.1\|WP_118991766.1\|851659_852760_+\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP041071.1\|WP_098320812.1\|842910_843990_+\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496
NZ_CP041071.1\|WP_029438731.1\|857458_860575_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP041071.1\|WP_118991765.1\|844765_848278_+\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|238697
NZ_CP041071.1\|WP_029438730.1\|866427_867102_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP041071.1\|WP_029438738.1\|844177_844615_-\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP041071.1\|WP_029438734.1\|852752_853853_+\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP041071.1\|WP_029438727.1\|869821_871093_+\|PTS-ascorbate-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|236502
NZ_CP041071.1\|WP_029438732.1\|855294_856452_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_CP041071.1\|WP_000633862.1\|862251_863877_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP041071.1\|WP_029438726.1\|871262_871688_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029438735.1\|850468_851641_+\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP041071.1\|WP_118991768.1\|864397_866371_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP041071.1\|WP_029438725.1\|871728_872556_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569

Protein	Function_ID	Function_description	E-value
NZ_CP041071.1\|WP_029438733.1\|853869_855159_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP041071.1\|WP_029438728.1\|869527_869797_+\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99905	cd05563, PTS_IIB_ascorbate, PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is an L-ascorbate-specific permease with two cytoplasmic subunits (IIA and IIB) and a transmembrane channel IIC subunit. Subunits IIA, IIB, and IIC are encoded by the sgaA, sgaB, and sgaT genes of the E. coli sgaTBA operon. In some bacteria, the IIB (SgaB) domain is fused C-terminal to the IIA (SgaT) domain. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include ascorbate, chitobiose/lichenan, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	5.50815e-34
NZ_CP041071.1\|WP_029438736.1\|849109_850186_+\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP041071.1\|WP_118991767.1\|861013_861862_+\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	5.72342e-147
NZ_CP041071.1\|WP_001107307.1\|856680_857247_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	3.38872e-64
NZ_CP041071.1\|WP_029438729.1\|867408_869514_+\|BglG-family-transcription-antiterminator	gnl\|CDD\|226234	COG3711, BglG, Transcriptional antiterminator [Transcription].	3.86028e-56
NZ_CP041071.1\|WP_118991766.1\|851659_852760_+\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP041071.1\|WP_098320812.1\|842910_843990_+\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	5.09187e-68
NZ_CP041071.1\|WP_029438731.1\|857458_860575_+\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	2.58353e-77
NZ_CP041071.1\|WP_118991765.1\|844765_848278_+\|DUF4020-domain-containing-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	4.05141e-56
NZ_CP041071.1\|WP_029438730.1\|866427_867102_-\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.39162e-74
NZ_CP041071.1\|WP_029438738.1\|844177_844615_-\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	4.48148e-45
NZ_CP041071.1\|WP_029438734.1\|852752_853853_+\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	4.35509e-159
NZ_CP041071.1\|WP_029438727.1\|869821_871093_+\|PTS-ascorbate-transporter-subunit-IIC	gnl\|CDD\|236502	PRK09410, ulaA, PTS system ascorbate-specific transporter subunit IIC; Reviewed.	0
NZ_CP041071.1\|WP_029438732.1\|855294_856452_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	4.50547e-73
NZ_CP041071.1\|WP_000633862.1\|862251_863877_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP041071.1\|WP_029438725.1\|871728_872556_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	4.88683e-85
NZ_CP041071.1\|WP_029438735.1\|850468_851641_+\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP041071.1\|WP_118991768.1\|864397_866371_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0

>NZ_CP041071.1|WP_001107307.1|856680_857247_+|TetR/AcrR-family-transcriptional-regulator
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKANVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIAKGFLRPLPPVALIIIVYQPLEKLTKVIATGQLEYSKELVKELEESSWNAIRII
>NZ_CP041071.1|WP_029438732.1|855294_856452_+|GNAT-family-N-acetyltransferase
MNVIRLKEDKFREALGLSEYAFQYKVEEERMQQQLTKMKESHEVYGIMEGEELAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVSFYRKYGWELCADLLVCHMTKSDLVMKKQVNGTVKRFNKEHHPEEVEKLYETFAERFSGMLVRNEKWWLQAVYDDLTLAIYYDENKTAAGYMLYKIENNKMIVEEFVPLHNEARNGLWNFICQHDSMIKELEMTVSKNEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVIVHITDSFAPWNNITVRLANHEITIVEETTEKGIKLDINALSAIMLGYKRPLELNELELISGSEEEIRAFENVVPVQKPFIYDFF
>NZ_CP041071.1|WP_029438733.1|853869_855159_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGKTTIKGFLPGADCLSTISCFKKMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDASIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLQNVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATEDGMIIYGKSVLKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>NZ_CP041071.1|WP_029438734.1|852752_853853_+|prephenate-dehydrogenase
MRKQVVLIGTGLIGGSLALAIKKEHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFRLRKDVIVTDVGSTKGTIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMNHVPNEHVKELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEGLYDTVSTGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAREEISITNLQILEAREGLLGVLRISFQREEDRTKAKLALGEEKYQTYETI
>NZ_CP041071.1|WP_118991766.1|851659_852760_+|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVQMEQVLCGSGLDEVIQIISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVPLNNGVYDLDEISSAVDNNTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFRETLPLLEKHKNILVLRTFSKAYGLASFRVGYAIGQEELIEKLNVVRLPFNVSSLAQKAATIAFCDDEFIEEVVRVNTEGLQQYESFCKENDIPFYPSQTNFIFLPVENAGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>NZ_CP041071.1|WP_029438735.1|850468_851641_+|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMDAIDHAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>NZ_CP041071.1|WP_029438736.1|849109_850186_+|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMDELKGFKNKLS
>NZ_CP041071.1|WP_118991765.1|844765_848278_+|DUF4020-domain-containing-protein
MTFLGKGESWVWITSEVEIPDELIDHLEQGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKSKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAIKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKISPLLWRTICSYLNETKMKMNPLLFARWTLLLVETAEKDSKSIETISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSIFSYVEQIWNEKMKPHISYYAVPIMMMGIEKMRMLSLRQTALKKRDKENAEKEFQQNDLAFLIQIVKECLAYLCENNEKKANYYITEMIEANSILQNRIAIDAMNKNIFVSADEKIKWLLQEGILLDVTYKQEVFQLIKNHYALSLEKTKEEVIQIVLKDLAEERAFDVCFVLDLLFNCDTNSPSTAKGYELMKQKHPHFHSDRYSVQKKEAAEQSITCNVTADGLLQLKDEEIMKQVRQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLGKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMLARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAREQQKFWAAWLSIFLRERPKMGEITAREYVMLLRIILFMDEIVERGLSIICKSFSDVGGKGNQTELKQLFNEILEKTESIKMYKDLYANVFFTLLQTLQEADLLETEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVMENLQEEM
>NZ_CP041071.1|WP_029438738.1|844177_844615_-|YndM-family-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSFLSAIVFTLSEVIVHRFSGSHTRHHNDNIRINRRFAYGTEFAEEQNILDKDKKK
>NZ_CP041071.1|WP_098320812.1|842910_843990_+|isochorismatase-family-protein
MLFQKDHVSVRYVVEEDAPTISKWLTDPKVLQYYEGRDNPQSLEMVLNHFIHNPNGHEKRCLIEFDDVPIGYIQMYPVDSEWKTLYDYEASQNVWGMDQFIGEPAYWEKGIGTKLVQAAITYIMENTGAKAIAMDPKVNNERAIKCYEKCGFKKVKILKEHELHEGVLEDCWMMEYKPRGLRDMKKALLVIDVQAGMYTAEMPVHNGEKFLEILQELIGECRSNDIPVIYVQHNGPKDHPLEKGTDGWKVHEAIAPLEGDCVVEKTTPDSFHKTNLKEVLQDKGIDHVIISGMQTQYCVDTTTRRAFSEGYKVTLVSDAHSTFDTEVLRAEDIVKHHNVVFGAFADVIPLKDLKVTASK
>NZ_CP041071.1|WP_029438731.1|857458_860575_+|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMDKGGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQFVSKDNTTILTQISIDKKHGEISKVTNNLHKKVQTKGVKTYLTGSDLVAGDFLKSSQEGVKKTEVISIIFILVVLIIVFRSPVVPIISLLTVGVSYLVSMGVIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVFVLLLVLTTLNPFFMVLLGKGMFYPVKNFKGHEDSRLWGFFAKNSVARPFVALIIVCVISIPFVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLHTLDELTDKILKVKGVSEVYSPTRPTGDRIKELYINKQAGELNTGLGDANGGIKEINDGLTTAKDKMGNKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAQGAQQIESGLTSVNENISVLSHATSQLHSGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQTKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMNNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQLLTGLKDLQEQMGQLQTGLSKSTEGLGKVSNGLNDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPIIQEINKTINGTLKGTELNNAKTAIGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLLLAYFASLGISEQISTHILHVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGDPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLTLIQVASVVGVALLLLAIIVMPILLPALIGLTSKMKNYAKKLSERK
>NZ_CP041071.1|WP_118991767.1|861013_861862_+|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAKLINEILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLLSRSGDFKEVLLKRVIKKGSNYLLPYRKMKNEFGDQFSDELFNTISKNDIYELPFDKNVELIADKWNDFAEIALEDNKVYIFECGFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLLYVEQDNLELSFRKALKERTPEWSTGFVDYYTNQGYGKEHNHSGVEGTIKVLEARRNLELEIFDMLKMNKEKINNTKYEIDSYRSMLKDKLTIQMVK
>NZ_CP041071.1|WP_000633862.1|862251_863877_+|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_CP041071.1|WP_118991768.1|864397_866371_+|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKHKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNYVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKKKVKTTPEGEAK
>NZ_CP041071.1|WP_029438730.1|866427_867102_-|TerC-family-protein
MDFLSADYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKNQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFMKWALIIIIIVGVVFFGKAKQKATDGSIS
>NZ_CP041071.1|WP_029438729.1|867408_869514_+|BglG-family-transcription-antiterminator
MILDTRSINILQQIIQAEDYVSINQLIDVIQVSKRTLYYDIKKIDDWLQEEGLHSIEYIRHLGYCLNKETKQMIVKKLNESMNNQYEYSPKERKIWLILYLLIQEKRILLEDLINLLQVSRNTVLADLKKLKVEFNKYNLSLHFYRKEGYQIVGNEQSKRNLLILSLSQIISQNGWGYLISQVNYIMSDMGSETDTLARETLYTIKKIFANCEEFLGVQYTDEVLENLSVYMYLFHRRILKGKCVEMEEAEKNVLKDSKQFEAAKYIAKQFERAFVVKFPIDEIYYITTHLLGAKVNYQENVYEKNNMDEIHSIVHCMIKDFQHYACVLFQDFKGLFTDLYLHMKPAFYRVKYGIEIENPLRNTIQENYEEVYFLTKKVIHHFEEYVRKSVSDDEIAYVTMHFGAWMRKEGIVPNPRKTALLVCPNGIGTSRMLQYQLEKLFSNIDILNAISKREYESNTFDVDCIITTTEIEKGNVPVLKVNPILSDSEKAALLRKVNGVLYGENHKDSVDLVMGIIQKYADVVDEKSLKRELIEFMSGPAYFEKEEKYKPMLNELLTREFIHLEDRVDNWKDAIRLAADPLLQNQYIFEEYINEMIVNVEKLGPYIVIAPKIAIPHARPEAGVKKLGMSLLQLKDSVLFSEKQEHAANLIIVLAAIDNETHLKALAQLSEMLSDSKNVEMLIHSNSIDEMLKTIAKYSN
>NZ_CP041071.1|WP_029438728.1|869527_869797_+|PTS-sugar-transporter-subunit-IIB
MKKILVVCGNGLGSSFIVEMNVKKILNELGLQAEVSHTDLASSKSEQADLYLGAKDIICNLEDGTRTVAGLTNILDLNEIKEALQKHLM
>NZ_CP041071.1|WP_029438727.1|869821_871093_+|PTS-ascorbate-transporter-subunit-IIC
MFDIIMKDILGQPAILVGLFAMCGLLLQKKNFADTVSGTLKTIMGFVVLGGGATILIGALDVFGKIFDKAFHIKGIIPNNEAVVAIAQQTLGKETALIMVFGMIANLLIARFTKFKYVFLTGHHTLFMACLISAVFSTTGMQGATLVIVGSIILGALMVIFPALLQPYVRKITGMDDIAIGHFGSVGYLAAGFVGSKFGNKDKSTEQIKVPKSLGFLRDTSVSMSLTMAVLFFIVAPFAGKEFIETELSNGQNYLVYSFMQAITFAAGVYIILAGVRMLIAEIVPAFKGIADKLVPNAKPALDCPTIFPFAPNAVIIGFLTSFIAGLLSMFILPFIGLSVIVPGLIPHFFTGATAAVFGNATGGRRGAILGAFVNGLLISFLPAILLPILGGLGFENTTFGDSDFAVVGILISEIVKLVGYIF
>NZ_CP041071.1|WP_029438726.1|871262_871688_+|hypothetical-protein
MIFQNEIVSLHVEALKYEFNNAFDTFDRNWLIIKVKLSEGNKVFETMDPFLQTSELQHMKEWFQTLPNPTYTRIDFIEPNLSFEFIGEKEEIFQIIVRLSIELNPSWCKEEEYEFCITITQEDRKNIIRLIEEQQIKFPKR
>NZ_CP041071.1|WP_029438725.1|871728_872556_-|polysaccharide-deacetylase
MHNGIRMTTLVKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDTEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWRYNKMPVDAASAKIVENVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041071_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041071_3

1977989-1978092

Orphan

Consensus_repeat	Method
CAAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP041071_3

>merge|NZ_CP041071|3|1977989-1978092|CRISPRCasFinder
CAAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGTCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NZ_CP041071|3|3|1977989-1978092|CRISPRCasFinder
CAAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGTCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTG
ACAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041071.1\|WP_029439277.1\|1988054_1989521_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP041071.1\|WP_033694723.1\|1979899_1980679_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029439295.1\|1967152_1967974_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133382
NZ_CP041071.1\|WP_029439288.1\|1975772_1976450_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP041071.1\|WP_029439278.1\|1986878_1987877_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP041071.1\|WP_029439294.1\|1968013_1968991_-\|peptidyl-arginine-deiminase	unknown	unknown	gnl\|CDD\|377332
NZ_CP041071.1\|WP_029439291.1\|1972191_1972422_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029439293.1\|1969369_1970527_-\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NZ_CP041071.1\|WP_118991658.1\|1972543_1973333_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP041071.1\|WP_029437794.1\|1982359_1983775_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP041071.1\|WP_098225145.1\|1973465_1974674_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP041071.1\|WP_029439287.1\|1976493_1977438_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NZ_CP041071.1\|WP_029439283.1\|1980696_1981680_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|274862
NZ_CP041071.1\|WP_029439282.1\|1981676_1981958_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029439289.1\|1974787_1975639_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP041071.1\|WP_029439279.1\|1986515_1986860_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP041071.1\|WP_029439280.1\|1984377_1985997_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP041071.1\|WP_029439285.1\|1979636_1979903_-\|DUF4176-domain-containing-protein	unknown	unknown	gnl\|CDD\|379364
NZ_CP041071.1\|WP_029439286.1\|1978727_1979381_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029439292.1\|1970805_1971933_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903

Protein	Function_ID	Function_description	E-value
NZ_CP041071.1\|WP_029439277.1\|1988054_1989521_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP041071.1\|WP_029437794.1\|1982359_1983775_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	5.195e-60
NZ_CP041071.1\|WP_029439295.1\|1967152_1967974_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	6.48115e-31
NZ_CP041071.1\|WP_029439288.1\|1975772_1976450_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	7.47367e-20
NZ_CP041071.1\|WP_029439278.1\|1986878_1987877_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	9.94823e-150
NZ_CP041071.1\|WP_029439294.1\|1968013_1968991_-\|peptidyl-arginine-deiminase	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	6.92063e-16
NZ_CP041071.1\|WP_029439293.1\|1969369_1970527_-\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	1.3149e-114
NZ_CP041071.1\|WP_118991658.1\|1972543_1973333_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	1.69431e-21
NZ_CP041071.1\|WP_098225145.1\|1973465_1974674_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.17437e-97
NZ_CP041071.1\|WP_029439287.1\|1976493_1977438_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	2.82804e-148
NZ_CP041071.1\|WP_029439289.1\|1974787_1975639_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.89395e-91
NZ_CP041071.1\|WP_029439279.1\|1986515_1986860_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.4805e-14
NZ_CP041071.1\|WP_029439280.1\|1984377_1985997_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	1.08474e-107
NZ_CP041071.1\|WP_029439285.1\|1979636_1979903_-\|DUF4176-domain-containing-protein	gnl\|CDD\|379364	pfam13780, DUF4176, Domain of unknown function (DUF4176).	1.77547e-34
NZ_CP041071.1\|WP_029439283.1\|1980696_1981680_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	1.21808e-16
NZ_CP041071.1\|WP_029439292.1\|1970805_1971933_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.2906e-59

>NZ_CP041071.1|WP_029439287.1|1976493_1977438_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGQHEWNTNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLKKYNLVGQNMSSSRVMIQSFSKDSLTKIHSMNKNIPLVQLLWYYPNENNEIVEWSGITHEPKSVTNEDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARNNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHSVLKEK
>NZ_CP041071.1|WP_029439288.1|1975772_1976450_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEIAFLKEITPQKCDVIFVFGGSHPGNWQAPLEAYRQGLGNQIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMEHGVPKGAIMFETNSLHSIANVMEAKKIFDFTKVNRLLFVCKSLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNICYGRKGGIEPPENEVEGLEEYVSYYYNLA
>NZ_CP041071.1|WP_029439289.1|1974787_1975639_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVTKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIDLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTAYYEKYPKVDLILETNTTEQLIKLVLERKLDGAFIAGSTQHTELHTNVFHEEELVLISKKTLSSLKDIEGMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSNMGVAIMMKSILKEHEHDVSFNPLPNSFKKVPTTFITRKDIFRSAALQKFMEMTHNA
>NZ_CP041071.1|WP_098225145.1|1973465_1974674_-|MFS-transporter
MEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNTESGLLVSVVNIGPLFCMLFVGRLLDQYNEKILISISSLLLGGSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTIQYNVTYAINSIACICIIGGLLFFMFYKEPYVQEEARKGHIKISFWTELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLVREQSITSIVAGTVFSVMFFSGMIGRVVLAAISDVFYKGNRRIPLFIAVCASIGLVLLLVMSIHTITSGVLYGVSALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAITIAPVLFGYVVDEKGYTYAWLCIVVLLSISAVSLSRNLPDSK
>NZ_CP041071.1|WP_118991658.1|1972543_1973333_+|IS5-family-transposase
MIHNYTSNITREQFELIREDLENARKKTRPRTVDLYEVFCGVLYLLTTGCQWRNLPSDFPHWKTVYAYYQIWRKVDENGISLLEKCIKKLVETYREQDGRKNQTSFCIVDAQSVKNTWIAGEKGYDAGKKVSGIKRHIAVDTNGLIHAIDVTTANITDREGAIQMCERHKKTLEKVTNILCDGGYTGPSFAQSIKETIDCSVEIIKRSELHKFVVLPKRWIVERTFAWLENYRRLWKNCERTLENSRQSCLLASVAILLKRF
>NZ_CP041071.1|WP_029439291.1|1972191_1972422_+|hypothetical-protein
MKNTDKRNRLNDRTFHYRVTKNNIVLIEYYGKQIIILKGNDAKKFLYKINHAHNDTEKQLIMAKVTGNFKRGNERN
>NZ_CP041071.1|WP_029439292.1|1970805_1971933_-|serine-hydrolase
MLKKWLIVFFIFAIFCGSVVALIHANKGKKYDIKAFSNVNSKQKDDMQEVNATEKKRYEAVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANAKDKVVTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGQGRVDAGSRLKLVTWIGAQKLQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPAGMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMDGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKKTFVILFSNVQNGMNDAFNQEFRKMANDLIEGK
>NZ_CP041071.1|WP_029439293.1|1969369_1970527_-|agmatine-deiminase-family-protein
MKKIVKFCLMAILSTTIISGCSFEGNNENATGKESEKVEVQKKVGKYTMPDEKDKHEGTWLQWPHEYTYGEEYQREVEPIWVKMASTLTEGEKVHIVAYDEEEKERINKLLIDKGLNMDKIDFFIAPTDDVWARDSGPIFVYDNNKNLKILDPAFNGWGKKTPYKNDARIRENVSKQAGIERIDWGNFVLEGGAIELDSNGTALLTRSAVTNKNRNPNLSEKEIEKYISDLGVSNFIWLDGVPNLDITDFHIDGFAKFHGKSTIVTMKEDDLAEWGLSNKDMDTLLDAKNASGQKYKYEYLPLSKGKVTLENGKALDYKGSYINYYIGNTVVLVPNYNDPNDKIANDTIQKLYPDRKVVGIDVRELYKNGGMIHCVTQQQPIALK
>NZ_CP041071.1|WP_029439294.1|1968013_1968991_-|peptidyl-arginine-deiminase
MEQKQNGIIFTAIPDKSNEYYRPFYEDLIYFNEYLNENKSFTDQLVSLSVEEQDFHTSFFEYDDIWLRDVAPVVINHLVKFKYQPNYLPKDQWRYLDQQFNKWLKKNDFEYVKSPLILDGGNLIWNKKDTVIVTEHIFDDNYDWTEEEIIEQLEWDLDVSRVIIIPAEEGDVLAHADGMVKFIDEHTMFISDFLGDHEFRYNVQEIIQEQMPEAEFIVVPSSYTEKGQYDREIASAKGLYINMLETCDTIYVPKFGLAKDREVLRYIQQHTEKQAIQIHVGEISTMGGAINCLTWYCPHHLLPSKMKRLNNQNEDFSVRKIFDWF
>NZ_CP041071.1|WP_029439295.1|1967152_1967974_-|MerR-family-transcriptional-regulator
MYTITEFSRICKISTRMLRHYDKEDILKPAYVNPENGYRYYELGQLEIALKIKKLREYKFPLPKIKIILQSSDQDSFVKHMQAQIIELSHEVKQNLQVISEMNEMVNVNNGLHIARHRSYDILIGMRNEITVITQRLQMNIDDMDDYFYDLYEKVQKHNFQIVGSPSTVFYDEEYIPNESDIELRIPILHENDKDVVQECEIKKLNPHQIVTTMHYGSYDYIGYAYIALEKWIERNSYVIVGSPYEVYIKGPECDCLVEEYVTQICLLVMKID
>NZ_CP041071.1|WP_029439286.1|1978727_1979381_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPDSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLTANIWGVWVFFYKPNEPRLVHILYNGFMGITFSFGSFIVIQKIAYTFIKIETPLFFIVTFVLYILTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAIVLSISGVYIWIYVDLKRKEMDGMHNGQI
>NZ_CP041071.1|WP_029439285.1|1979636_1979903_-|DUF4176-domain-containing-protein
MNSQLFPIGSIVILKEGTKKLMIFGRKQQVATDEVRKFDYMGCPYPEGYINPDFTYLFNHDDIQEVVSTGYEDQEERTFQENVLSKIQ
>NZ_CP041071.1|WP_033694723.1|1979899_1980679_-|hypothetical-protein
MDKYNGNSIDDCMRILIPFDIRNIVGAFVWVIMNFMLLIILFIFPPFNIYSYVALPFYVICNLWGILVSIYKPRQPQLQHLLYSGFVALSISFCSFIAVQKLAYEFVEIESPLFFILSLIAYSLIVYKSELFWIKYFTARLRGITDQDVKIPKIVYFSGLGYMIGQVSIGILSQKAMAIVLIVIFSFISVVFLALSTHLYFYFDFKKQGITSRHLKELYFQKKPKLSRKERRQSTAASGHVNIPHSQKKTKLTRKEKRQ
>NZ_CP041071.1|WP_029439283.1|1980696_1981680_-|WXG100-family-type-VII-secretion-target
MSGEIKVTPAHLRKLASNIEQTAHELSETYQRINQQLFDLPFQISGRDAVLNQSQYAGSMLATITTVLKEHSDALRKAADRFEKADQQEVLFGEEAIDVNWFAPLGGDIGDWKENPTGSLFTLLGTVTEGAAAYKLAALHNKGLRVTPFTNEKGKEMVRFQNRTVLKDKNGLNVIRRTKLPLAEVKQIDDVKRYVLSPKEILKDSLKLKTNVLGYAAVGWDVINDTKENIENKASKTKIAGDIIGDAAIGIGSTAASALTGAAIGTVIGGPIGTVVGAGIGFGVSIGISWLTDGIKFNKGDWNHDGKQDSVKDRVKSGIGNVLDKIF
>NZ_CP041071.1|WP_029439282.1|1981676_1981958_-|hypothetical-protein
MTLYLDDEASSELANIIHNREELNTVQVHYYIKDSWSTDCIQFLYSQNQYWLIQKVLDNEQTQTNFICLDTFTLTEEIKKMVLYLKSLGGETR
>NZ_CP041071.1|WP_029437794.1|1982359_1983775_+|IS66-family-transposase
MIEQKIILDAYQKGPEAVVSLFEETFHKLEMRIQELENRSKKTSKNSHKPPSTDGFRKPATTSLRKPSHRQTGGQLGHKGHTLRFTETPDHIVRHSLTTCSHCQTSLEQEPTVGYRIRQVYDLPPIQLEVTQHEVEQKECPHCHSFQESTFPTTVSQPVQYGPRVKAFVPYLTQYQCLSYKRTRELFQDCFEHTISEGTLINHNRAFSQQLDPFIQEAKQQILQSPVGHFDETGMRVEKKTQWLHTASTPEVTIQYVHEKRGKDAMDAGEILPSFSGIAVHDGWKSYDAYTDCRHVLCNAHLLRDLQGILDSTKQKWAQEMKSLLQQALELKKHQNGNVSDMEKQRIASTYQAILKKGQDIQPSITLVPGQKVKHTPAQNLLNRFIKYQDRILAFLDGPHIPFDNNQAERDIRMTKVKQKVSGTFRSQSGADVFSRTRSFISTMKKQKQSVLQAMRQVLETGTVPWAQNIQ
>NZ_CP041071.1|WP_029439280.1|1984377_1985997_-|FAD-dependent-monooxygenase
MKSNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGLTFRTMELFRELGLEQRIKLAGKALENCRGRIVVHTIAEANKEELEQMRATQYGNDEELLQKIEKISPSKQTACYQIILEEMMLQEAKTLGGQLSFYHELVSFEQNENGVKATIRNRETEKESVIHCDYLIAADGAKSKIREQLGISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQILQTAIGSTNVESEIVSVLPWEATESTATKFQDNRVFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLGAVIKGKAKPKLLETYHEERYHVAKLTTAYASSLLFRAANREEGSLNNMDGLAVTVGYQYCSEAILDESATPHRMDIVDLNGRPGTRAPHFWGMYKGKEVSILDLFGNNFVLLTGVDNSSWAEAVYDVSSNLGINIKVYRVGLSGDFIAQENVFCELYGIENEGVVLIRPDGFIGWRSEKAVVNPDVMLEEVMSNLVCDF
>NZ_CP041071.1|WP_029439279.1|1986515_1986860_+|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNIIKRDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>NZ_CP041071.1|WP_029439278.1|1986878_1987877_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPTPEINEYEVLAEIYAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVITKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKGQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGANLVKSLGADEIINYKTEKFEDILKDYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTALEKKHNARYSFLFMKPSGDQLRTIANYIEAGKIKPIIDRVFSFEDAQKAMEYSEAGRAKGKIIVKIK
>NZ_CP041071.1|WP_029439277.1|1988054_1989521_+|YdiU-family-protein
MTKNNEAGWNLDNSYATLPQSFYTDIPPTPVSSPELVKLNHSLAISLGFNPEELKKEVEIAIFAGNALPEGSHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYEKQWFIGMKKKLGLFSNEEQDHSLIEQLLKMMEKYKADYTNTFRSLTLDTLENIPLFDSPEFKEWYKLWQSRLERQEELKENAYEMMKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNRPYRTFCGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041071_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041071_4

5315118-5315352

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP041071_4

>merge|NZ_CP041071|4|5315118-5315352|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTAGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAATAAGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTTCGTTTTTGATCCTTCTGCATGAGAAAAAGACCCTTTTGCATGTGTCAGAAGCCCTTCTGCATGTGAA

>NZ_CP041071|4|4|5315118-5315352|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTAGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA	TAAGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTT
CGTTTTTGATCCTTCTGCATGAGAA	AAAGACCCTTTTGCATG
TGTCAGAAGCCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041071.1\|WP_002051510.1\|5309059_5309233_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029437851.1\|5315999_5316740_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP041071.1\|WP_029437844.1\|5305818_5307063_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP041071.1\|WP_029437854.1\|5319063_5319822_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP041071.1\|WP_029437859.1\|5323925_5324612_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP041071.1\|WP_029437852.1\|5316814_5317975_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP041071.1\|WP_029437845.1\|5307113_5308940_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP041071.1\|WP_000654997.1\|5324624_5325305_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP041071.1\|WP_029437858.1\|5323239_5323929_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|372616
NZ_CP041071.1\|WP_029437857.1\|5321987_5323088_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP041071.1\|WP_000043380.1\|5310355_5310754_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP041071.1\|WP_000360642.1\|5309462_5310356_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP041071.1\|WP_029437853.1\|5318121_5319057_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|366154
NZ_CP041071.1\|WP_029437847.1\|5311655_5312027_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041071.1\|WP_029437848.1\|5312714_5313512_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP041071.1\|WP_029437846.1\|5310932_5311511_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP041071.1\|WP_001081480.1\|5312057_5312696_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP041071.1\|WP_029437849.1\|5313527_5314421_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP041071.1\|WP_029437855.1\|5319966_5320812_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP041071.1\|WP_118991709.1\|5320934_5321822_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999

Protein	Function_ID	Function_description	E-value
NZ_CP041071.1\|WP_029437853.1\|5318121_5319057_-\|glycosyltransferase	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.11645e-21
NZ_CP041071.1\|WP_029437851.1\|5315999_5316740_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP041071.1\|WP_029437844.1\|5305818_5307063_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	1.29756e-57
NZ_CP041071.1\|WP_029437854.1\|5319063_5319822_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.68135e-20
NZ_CP041071.1\|WP_000654997.1\|5324624_5325305_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NZ_CP041071.1\|WP_029437852.1\|5316814_5317975_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	4.52911e-100
NZ_CP041071.1\|WP_029437845.1\|5307113_5308940_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP041071.1\|WP_029437858.1\|5323239_5323929_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.0744e-18
NZ_CP041071.1\|WP_029437857.1\|5321987_5323088_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	6.42399e-53
NZ_CP041071.1\|WP_000043380.1\|5310355_5310754_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.69795e-69
NZ_CP041071.1\|WP_000360642.1\|5309462_5310356_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	7.3476e-93
NZ_CP041071.1\|WP_029437859.1\|5323925_5324612_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	2.9221e-110
NZ_CP041071.1\|WP_029437848.1\|5312714_5313512_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP041071.1\|WP_029437846.1\|5310932_5311511_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	4.75723e-85
NZ_CP041071.1\|WP_001081480.1\|5312057_5312696_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.30935e-95
NZ_CP041071.1\|WP_029437849.1\|5313527_5314421_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.82466e-99
NZ_CP041071.1\|WP_029437855.1\|5319966_5320812_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	9.50581e-150
NZ_CP041071.1\|WP_118991709.1\|5320934_5321822_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	8.54033e-18

>NZ_CP041071.1|WP_029437849.1|5313527_5314421_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAAEGTLVREFLKTKGISKAALTDIKFQGGAIEVNGQYASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIIYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKQHLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVLLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTTIPNDMQAVVRHT
>NZ_CP041071.1|WP_029437848.1|5312714_5313512_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYNRLAETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP041071.1|WP_001081480.1|5312057_5312696_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEKKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP041071.1|WP_029437847.1|5311655_5312027_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDMVMFVRVNDIEIELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP041071.1|WP_029437846.1|5310932_5311511_-|CYTH-domain-containing-protein
MTQEIEIEFKNMVTEEEFNTLCKSFSIEAFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAKVGLLETHQVVTENEARMMMETNVIISGAVMDQLRKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLTQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP041071.1|WP_000043380.1|5310355_5310754_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP041071.1|WP_000360642.1|5309462_5310356_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP041071.1|WP_002051510.1|5309059_5309233_-|hypothetical-protein
MKKTYILLIILAVIVSFFLYILSLLQAFPKIIAFPLLFGVIVIALSYFNHKKRFKGF
>NZ_CP041071.1|WP_029437845.1|5307113_5308940_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDAEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHMIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALIIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP041071.1|WP_029437844.1|5305818_5307063_+|competence-protein
MIPMFIAKRENGEKIYLLDHYNEELLHRMRKRESFFCTACGKEVQMRLGKQKKWHFAHKKVDSCLAFYEAESIYHMHGKELLYRWLKRQNFHVEIEHYLPEIQQRPDIFIERAGRQIAIEYQCANLSIEQLYKRTHSYWRAGIQVVWIIGGNQLKKQSAYWMKFSSLMAFSLQSYPQPLLIFFCSKQKSFMKCTFLTSFSTSVSFSHIIYLPTNTTTFEMLFSPVPFQKKILAREWKKRKDYFRKNALPIWNYNHKSLLRLLYQCKCTPANFPSEIGVPLQSSFAFRTNPFIWQAFIYMKCIGELAVGDCISLEYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYVGVLQKVGTYKYRKKRRIVMLKTEEEVMKYDEVCLAYALSLFEAKYNMGEGKGDIIKTDREGIT
>NZ_CP041071.1|WP_029437851.1|5315999_5316740_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCFHEFQDLTKKLGYSWNSDLPIHPDRRKLAFVGDITDRGPHSLRMIEIVWELVINKKIAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYETLPSHKQNMIKEKFITLYEHSPFYHVLDEKRLIVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP041071.1|WP_029437852.1|5316814_5317975_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLIILFAIGIVSCCAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGMIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFAVGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP041071.1|WP_029437853.1|5318121_5319057_-|glycosyltransferase
MNNIKNPPLVSILIPTYNRPHYFKIALESALAQTYPNIEIIIGDDSTNDEIEILMQTDYLPNHKHITYIRNATTLGQFNNSLMLLKQSHGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMKRLYDKDTLLNGTDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLNSKKYGFLQEIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHIRLSHCLNIVTKELRAI
>NZ_CP041071.1|WP_029437854.1|5319063_5319822_-|class-I-SAM-dependent-methyltransferase
MNENEKKTTLIPPPELVQYVGGDFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYLSEISRVLKKNGRCFITFFLINPESSYYLNAGLSTLGFYHQIDNCYVLNKEIPNFAVAYPEEDIRNLLNKYGLELQTPPHYGSWCSRTEHTSYQDIILTQKISER
>NZ_CP041071.1|WP_029437855.1|5319966_5320812_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSTGGFIIIDDYGLITCAEAVTDFRSERNIKAPMTQIDDFGIYWRKE
>NZ_CP041071.1|WP_118991709.1|5320934_5321822_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTRPTGPTGPTGSTGTTGTTGPTGPTGSTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGDTGATGPTGATGPTGPTGPTGPTGPSGLGLPAGLYAFNSAGISLDLGLNAPVPFNTVGSQFGTAISQLDPDTFVISETGFYKITVIVYTAALSVLGGLTIQVNGVSVPGTGATLISVGAPIVVQAITQITTTPSLVEVIVTGLGLSLALGTNASIIIEKIA
>NZ_CP041071.1|WP_029437857.1|5321987_5323088_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANESMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATELPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKSL
>NZ_CP041071.1|WP_029437858.1|5323239_5323929_+|methyltransferase-domain-containing-protein
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDYKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP041071.1|WP_029437859.1|5323925_5324612_+|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDRKMYAQCVRHILSLAVPPGYTVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSGVNQDE
>NZ_CP041071.1|WP_000654997.1|5324624_5325305_+|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP041071_3	3.1\|1978015\|52\|NZ_CP041071\|CRISPRCasFinder	1978015-1978066	52	NZ_CP041071.1	1979949-1980000	1	0.981

1. spacer 3.1|1978015|52|NZ_CP041071|CRISPRCasFinder matches to position: 1979949-1980000, mismatch: 1, identity: 0.981

ggtatatttacatgtcccgaagtagccgtggattgtctcctttccttccttg	CRISPR spacer
ggtatatttacatgtcccgaagcagccgtggattgtctcctttccttccttg	Protospacer
**********************.*****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

396830 : 431037

Staphylococcus_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_118991659.1\|396830_397619_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_050587967.1\|398080_398278_-	hypothetical protein	NA	NA	NA	NA
WP_001072990.1\|399232_399556_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029440919.1\|399678_400212_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_029440920.1\|400346_401849_+	acyl--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	5.2e-35	25.0
WP_029440921.1\|402014_402560_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	2.1e-10	31.8
WP_029440922.1\|402705_403269_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029440923.1\|403265_403970_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_029440924.1\|403966_404743_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029440925.1\|404754_405654_+	PhzF family phenazine biosynthesis isomerase	NA	NA	NA	NA
WP_000801653.1\|405686_405896_-	hypothetical protein	NA	NA	NA	NA
WP_050587969.1\|406071_406875_+	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_029440926.1\|406938_407496_+	hypothetical protein	NA	NA	NA	NA
WP_118991735.1\|407521_408349_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_029440928.1\|408365_408932_+	SGNH/GDSL hydrolase family protein	A0A0N9RRL9	Staphylococcus_phage	3.6e-05	27.0
WP_029440929.1\|408976_409393_-	SRPBCC family protein	NA	NA	NA	NA
WP_000040533.1\|409473_410484_-	aldo/keto reductase	NA	NA	NA	NA
WP_029440930.1\|410886_411231_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029440931.1\|411423_411750_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029440932.1\|412059_413250_+	cyclopropane-fatty-acyl-phospholipid synthase	A0A2K9L0U7	Tupanvirus	5.9e-50	40.2
WP_029440933.1\|413466_414528_+	oxidoreductase	NA	NA	NA	NA
WP_029440934.1\|414560_415298_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_029440935.1\|415364_415706_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029440936.1\|416288_416684_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_029440937.1\|416731_416866_+	BA3454 family stress response protein	NA	NA	NA	NA
WP_000573529.1\|416975_417110_+	BA3454 family stress response protein	NA	NA	NA	NA
WP_029440938.1\|417273_417687_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_000987469.1\|417814_418150_+	IDEAL domain-containing protein	NA	NA	NA	NA
WP_118991658.1\|418419_419209_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029440585.1\|419284_420478_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8
WP_118991736.1\|420773_421475_+	hypothetical protein	NA	NA	NA	NA
WP_118991659.1\|421579_422368_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029440442.1\|422631_422844_+	hypothetical protein	NA	NA	NA	NA
WP_118991861.1\|423337_424654_-	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_118991737.1\|424932_426021_-	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	4.6e-09	22.2
WP_118991862.1\|426223_427516_-	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_118991738.1\|427717_427990_+	hypothetical protein	NA	NA	NA	NA
WP_029437250.1\|428155_429274_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_118991739.1\|429624_431037_+\|transposase	IS66 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

987879 : 997108

Geobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029438617.1\|987879_988686_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	4.7e-107	68.5
WP_029438616.1\|988750_988963_-	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	9.6e-12	52.9
WP_029438615.1\|988965_990351_-	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.7e-78	59.5
WP_029438614.1\|990797_991202_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029438613.1\|991217_991571_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_029438612.1\|991592_992300_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.1e-16	27.0
WP_029438611.1\|992365_992752_+	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_118991771.1\|992773_993277_+	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	3.6e-41	45.5
WP_029438610.1\|993423_994104_+	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	7.8e-31	38.7
WP_029438609.1\|994189_995383_+	glycosyl transferase family 1	B0LUM8	Spodoptera_litura_multicapsid_nucleopolyhedrovirus	9.9e-13	27.2
WP_029438608.1\|995740_997108_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.8e-19	37.5

DBSCAN-SWA_3

1089871 : 1156822

Bacillus_phage(20.0%)

transposase,bacteriocin,integrase

attL 1101675:1101734|attR 1155530:1157109

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029438525.1\|1089871_1090099_-\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_029438524.1\|1090298_1090745_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_029438523.1\|1090770_1091109_-	divalent cation tolerance protein CutA	A0A1S5V250	Saudi_moumouvirus	3.3e-14	34.0
WP_029438522.1\|1091139_1091598_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029438521.1\|1091707_1092619_-	EamA family transporter	NA	NA	NA	NA
WP_029438520.1\|1092769_1094203_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_118991778.1\|1094247_1094778_-	DUF4269 domain-containing protein	NA	NA	NA	NA
WP_061687732.1\|1094950_1095412_+	hypothetical protein	NA	NA	NA	NA
WP_029438518.1\|1095701_1096574_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	2.4e-32	38.3
WP_029438517.1\|1096619_1097420_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_118991779.1\|1097903_1098620_+	hypothetical protein	NA	NA	NA	NA
WP_118991780.1\|1100066_1101290_-	MerR family transcriptional regulator	NA	NA	NA	NA
1101675:1101734	attL	NA	NA	NA	NA
WP_029437265.1\|1101773_1102967_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_029438516.1\|1103301_1103874_+	thiamine biosynthesis protein ThiJ	NA	NA	NA	NA
WP_029438515.1\|1103998_1104805_-	DegV family protein	NA	NA	NA	NA
WP_029438514.1\|1105004_1105511_-	DUF3189 family protein	NA	NA	NA	NA
WP_029438513.1\|1105765_1106359_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_061685883.1\|1106363_1107386_-	serine hydrolase	G1BSP8	Mycobacterium_virus	2.1e-11	21.9
WP_029438512.1\|1107484_1108723_-	MFS transporter	NA	NA	NA	NA
WP_029438511.1\|1109221_1111360_-	PASTA domain-containing protein	NA	NA	NA	NA
WP_061687737.1\|1111730_1112330_-	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_029438510.1\|1112576_1113566_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_118991781.1\|1113672_1115091_-	HAMP domain-containing histidine kinase	A0A1V0SKH0	Klosneuvirus	5.7e-07	22.7
WP_029438509.1\|1115087_1115762_-	response regulator transcription factor	NA	NA	NA	NA
WP_029438508.1\|1115774_1116305_-	hypothetical protein	NA	NA	NA	NA
WP_118991782.1\|1116409_1116919_-	GrpB family protein	NA	NA	NA	NA
WP_118991783.1\|1117046_1117928_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_029438506.1\|1118016_1119285_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	3.3e-14	24.7
WP_000120182.1\|1119377_1119485_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_118991784.1\|1119620_1120421_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_029438505.1\|1120413_1122114_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	2.6e-14	30.4
WP_029438503.1\|1123035_1123527_-	hypothetical protein	NA	NA	NA	NA
WP_167506398.1\|1123596_1124115_-	acetylglutamate kinase	NA	NA	NA	NA
WP_029438501.1\|1124896_1125496_-	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_029438500.1\|1126165_1126759_+	hypothetical protein	NA	NA	NA	NA
WP_029438499.1\|1126751_1127063_+	HNH endonuclease	NA	NA	NA	NA
WP_029438498.1\|1127658_1128018_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029438497.1\|1128303_1129479_-	myo-inositol-1-phosphate synthase	NA	NA	NA	NA
WP_029438496.1\|1129483_1130806_-	alkaline phosphatase family protein	NA	NA	NA	NA
WP_029438495.1\|1130838_1131717_-	UbiA-like protein EboC	NA	NA	NA	NA
WP_029438494.1\|1131713_1132544_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_029438493.1\|1132558_1133356_-	hydrolase TatD	NA	NA	NA	NA
WP_029438492.1\|1133369_1134221_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_033694628.1\|1134287_1134824_-	hypothetical protein	NA	NA	NA	NA
WP_029438490.1\|1135150_1136572_-	glucose dehydrogenase	NA	NA	NA	NA
WP_118991658.1\|1137465_1138254_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029438489.1\|1140051_1140498_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029438488.1\|1140854_1142432_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_029438487.1\|1142825_1143677_+	DUF2935 domain-containing protein	A0A167RKB4	Powai_lake_megavirus	3.4e-07	25.1
WP_118991785.1\|1145186_1145549_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_029438484.1\|1146433_1147600_+	serine hydrolase	G1DB24	Mycobacterium_phage	1.1e-21	27.1
WP_033694627.1\|1147896_1148286_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_029438482.1\|1148902_1149796_-	cation transporter	NA	NA	NA	NA
WP_029438481.1\|1150374_1150941_-	hypothetical protein	NA	NA	NA	NA
WP_118991787.1\|1150919_1152785_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_033694554.1\|1152768_1155138_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_029437265.1\|1155628_1156822_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
1155530:1157109	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1376852 : 1400028

Bacillus_phage(84.21%)

transposase,plate,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029437265.1\|1376852_1378046_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_029438311.1\|1378342_1379125_+	arginase	NA	NA	NA	NA
WP_029438309.1\|1379799_1381263_-	recombinase family protein	Q2XVV3	Bacillus_phage	1.3e-142	54.3
WP_029438308.1\|1381606_1381834_-	hypothetical protein	NA	NA	NA	NA
WP_118991798.1\|1382115_1382739_-	hypothetical protein	H0USY2	Bacillus_phage	1.4e-95	79.6
WP_029438306.1\|1382680_1383871_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	9.8e-146	64.9
WP_029438305.1\|1383986_1384169_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.5e-21	88.3
WP_029438304.1\|1384165_1384468_-	hypothetical protein	A0A288WG38	Bacillus_phage	3.4e-26	54.1
WP_029438303.1\|1384467_1384734_-	hypothetical protein	NA	NA	NA	NA
WP_000669091.1\|1384919_1385120_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	2.4e-12	53.0
WP_118991799.1\|1385765_1385888_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	2.4e-07	59.5
WP_029438302.1\|1385875_1386226_-	hypothetical protein	NA	NA	NA	NA
WP_033694537.1\|1386405_1386645_+	helix-turn-helix transcriptional regulator	A0A288WFZ7	Bacillus_phage	2.0e-21	67.1
WP_029438300.1\|1386721_1387054_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	7.0e-17	43.5
WP_029438299.1\|1387075_1387357_+	hypothetical protein	NA	NA	NA	NA
WP_029438298.1\|1387423_1388179_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	8.5e-103	75.3
WP_029438297.1\|1388195_1388426_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	2.2e-25	75.0
WP_029438296.1\|1388440_1388725_-	hypothetical protein	NA	NA	NA	NA
WP_162901159.1\|1388761_1388908_-	hypothetical protein	A0A2H4JFI6	uncultured_Caudovirales_phage	8.3e-15	81.2
WP_029438295.1\|1388925_1389483_-	hypothetical protein	D2XPZ8	Bacillus_virus	8.3e-71	70.1
WP_118991800.1\|1389497_1390907_-\|plate	BppU family phage baseplate upper protein	A0A1B1P836	Bacillus_phage	8.9e-45	34.7
WP_118991658.1\|1390864_1391654_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029438291.1\|1391692_1391926_-	hypothetical protein	NA	NA	NA	NA
WP_033694535.1\|1391948_1392206_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	1.2e-32	76.5
WP_029438290.1\|1392232_1394611_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	1.9e-180	35.1
WP_029438289.1\|1394607_1396119_-\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	1.1e-160	58.0
WP_118991870.1\|1396131_1400028_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	3.9e-42	41.3

DBSCAN-SWA_5

1405148 : 1420137

Bacillus_phage(41.67%)

transposase,portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029438278.1\|1405148_1405931_-	scaffolding protein	Q4ZC70	Staphylococcus_virus	7.4e-09	40.9
WP_029438277.1\|1405989_1407507_-\|portal	phage portal protein	A0A142F1L7	Bacillus_phage	4.0e-67	30.0
WP_029438276.1\|1407523_1409239_-\|terminase	phage terminase large subunit	A0A142F1L6	Bacillus_phage	1.3e-154	53.9
WP_001086031.1\|1409255_1409684_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.5e-32	51.1
WP_029438273.1\|1409878_1410442_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.3e-34	46.0
WP_029438272.1\|1410841_1411231_-	hypothetical protein	NA	NA	NA	NA
WP_029438271.1\|1411489_1411816_-	hypothetical protein	NA	NA	NA	NA
WP_029438270.1\|1411963_1412143_-	hypothetical protein	A0A1B1P7M4	Bacillus_phage	3.3e-13	64.0
WP_029438269.1\|1412139_1412667_-	hypothetical protein	NA	NA	NA	NA
WP_033694534.1\|1412644_1413103_-	hypothetical protein	NA	NA	NA	NA
WP_029438267.1\|1413105_1413303_-	hypothetical protein	NA	NA	NA	NA
WP_029438266.1\|1413299_1413497_-	hypothetical protein	A0A1L2JY50	Aeribacillus_phage	8.6e-07	49.1
WP_029438265.1\|1413501_1413780_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	5.1e-13	59.0
WP_029438264.1\|1413804_1413999_-	hypothetical protein	NA	NA	NA	NA
WP_033694533.1\|1414117_1414264_-	BC1881 family protein	NA	NA	NA	NA
WP_029438263.1\|1414266_1415244_-	hypothetical protein	NA	NA	NA	NA
WP_029438262.1\|1415260_1415578_-	transglycosylase	NA	NA	NA	NA
WP_050587870.1\|1415593_1416241_-	hypothetical protein	NA	NA	NA	NA
WP_029438260.1\|1416237_1416648_-	hypothetical protein	S5MUC4	Brevibacillus_phage	1.3e-12	59.3
WP_118991801.1\|1416690_1418232_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	4.3e-117	38.4
WP_029438259.1\|1418262_1418460_-	hypothetical protein	A0A1B1P7W9	Bacillus_phage	1.9e-22	76.9
WP_029440585.1\|1418943_1420137_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8

DBSCAN-SWA_6

1688581 : 1695960

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_118991811.1\|1688581_1690477_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	5.4e-45	25.4
WP_098224425.1\|1690473_1691121_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	2.3e-11	31.2
WP_029439504.1\|1691230_1691992_+	hypothetical protein	NA	NA	NA	NA
WP_087986843.1\|1692795_1693182_+	hypothetical protein	A0A1C8E993	Bacillus_phage	2.5e-42	65.6
WP_029439502.1\|1693216_1694020_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	3.8e-85	78.0
WP_080449872.1\|1694444_1694855_-	hypothetical protein	D2XR44	Bacillus_phage	3.7e-52	88.8
WP_000427791.1\|1695684_1695960_-	stage V sporulation protein SpoVS	A0A1J0GVV0	Streptomyces_phage	8.4e-08	43.4

DBSCAN-SWA_7

1865058 : 1874377

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029439370.1\|1865058_1865931_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.1e-66	45.1
WP_029439369.1\|1866064_1866736_-	O-methyltransferase	W8CYT3	Bacillus_phage	3.7e-65	92.7
WP_000818985.1\|1866883_1867603_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_029439368.1\|1867798_1868386_+	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_029439367.1\|1868409_1869483_-	sensor histidine kinase	W8CYF6	Bacillus_phage	2.0e-174	89.9
WP_118991871.1\|1869479_1870166_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.7e-119	94.3
WP_000453899.1\|1870245_1872006_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-270	96.9
WP_001194292.1\|1872246_1873011_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_029439365.1\|1873108_1874377_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	7.6e-11	32.0

DBSCAN-SWA_8

2059253 : 2130103

Bacillus_phage(86.96%)

plate,capsid,portal,holin,terminase,integrase,protease,transposase

attL 2059203:2059262|attR 2130095:2130944

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2059203:2059262	attL	NA	NA	NA	NA
WP_118991658.1\|2059253_2060042_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000039582.1\|2060610_2060955_-	DUF2294 domain-containing protein	NA	NA	NA	NA
WP_029439227.1\|2061070_2061553_-	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_118991825.1\|2064188_2065013_+	HTH domain-containing protein	A0A2H4J969	uncultured_Caudovirales_phage	3.2e-111	75.0
WP_033694722.1\|2065022_2065643_-	phage protein	H0USY2	Bacillus_phage	8.0e-99	84.0
WP_029439224.1\|2065584_2066766_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.4e-189	82.7
WP_029439223.1\|2066881_2067064_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.0e-22	90.0
WP_029439222.1\|2067060_2067378_-	hypothetical protein	H0USY0	Bacillus_phage	3.5e-50	95.2
WP_029439221.1\|2067581_2067785_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	2.4e-12	51.5
WP_029439220.1\|2067789_2068368_+	type IV secretory system conjugative DNA transfer family protein	A0A288WFT6	Bacillus_phage	1.0e-79	72.6
WP_029439219.1\|2068434_2069187_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	5.2e-100	74.0
WP_029439218.1\|2069203_2069434_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	5.3e-32	92.1
WP_001115042.1\|2069476_2069716_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
WP_029439217.1\|2069731_2070691_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	1.8e-174	94.4
WP_029440627.1\|2070848_2072573_-\|plate	BppU family phage baseplate upper protein	A0A2H4J855	uncultured_Caudovirales_phage	2.0e-38	54.0
WP_029440626.1\|2072562_2075178_-	hypothetical protein	A0A2H4JFY7	uncultured_Caudovirales_phage	5.3e-277	52.2
WP_029440625.1\|2075174_2075861_-	hypothetical protein	A0A2H4J851	uncultured_Caudovirales_phage	2.0e-82	62.3
WP_118991872.1\|2075853_2078703_-	hypothetical protein	A0A1B1P764	Bacillus_phage	1.8e-209	85.1
WP_029440472.1\|2078926_2080759_-	hypothetical protein	A0A1B1P775	Bacillus_phage	6.0e-134	98.9
WP_029440473.1\|2080937_2081399_-	hypothetical protein	A0A1B1P772	Bacillus_phage	2.1e-75	94.1
WP_029440474.1\|2081472_2082060_-	hypothetical protein	A0A1B1P778	Bacillus_phage	1.3e-95	86.6
WP_029440475.1\|2082060_2082489_-	hypothetical protein	A0A1B1P769	Bacillus_phage	2.3e-73	97.9
WP_033694907.1\|2082475_2082853_-	hypothetical protein	A0A1B1P759	Bacillus_phage	2.8e-46	72.8
WP_029440477.1\|2082827_2083226_-	hypothetical protein	A0A1B1P760	Bacillus_phage	3.9e-46	77.1
WP_029440478.1\|2083206_2083506_-	hypothetical protein	A0A1B1P751	Bacillus_phage	2.1e-41	87.6
WP_029440479.1\|2083515_2083740_-	hypothetical protein	NA	NA	NA	NA
WP_029440480.1\|2083754_2084918_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.3e-86	44.1
WP_118991826.1\|2084959_2085679_-\|protease	Clp protease ClpP	A0A2H4JC91	uncultured_Caudovirales_phage	1.0e-52	49.4
WP_118991827.1\|2085665_2086832_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.6e-210	93.8
WP_118991719.1\|2086846_2088529_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	9.3e-312	94.3
WP_029440482.1\|2088512_2088833_-	hypothetical protein	A0A1B1P762	Bacillus_phage	4.2e-43	85.8
WP_029437246.1\|2088939_2089239_-	hypothetical protein	NA	NA	NA	NA
WP_029437245.1\|2089242_2089554_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-33	68.0
WP_029437244.1\|2089564_2089906_-	hypothetical protein	A0A1B1P7D2	Bacillus_phage	9.7e-06	35.2
WP_029437243.1\|2089907_2090225_-	hypothetical protein	Q2I8B8	Bacillus_phage	2.3e-09	55.1
WP_050587850.1\|2090238_2090472_-	hypothetical protein	NA	NA	NA	NA
WP_029437241.1\|2090673_2090886_-	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	2.2e-08	39.1
WP_029439665.1\|2091490_2092033_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P746	Bacillus_phage	2.3e-89	91.1
WP_029439666.1\|2092029_2092500_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	7.5e-49	63.2
WP_033694766.1\|2092520_2092691_-	hypothetical protein	NA	NA	NA	NA
WP_029437265.1\|2092986_2094180_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_029439667.1\|2094365_2094548_-	hypothetical protein	NA	NA	NA	NA
WP_033694767.1\|2094567_2094690_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_029439668.1\|2094739_2095165_-	hypothetical protein	NA	NA	NA	NA
WP_029439669.1\|2095200_2095509_-	hypothetical protein	NA	NA	NA	NA
WP_162901164.1\|2095892_2096060_-	hypothetical protein	NA	NA	NA	NA
WP_016098383.1\|2096287_2096452_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	2.9e-24	98.1
WP_029439670.1\|2096502_2096769_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	4.1e-36	85.2
WP_050587941.1\|2096765_2097068_-	hypothetical protein	A0A1B1P7W1	Bacillus_phage	2.0e-18	51.6
WP_029439672.1\|2097071_2097878_-	ATP-binding protein	D2XQ17	Bacillus_virus	1.8e-122	81.6
WP_029439673.1\|2098995_2099643_-	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	2.6e-100	84.7
WP_029439674.1\|2099898_2100231_-	hypothetical protein	W8CYU1	Bacillus_phage	1.5e-43	88.9
WP_029439675.1\|2100393_2101188_-	antirepressor	A0A0S2GLP8	Bacillus_phage	4.9e-133	93.6
WP_000788399.1\|2101225_2101381_-	hypothetical protein	I7J4K2	Bacillus_phage	2.6e-22	96.1
WP_029439676.1\|2101400_2101589_-	helix-turn-helix transcriptional regulator	W8CYN7	Bacillus_phage	6.7e-25	93.5
WP_000819158.1\|2101656_2101863_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029439677.1\|2102032_2102377_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	6.1e-16	41.5
WP_134981279.1\|2102373_2102553_-	hypothetical protein	NA	NA	NA	NA
WP_029439678.1\|2102777_2103998_-	hypothetical protein	A0A0U3TNF6	Bacillus_phage	2.2e-108	49.5
WP_029439679.1\|2104738_2105830_+\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	1.8e-162	79.3
WP_029439680.1\|2105803_2106529_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_029439681.1\|2106943_2108482_+	spore germination protein GerSA	NA	NA	NA	NA
WP_029439682.1\|2108478_2109576_+	endospore germination permease	NA	NA	NA	NA
WP_118991829.1\|2109576_2110713_+	spore germination protein GerSC	NA	NA	NA	NA
WP_001116178.1\|2110791_2110926_-	hypothetical protein	NA	NA	NA	NA
WP_029439683.1\|2110983_2114346_-	phosphonate ABC transporter permease	NA	NA	NA	NA
WP_029439684.1\|2114424_2116524_-	VWA domain-containing protein	NA	NA	NA	NA
WP_029439685.1\|2116781_2117120_-	VOC family protein	NA	NA	NA	NA
WP_029439686.1\|2117190_2117526_-	hypothetical protein	NA	NA	NA	NA
WP_029439687.1\|2117660_2118056_+	hypothetical protein	NA	NA	NA	NA
WP_029439688.1\|2118097_2118817_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_029439689.1\|2118930_2120637_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000728446.1\|2120917_2122624_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029439690.1\|2123000_2124713_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_118991830.1\|2126528_2127566_-	LCP family protein	NA	NA	NA	NA
WP_029439691.1\|2127583_2128612_-	hypothetical protein	NA	NA	NA	NA
WP_000864744.1\|2128624_2129158_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_118991658.1\|2129313_2130103_-\|transposase	IS5 family transposase	NA	NA	NA	NA
2130095:2130944	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2474384 : 2545322

Bacillus_phage(79.63%)

capsid,portal,transposase,head,terminase,tail,protease,integrase,tRNA

attL 2466573:2466589|attR 2539797:2539813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2466573:2466589	attL	NA	NA	NA	NA
WP_029439624.1\|2474384_2477150_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	2.0e-85	26.8
WP_001131611.1\|2477499_2478006_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_029439625.1\|2478095_2478863_-	RNA-binding protein	NA	NA	NA	NA
WP_029439626.1\|2478878_2479142_-	YggT family protein	NA	NA	NA	NA
WP_000119137.1\|2479148_2479619_-	cell division protein SepF	NA	NA	NA	NA
WP_029439627.1\|2479638_2480313_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_029439628.1\|2480309_2481128_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_001980616.1\|2481246_2481531_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000197753.1\|2481677_2482457_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_000976948.1\|2482614_2483334_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_029439629.1\|2483353_2484271_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888991.1\|2484585_2485740_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087553.1\|2485779_2487087_-	cell division protein FtsA	NA	NA	NA	NA
WP_000798232.1\|2487487_2488258_-	cell division protein DivIB	NA	NA	NA	NA
WP_029439630.1\|2488356_2489262_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001265416.1\|2489323_2490418_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753510.1\|2490523_2491615_-	stage V sporulation protein E	NA	NA	NA	NA
WP_029439631.1\|2491705_2493058_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000893059.1\|2493058_2494033_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_029439632.1\|2494055_2495531_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_001266226.1\|2495735_2497652_-	stage V sporulation protein D	NA	NA	NA	NA
WP_029439633.1\|2497733_2499833_-	penicillin-binding protein	NA	NA	NA	NA
WP_000067082.1\|2499905_2500268_-	cell division protein FtsL	NA	NA	NA	NA
WP_029439634.1\|2500283_2501216_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_118991640.1\|2501585_2503202_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_029439635.1\|2503281_2504172_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_029439636.1\|2504466_2504940_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246480.1\|2504973_2505480_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	5.1e-11	34.7
WP_001984764.1\|2505609_2505783_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_140611837.1\|2505844_2506345_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_118991641.1\|2506618_2507236_-	hypothetical protein	Q2LIA9	Bacillus_phage	1.2e-81	78.1
WP_029439637.1\|2507177_2508362_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	2.6e-138	60.9
WP_029439638.1\|2508480_2508663_-	hypothetical protein	A0A288WGN6	Bacillus_phage	3.1e-19	78.3
WP_029439639.1\|2508659_2508956_-	hypothetical protein	A0A288WG38	Bacillus_phage	1.2e-23	52.6
WP_001237238.1\|2509140_2509353_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	2.7e-30	100.0
WP_029439640.1\|2509345_2509837_+	hypothetical protein	Q3HL01	Bacillus_phage	1.2e-76	98.2
WP_029439641.1\|2509893_2510691_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.8e-111	69.8
WP_029439642.1\|2510690_2510897_-	hypothetical protein	D2XR32	Bacillus_phage	2.6e-30	89.7
WP_000818882.1\|2510905_2511145_-	peptidase	A0A1B1P7E0	Bacillus_phage	8.0e-31	86.1
WP_029439643.1\|2511235_2511568_-	hypothetical protein	A0A1B2APY3	Phage_Wrath	8.8e-28	60.7
WP_029439644.1\|2511631_2513122_-	hypothetical protein	A0A0S2SXW1	Bacillus_phage	1.6e-31	41.0
WP_029439645.1\|2513180_2514800_-	hypothetical protein	A0A0K1LLF9	Bacillus_phage	3.6e-98	38.3
WP_029439646.1\|2514815_2515679_-\|tail	phage tail family protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.7e-75	56.0
WP_029439647.1\|2515683_2520198_-	hypothetical protein	A6XMK6	Bacillus_virus	1.6e-111	52.9
WP_029439648.1\|2520376_2520838_-	hypothetical protein	A0A1B1P772	Bacillus_phage	2.5e-49	61.8
WP_029439649.1\|2520905_2521493_-	hypothetical protein	A0A1B1P778	Bacillus_phage	3.6e-93	85.1
WP_029439650.1\|2521494_2521923_-	hypothetical protein	A0A1B1P769	Bacillus_phage	1.3e-63	85.1
WP_033694784.1\|2521909_2522287_-	hypothetical protein	A0A1B1P759	Bacillus_phage	2.1e-46	76.8
WP_098142341.1\|2522303_2522660_-\|head,tail	phage head-tail adapter protein	A0A1B1P760	Bacillus_phage	2.2e-53	86.4
WP_029439653.1\|2522640_2522940_-	hypothetical protein	A0A1B1P751	Bacillus_phage	6.2e-41	84.5
WP_029439654.1\|2522949_2523189_-	hypothetical protein	NA	NA	NA	NA
WP_029439655.1\|2523203_2524355_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.5e-204	93.5
WP_029439656.1\|2524383_2525109_-\|protease	Clp protease ClpP	A0A1B1P753	Bacillus_phage	7.9e-106	82.6
WP_118991642.1\|2525110_2526277_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.6e-204	92.0
WP_029439657.1\|2526291_2527974_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.2e-311	94.4
WP_029439658.1\|2527957_2528278_-	hypothetical protein	A0A1B1P762	Bacillus_phage	1.7e-44	85.8
WP_029439659.1\|2528385_2528694_-	hypothetical protein	A0A1B1P767	Bacillus_phage	5.6e-45	90.4
WP_033694765.1\|2528696_2529002_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.4e-51	95.0
WP_029439661.1\|2529004_2529256_-	hypothetical protein	A0A1B1P743	Bacillus_phage	9.3e-14	52.4
WP_029439662.1\|2529260_2529557_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.2e-07	50.0
WP_029439663.1\|2529563_2529788_-	hypothetical protein	A0A1B1P745	Bacillus_phage	6.1e-25	85.1
WP_158001557.1\|2529793_2529952_-	hypothetical protein	NA	NA	NA	NA
WP_029439664.1\|2530321_2530876_-	hypothetical protein	NA	NA	NA	NA
WP_162901141.1\|2530909_2531065_-	hypothetical protein	NA	NA	NA	NA
WP_029439665.1\|2531266_2531809_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P746	Bacillus_phage	2.3e-89	91.1
WP_029439666.1\|2531805_2532276_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	7.5e-49	63.2
WP_033694766.1\|2532296_2532467_-	hypothetical protein	NA	NA	NA	NA
WP_029437265.1\|2532762_2533956_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_029439667.1\|2534141_2534324_-	hypothetical protein	NA	NA	NA	NA
WP_033694767.1\|2534343_2534466_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_029439668.1\|2534515_2534941_-	hypothetical protein	NA	NA	NA	NA
WP_029439669.1\|2534976_2535285_-	hypothetical protein	NA	NA	NA	NA
WP_029438025.1\|2535653_2535902_-	helix-turn-helix transcriptional regulator	A0A0U3J7D7	Bacillus_phage	4.2e-35	89.0
WP_029438026.1\|2536018_2536228_-	hypothetical protein	A0A1B1P8C8	Bacillus_phage	6.8e-18	68.8
WP_033694511.1\|2536253_2536433_-	hypothetical protein	A0A1B1P7M8	Bacillus_phage	9.2e-24	94.5
WP_029438027.1\|2536432_2536630_-	hypothetical protein	A0A097BYE4	Leuconostoc_phage	6.2e-05	38.7
WP_029438028.1\|2536667_2536961_-	hypothetical protein	NA	NA	NA	NA
WP_167506397.1\|2537053_2537194_+	hypothetical protein	NA	NA	NA	NA
WP_029438029.1\|2537798_2537990_-	hypothetical protein	NA	NA	NA	NA
WP_029437230.1\|2538031_2538514_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
WP_000109490.1\|2538533_2538785_-	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	4.9e-07	42.2
WP_000717826.1\|2538810_2538978_-	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_001125952.1\|2538996_2539356_-	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.1e-31	53.3
WP_029438030.1\|2539348_2539627_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	3.5e-14	64.4
WP_029438031.1\|2539643_2539838_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.9e-22	81.2
2539797:2539813	attR	NA	NA	NA	NA
WP_029438032.1\|2539840_2540704_-	ATP-binding protein	A0A1B0T6C3	Bacillus_phage	1.3e-102	71.1
WP_029438033.1\|2540645_2541521_-	replication protein	V5UQV4	Oenococcus_phage	4.2e-37	38.3
WP_033694513.1\|2541526_2541703_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	6.5e-22	82.8
WP_033694514.1\|2541732_2541897_-	hypothetical protein	A0A0U3B230	Bacillus_phage	1.1e-18	85.2
WP_000284333.1\|2541953_2542154_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_029438034.1\|2542206_2542431_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000153812.1\|2542649_2543018_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
WP_000719898.1\|2543281_2543431_-	hypothetical protein	NA	NA	NA	NA
WP_029438035.1\|2543443_2544541_-	hypothetical protein	NA	NA	NA	NA
WP_029438036.1\|2544977_2545322_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	6.1e-16	36.6

DBSCAN-SWA_10

2990043 : 3050406

Bacillus_phage(18.18%)

transposase,tRNA,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029437265.1\|2990043_2991237_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_000349152.1\|2991421_2991805_+	TIGR04086 family membrane protein	NA	NA	NA	NA
WP_001068065.1\|2991841_2992102_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.3e-05	45.5
WP_000125362.1\|2992129_2993269_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	42.1
WP_000354028.1\|2993281_2994334_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_000138162.1\|2994353_2994554_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_000344453.1\|2994550_2995552_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	5.2e-07	26.3
WP_000464508.1\|2995557_2996175_-	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
WP_029440005.1\|2996363_2997308_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029440006.1\|2997321_2997849_-	BofC protein	NA	NA	NA	NA
WP_029440007.1\|2997969_2998899_-	DMT family transporter	NA	NA	NA	NA
WP_029440008.1\|2998965_2999286_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_118991648.1\|2999729_3000164_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029440010.1\|3000198_3000840_-	hypothetical protein	NA	NA	NA	NA
WP_118991649.1\|3001020_3002949_-\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA
WP_029440012.1\|3003169_3004276_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_029440013.1\|3004306_3005140_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_029440014.1\|3005159_3006689_-	L-aspartate oxidase	NA	NA	NA	NA
WP_029440015.1\|3006840_3007983_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	1.1e-32	30.1
WP_000812272.1\|3007982_3008525_+	transcription repressor NadR	NA	NA	NA	NA
WP_029440016.1\|3008604_3009252_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_000621725.1\|3009489_3010341_-	prephenate dehydratase	NA	NA	NA	NA
WP_029440017.1\|3010437_3012348_-	ABC transporter permease	NA	NA	NA	NA
WP_029440018.1\|3012397_3014320_-	ABC transporter permease	NA	NA	NA	NA
WP_000114530.1\|3014294_3015071_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-29	38.4
WP_029440019.1\|3015164_3016247_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_029440020.1\|3016236_3016944_-	response regulator transcription factor	NA	NA	NA	NA
WP_029440021.1\|3017083_3018370_-	GTPase ObgE	NA	NA	NA	NA
WP_029440022.1\|3018369_3018918_-	sporulation protein	NA	NA	NA	NA
WP_000944957.1\|3018981_3019272_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_001973720.1\|3019275_3019620_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|3019631_3019940_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_029440023.1\|3020109_3021498_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_029440024.1\|3021565_3022426_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_029440025.1\|3022418_3023165_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000503310.1\|3023298_3024096_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_000391517.1\|3024098_3024785_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_029440026.1\|3024820_3025366_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_029440027.1\|3025380_3026232_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000466737.1\|3026273_3027293_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_001013370.1\|3027450_3028128_-	DNA repair protein RadC	NA	NA	NA	NA
WP_001226285.1\|3028174_3028750_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_029440028.1\|3028971_3029934_-	hypothetical protein	NA	NA	NA	NA
WP_029440029.1\|3030099_3031401_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_029440030.1\|3031494_3034140_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	8.0e-164	42.7
WP_029440031.1\|3034534_3035560_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_029440032.1\|3035622_3036600_-	stage VI sporulation protein D	NA	NA	NA	NA
WP_000712928.1\|3036709_3037999_-	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.7e-05	34.1
WP_029440033.1\|3037998_3038988_-	porphobilinogen synthase	NA	NA	NA	NA
WP_029440034.1\|3039057_3039810_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_029440035.1\|3039812_3040742_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_000008996.1\|3040757_3041591_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_029440036.1\|3041608_3042943_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_029440037.1\|3043359_3043812_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000359781.1\|3043814_3044231_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_029440038.1\|3044262_3044859_-	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
WP_029440039.1\|3044855_3047186_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.0e-178	43.8
WP_029440040.1\|3047369_3049040_-\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	7.4e-14	33.0
WP_000472281.1\|3049146_3050406_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.7e-149	66.1

DBSCAN-SWA_11

3095823 : 3103502

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029440066.1\|3095823_3096747_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-46	47.8
WP_029440067.1\|3096872_3097808_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	4.3e-11	25.9
WP_029440068.1\|3097809_3098502_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-36	38.7
WP_033694813.1\|3098670_3098844_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|3098844_3099039_+	YwbE family protein	NA	NA	NA	NA
WP_001255958.1\|3099078_3100278_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.2
WP_029440069.1\|3100573_3100897_+	heme oxygenase	NA	NA	NA	NA
WP_029440070.1\|3100962_3101727_-	class B sortase	NA	NA	NA	NA
WP_029440071.1\|3101758_3102529_-	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.7e-05	24.4
WP_001036835.1\|3102518_3103502_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	7.1e-17	26.6

DBSCAN-SWA_12

3335868 : 3383339

Staphylococcus_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029437205.1\|3335868_3337281_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029440214.1\|3338594_3339815_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_029440215.1\|3339811_3341068_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_029440216.1\|3341421_3342231_+	alpha/beta hydrolase	A0A0B5A484	Mycobacterium_phage	5.9e-09	27.3
WP_033694832.1\|3342435_3344580_-	alkaline phosphatase family protein	NA	NA	NA	NA
WP_029440218.1\|3344814_3345045_-	hypothetical protein	NA	NA	NA	NA
WP_000455572.1\|3345056_3345353_-	DUF3986 family protein	NA	NA	NA	NA
WP_029440219.1\|3345473_3346481_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029440220.1\|3346492_3347257_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.4e-38	41.0
WP_000368783.1\|3347249_3348056_+	ABC transporter permease	NA	NA	NA	NA
WP_000849109.1\|3348090_3348318_-	hypothetical protein	NA	NA	NA	NA
WP_029440222.1\|3348532_3349648_-	hypothetical protein	NA	NA	NA	NA
WP_029440223.1\|3349741_3350416_+	HAD family hydrolase	NA	NA	NA	NA
WP_118991659.1\|3350549_3351339_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_000276389.1\|3351958_3352438_-	antimutator 8-oxo-(dGTP/GTP)ase	A0A2H4PQM4	Staphylococcus_phage	2.8e-19	33.3
WP_029440224.1\|3352522_3352840_-	hypothetical protein	NA	NA	NA	NA
WP_000472802.1\|3352923_3353073_+	YtzI protein	NA	NA	NA	NA
WP_029440225.1\|3353283_3353514_+	YczI family protein	NA	NA	NA	NA
WP_029440226.1\|3353844_3354084_+	hypothetical protein	NA	NA	NA	NA
WP_001141369.1\|3354397_3354871_-	S-ribosylhomocysteine lyase LuxS	NA	NA	NA	NA
WP_000809327.1\|3354999_3355236_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.4e-27	72.6
WP_000838161.1\|3355232_3355796_-	carbonic anhydrase	NA	NA	NA	NA
WP_029440227.1\|3356020_3357370_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_029440228.1\|3357359_3358388_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_001141559.1\|3358554_3358770_-	spore germination protein	NA	NA	NA	NA
WP_029440229.1\|3358870_3359677_-	S-layer protein	NA	NA	NA	NA
WP_029440230.1\|3360385_3361420_+	YdcF family protein	NA	NA	NA	NA
WP_029440231.1\|3361494_3361812_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_000411240.1\|3362053_3362926_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-33	34.6
WP_029440232.1\|3363049_3363265_-	hypothetical protein	NA	NA	NA	NA
WP_000071191.1\|3363365_3364181_-	DUF4247 domain-containing protein	NA	NA	NA	NA
WP_029440233.1\|3364193_3364700_-	DUF4178 domain-containing protein	NA	NA	NA	NA
WP_000220322.1\|3364721_3365126_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_029440234.1\|3365206_3365872_-	PspA/IM30 family protein	NA	NA	NA	NA
WP_029440235.1\|3366274_3366853_+	hypothetical protein	NA	NA	NA	NA
WP_029440236.1\|3366887_3367058_-	FeoB-associated Cys-rich membrane protein	NA	NA	NA	NA
WP_029440237.1\|3367074_3369063_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_000060512.1\|3369059_3369287_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_118991843.1\|3369531_3370725_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_118991844.1\|3371132_3372326_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029440240.1\|3372935_3373604_+	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_029440241.1\|3373812_3375666_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.6e-31	31.2
WP_029440242.1\|3375662_3376352_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	36.9
WP_029440243.1\|3376391_3377012_-	class D sortase	NA	NA	NA	NA
WP_029440244.1\|3377101_3377545_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_029440245.1\|3377722_3378055_-	hypothetical protein	NA	NA	NA	NA
WP_002156638.1\|3378239_3378455_-	hypothetical protein	NA	NA	NA	NA
WP_001019304.1\|3378615_3379143_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.7e-12	31.8
WP_000167905.1\|3379329_3380232_+	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_029440246.1\|3380311_3380992_-	hypothetical protein	NA	NA	NA	NA
WP_029440247.1\|3381172_3382132_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	4.5e-16	27.8
WP_118991658.1\|3382549_3383339_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

3471149 : 3549442

Bacillus_phage(46.0%)

capsid,portal,coat,transposase,head,terminase,tail,protease,integrase,tRNA

attL 3492969:3492986|attR 3553012:3553029

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029440495.1\|3471149_3472526_+\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	2.6e-49	28.1
WP_029440496.1\|3472565_3472949_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_029440497.1\|3473044_3473788_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_029440498.1\|3473838_3474420_+	biotin transporter BioY	NA	NA	NA	NA
WP_029440499.1\|3474461_3475349_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	7.7e-79	52.7
WP_029440500.1\|3475457_3477182_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	5.2e-180	54.4
WP_001158742.1\|3477325_3477931_+	hypothetical protein	NA	NA	NA	NA
WP_029440501.1\|3478014_3479499_-	cytosol aminopeptidase	Q6GYZ8	Mycoplasma_phage	8.7e-59	37.2
WP_029440502.1\|3479643_3480270_-	3D domain-containing protein	A0A0H3UZG2	Geobacillus_virus	9.5e-15	43.9
WP_029440503.1\|3480356_3480674_-	membrane protein	NA	NA	NA	NA
WP_029440504.1\|3480670_3481177_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000856614.1\|3481299_3482508_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000829779.1\|3482970_3483960_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	3.0e-31	52.4
WP_029440505.1\|3484086_3484563_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000391915.1\|3484894_3486142_+	MFS transporter	NA	NA	NA	NA
WP_029440506.1\|3486152_3487040_-	decarboxylase	NA	NA	NA	NA
WP_029440507.1\|3487120_3487582_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_029440508.1\|3487904_3488969_+	hypothetical protein	A0A0S2MVF4	Bacillus_phage	9.2e-10	48.8
WP_029440509.1\|3489117_3489309_+	hypothetical protein	NA	NA	NA	NA
WP_029440510.1\|3489322_3489589_+	hypothetical protein	NA	NA	NA	NA
WP_029440511.1\|3489981_3491157_-	serine hydrolase	R4JG75	Mycobacterium_phage	1.2e-26	28.5
WP_140611869.1\|3492089_3493214_+	hypothetical protein	NA	NA	NA	NA
3492969:3492986	attL	NA	NA	NA	NA
WP_029440513.1\|3493317_3494385_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	4.3e-193	91.8
WP_000253960.1\|3494381_3494621_-	hypothetical protein	A0A2H4J378	uncultured_Caudovirales_phage	1.5e-32	97.5
WP_029440514.1\|3494620_3494857_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	97.4
WP_029440515.1\|3495266_3499262_-	peptidase S74	Q2LIB7	Bacillus_phage	0.0e+00	85.3
WP_029440516.1\|3499258_3500749_-\|tail	phage tail protein	Q2LIB8	Bacillus_phage	3.3e-276	93.8
WP_029440517.1\|3500754_3504615_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	91.1
WP_158001569.1\|3504629_3504806_-	hypothetical protein	I3WTY5	Bacillus_phage	2.9e-22	89.7
WP_029440518.1\|3504835_3505153_-	hypothetical protein	A0A288WFU2	Bacillus_phage	1.2e-53	100.0
WP_000896773.1\|3505202_3505811_-\|tail	tail protein	A0A288WG55	Bacillus_phage	1.1e-103	98.5
WP_029440519.1\|3505811_3506171_-	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	2.7e-59	95.0
WP_029440520.1\|3506167_3506605_-	HK97 gp10 family phage protein	A0A288WGM7	Bacillus_phage	1.0e-76	99.3
WP_029440521.1\|3506597_3506921_-\|head	phage head closure protein	H0USW8	Bacillus_phage	7.0e-54	92.5
WP_000244596.1\|3506917_3507196_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	5.8e-41	94.6
WP_029440522.1\|3507216_3508389_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	3.0e-195	88.5
WP_029440523.1\|3508426_3509137_-\|protease	Clp protease ClpP	A0A0S2GLD5	Bacillus_phage	1.3e-124	96.2
WP_000577482.1\|3509123_3510377_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	1.7e-236	97.4
WP_029440524.1\|3510565_3512260_-\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	0.0e+00	99.6
WP_029440525.1\|3512261_3512765_-\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	6.7e-88	99.4
WP_029440526.1\|3512873_3513248_-	HNH endonuclease	H0USW1	Bacillus_phage	2.0e-60	88.5
WP_029440527.1\|3513237_3513492_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	3.8e-39	88.1
WP_029440528.1\|3513492_3513747_-	hypothetical protein	A0A1B1P7X2	Bacillus_phage	2.8e-18	59.3
WP_029440529.1\|3513769_3513991_-	hypothetical protein	NA	NA	NA	NA
WP_029440530.1\|3514205_3514595_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	3.5e-36	57.4
WP_162901144.1\|3514778_3514916_-	hypothetical protein	NA	NA	NA	NA
WP_033694916.1\|3515252_3515519_-	hypothetical protein	A0A0H3V0M3	Geobacillus_virus	1.3e-13	51.2
WP_118991662.1\|3515562_3515721_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_029440531.1\|3515734_3516274_-	nuclease	A0A0S2SXQ1	Bacillus_phage	3.5e-50	54.2
WP_029440532.1\|3516276_3516705_-	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	1.5e-56	69.5
WP_029440533.1\|3516692_3516932_-	hypothetical protein	NA	NA	NA	NA
WP_029440534.1\|3517257_3519600_-	DNA primase	A0A2H4J990	uncultured_Caudovirales_phage	0.0e+00	84.7
WP_029440535.1\|3519671_3520148_-	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	3.0e-29	46.9
WP_029440536.1\|3520147_3520849_-	AAA family ATPase	A0A2H4JHI2	uncultured_Caudovirales_phage	1.6e-71	58.1
WP_029440537.1\|3520849_3521044_-	hypothetical protein	NA	NA	NA	NA
WP_162901145.1\|3521040_3521217_-	hypothetical protein	NA	NA	NA	NA
WP_029440538.1\|3521194_3521431_-	hypothetical protein	NA	NA	NA	NA
WP_029440539.1\|3521704_3521905_-	hypothetical protein	A0A1B1P7L2	Bacillus_phage	7.7e-11	56.5
WP_118991663.1\|3522167_3522956_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029440542.1\|3522953_3523565_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	2.7e-75	68.0
WP_000277639.1\|3523585_3523774_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	9.4e-19	75.8
WP_001025461.1\|3523785_3523983_-	hypothetical protein	NA	NA	NA	NA
WP_162901146.1\|3524003_3524159_-	hypothetical protein	A0A2H4J977	uncultured_Caudovirales_phage	6.8e-15	76.0
WP_000817630.1\|3524178_3524499_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029440543.1\|3524677_3525016_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	1.4e-09	35.2
WP_029440544.1\|3525166_3526618_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_033694917.1\|3526739_3526916_-	hypothetical protein	NA	NA	NA	NA
WP_162901147.1\|3527057_3527207_-	hypothetical protein	NA	NA	NA	NA
WP_033694929.1\|3527203_3528343_-	hypothetical protein	H0UST6	Bacillus_phage	1.0e-139	65.3
WP_050587961.1\|3528571_3528757_-	hypothetical protein	H0UST5	Bacillus_phage	8.1e-15	70.5
WP_029440546.1\|3529862_3530924_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	2.1e-171	83.6
WP_029440547.1\|3531011_3531365_-	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	3.2e-12	39.5
WP_029440548.1\|3532089_3532653_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000573821.1\|3532759_3533113_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	6.3e-16	43.3
WP_000077386.1\|3533154_3534021_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_000595026.1\|3534266_3534506_-	YuzB family protein	NA	NA	NA	NA
WP_029440549.1\|3534858_3535929_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_029440550.1\|3536160_3536334_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_029440551.1\|3536388_3537048_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	35.2
WP_029440552.1\|3537031_3537829_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_000212737.1\|3537969_3538311_-	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
WP_029440553.1\|3538847_3539525_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_118991664.1\|3539623_3540502_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000248595.1\|3540470_3540779_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|3540985_3541222_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_001125496.1\|3541416_3541632_+	hypothetical protein	NA	NA	NA	NA
WP_048557137.1\|3541693_3542695_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_000665103.1\|3542815_3543307_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_029440556.1\|3543327_3543807_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029440557.1\|3544309_3546883_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_029440558.1\|3546866_3547655_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-33	39.5
WP_029437205.1\|3548029_3549442_-\|transposase	IS66 family transposase	NA	NA	NA	NA
3553012:3553029	attR	NA	NA	NA	NA

DBSCAN-SWA_14

4393201 : 4401574

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|4393201_4394509_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_001170542.1\|4394597_4395317_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278820.1\|4395309_4395564_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666778.1\|4395560_4396244_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_029437191.1\|4396227_4398447_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.0
WP_029437192.1\|4398431_4399847_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.0
WP_029437193.1\|4399949_4400990_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.4e-68	45.6
WP_029437194.1\|4400986_4401574_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.7e-26	35.8

DBSCAN-SWA_15

4424451 : 4510278

101

Bacillus_phage(67.31%)

capsid,portal,plate,coat,transposase,holin,terminase,integrase,protease,tRNA

attL 4443421:4443451|attR 4483217:4483247

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000086999.1\|4424451_4424742_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_029437209.1\|4424757_4426215_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_001047685.1\|4426229_4427657_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_000977671.1\|4428127_4429033_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	3.1e-27	30.8
WP_029437210.1\|4429172_4429919_+	HAD family hydrolase	NA	NA	NA	NA
WP_118991682.1\|4429998_4431438_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_029437212.1\|4431554_4432922_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_029437213.1\|4432914_4434366_+	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000263262.1\|4434413_4434737_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_029437214.1\|4434777_4436007_-	aminopeptidase	NA	NA	NA	NA
WP_158001543.1\|4436492_4436963_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_029437142.1\|4436952_4438059_+	hypothetical protein	NA	NA	NA	NA
WP_029437216.1\|4439085_4440189_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_029437217.1\|4440465_4441662_-	pyrimidine nucleoside transporter NupC	NA	NA	NA	NA
WP_118991683.1\|4442066_4443467_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	5.1e-117	46.5
4443421:4443451	attL	NA	NA	NA	NA
WP_029437219.1\|4443525_4444650_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	9.7e-212	98.7
WP_029437220.1\|4444925_4445270_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	1.2e-32	61.3
WP_118991685.1\|4445760_4446912_+	hypothetical protein	D2XQ10	Bacillus_virus	7.0e-72	43.3
WP_162901148.1\|4446947_4447103_+	hypothetical protein	NA	NA	NA	NA
WP_162901149.1\|4447251_4447389_+	hypothetical protein	NA	NA	NA	NA
WP_029437221.1\|4447418_4447778_-	helix-turn-helix transcriptional regulator	A0A0A7AR52	Bacillus_phage	4.3e-20	41.2
WP_033694430.1\|4447948_4448152_+	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	3.4e-14	59.7
WP_029437223.1\|4448218_4448950_+	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	2.1e-122	89.3
WP_029437224.1\|4448993_4449344_+	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	4.6e-51	81.0
WP_158001545.1\|4449340_4449508_+	hypothetical protein	A0A0U3B230	Bacillus_phage	3.4e-20	88.9
WP_033694431.1\|4449537_4449714_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	1.2e-23	86.2
WP_029437225.1\|4449718_4450606_+	chromosomal replication initiator protein DnaA	A0A0U3TZZ4	Bacillus_phage	5.5e-93	66.4
WP_029437226.1\|4450620_4451535_+	AAA family ATPase	A0A0U3U1U1	Bacillus_phage	2.9e-169	98.7
WP_029437227.1\|4451547_4451742_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	8.2e-26	87.5
WP_029437228.1\|4451758_4452037_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.4e-12	59.3
WP_001125952.1\|4452029_4452389_+	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.1e-31	53.3
WP_000717826.1\|4452407_4452575_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_029437229.1\|4452600_4452852_+	hypothetical protein	A0A1B1P7W1	Bacillus_phage	1.3e-15	48.7
WP_029437230.1\|4452871_4453354_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
WP_029437231.1\|4453392_4453632_+	hypothetical protein	NA	NA	NA	NA
WP_158001546.1\|4453645_4453819_+	hypothetical protein	NA	NA	NA	NA
WP_029437232.1\|4453852_4454185_+	hypothetical protein	NA	NA	NA	NA
WP_029437233.1\|4454212_4454908_+	hypothetical protein	A0A1I9S6E4	Bacillus_phage	8.4e-113	81.0
WP_029437234.1\|4455125_4455305_+	hypothetical protein	NA	NA	NA	NA
WP_029437235.1\|4455343_4455526_+	hypothetical protein	A0A0A7AR63	Bacillus_phage	2.2e-12	54.4
WP_029437236.1\|4455562_4455799_+	hypothetical protein	NA	NA	NA	NA
WP_029437237.1\|4456058_4456241_+	hypothetical protein	G9J254	Bacillus_phage	3.9e-14	70.4
WP_033694472.1\|4456269_4456452_+	hypothetical protein	G9J1S8	Bacillus_phage	1.9e-08	51.7
WP_033694432.1\|4456462_4456585_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_029437238.1\|4456605_4456788_+	hypothetical protein	NA	NA	NA	NA
WP_000866511.1\|4456892_4457063_+	hypothetical protein	NA	NA	NA	NA
WP_029437239.1\|4457083_4457560_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	9.3e-47	61.0
WP_029437240.1\|4457556_4458099_+\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	3.6e-87	88.3
WP_029437241.1\|4458702_4458915_+	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	2.2e-08	39.1
WP_050587850.1\|4459116_4459350_+	hypothetical protein	NA	NA	NA	NA
WP_029437243.1\|4459363_4459681_+	hypothetical protein	Q2I8B8	Bacillus_phage	2.3e-09	55.1
WP_029437244.1\|4459682_4460024_+	hypothetical protein	A0A1B1P7D2	Bacillus_phage	9.7e-06	35.2
WP_029437245.1\|4460034_4460346_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-33	68.0
WP_029437246.1\|4460349_4460649_+	hypothetical protein	NA	NA	NA	NA
WP_029437247.1\|4460755_4461079_+	hypothetical protein	A0A1B1P762	Bacillus_phage	5.5e-43	87.6
WP_029437248.1\|4461059_4462733_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	7.8e-290	89.7
WP_029437249.1\|4462749_4463913_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	2.3e-131	59.4
WP_029437250.1\|4464009_4465128_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_033694433.1\|4465478_4466222_+\|protease	Clp protease ClpP	Q8W605	Listeria_phage	1.4e-60	65.4
WP_029437251.1\|4466259_4467402_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.5e-122	57.8
WP_158001547.1\|4467421_4467562_+	hypothetical protein	NA	NA	NA	NA
WP_000438401.1\|4467563_4467869_+	hypothetical protein	A0A1B1P751	Bacillus_phage	1.2e-18	54.1
WP_029437252.1\|4467852_4468200_+	hypothetical protein	A0A1B1P760	Bacillus_phage	1.8e-31	62.7
WP_029437253.1\|4468189_4468576_+	hypothetical protein	NA	NA	NA	NA
WP_029437254.1\|4468565_4468988_+	hypothetical protein	R4IBU7	Listeria_phage	2.3e-20	39.7
WP_029437255.1\|4468994_4469588_+	hypothetical protein	A0A1B1P778	Bacillus_phage	5.0e-58	55.3
WP_029437256.1\|4469606_4470059_+	hypothetical protein	A0A1B1P772	Bacillus_phage	2.1e-19	36.3
WP_029437257.1\|4470241_4471852_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	8.2e-103	71.4
WP_118991849.1\|4473464_4474487_+	hypothetical protein	A0A2I7SCT8	Paenibacillus_phage	1.3e-24	62.4
WP_029437261.1\|4474479_4475166_+	hypothetical protein	A0A2H4J851	uncultured_Caudovirales_phage	4.9e-81	61.4
WP_029437262.1\|4475162_4477778_+	hypothetical protein	A0A2H4JFY7	uncultured_Caudovirales_phage	4.1e-277	52.1
WP_118991686.1\|4477767_4479492_+\|plate	BppU family phage baseplate upper protein	A0A2H4J855	uncultured_Caudovirales_phage	5.2e-39	54.0
WP_029437264.1\|4479579_4480002_+\|holin	phage holin family protein	D2XPZ9	Bacillus_virus	1.4e-67	97.1
WP_029437265.1\|4480084_4481278_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_029437266.1\|4481574_4482372_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.3e-112	72.1
WP_029437267.1\|4482600_4482954_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	1.4e-10	34.7
WP_029437268.1\|4483356_4484346_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
4483217:4483247	attR	NA	NA	NA	NA
WP_118991687.1\|4484661_4486680_+	GAF domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_001251708.1\|4486757_4487276_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	1.0e-22	37.7
WP_029437270.1\|4487651_4489388_-	hypothetical protein	NA	NA	NA	NA
WP_029437271.1\|4489735_4490443_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_029437272.1\|4490503_4491199_-	hypothetical protein	NA	NA	NA	NA
WP_000704467.1\|4491213_4492323_-	dipeptide epimerase	Q6A202	Oenococcus_phage	8.6e-19	25.5
WP_029437273.1\|4492415_4493687_+	hypothetical protein	NA	NA	NA	NA
WP_029437274.1\|4493675_4495097_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_029437275.1\|4495391_4496507_+	amidohydrolase	NA	NA	NA	NA
WP_029437276.1\|4496639_4497248_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_029437277.1\|4497251_4497998_+	hypothetical protein	NA	NA	NA	NA
WP_029437278.1\|4498050_4499577_-	alkyl hydroperoxide reductase subunit F	A0A1W6JNB4	Lactococcus_phage	9.1e-19	30.8
WP_000924418.1\|4499591_4500155_-	peroxiredoxin	NA	NA	NA	NA
WP_029437279.1\|4500745_4501975_+	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_029437280.1\|4501987_4503028_+	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_000926550.1\|4503083_4503725_+	L-fuculose-phosphate aldolase	NA	NA	NA	NA
WP_029437281.1\|4503765_4504773_-	iron ABC transporter permease	NA	NA	NA	NA
WP_029437282.1\|4504769_4505810_-	iron ABC transporter permease	NA	NA	NA	NA
WP_000732577.1\|4505858_4506776_-	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029437283.1\|4507108_4508071_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	2.7e-13	26.2
WP_000235471.1\|4508266_4508635_-	hypothetical protein	NA	NA	NA	NA
WP_000276020.1\|4508825_4509056_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_029437284.1\|4509292_4509808_+	hypothetical protein	NA	NA	NA	NA
WP_029437285.1\|4509828_4510278_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_16

5509520 : 5588856

Bacillus_phage(76.0%)

capsid,portal,plate,terminase,protease,integrase,transposase,bacteriocin

attL 5526756:5526773|attR 5554401:5554418

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029437993.1\|5509520_5511407_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.9e-87	34.3
WP_029437994.1\|5511613_5512723_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	2.1e-142	76.2
WP_029437995.1\|5513148_5513493_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	7.7e-19	42.9
WP_029437996.1\|5514017_5515157_+	hypothetical protein	H0UST6	Bacillus_phage	8.4e-62	37.1
WP_162901155.1\|5515160_5515298_+	hypothetical protein	NA	NA	NA	NA
WP_155417052.1\|5515447_5515600_+	hypothetical protein	A0A0A7AQZ6	Bacillus_phage	5.2e-12	74.0
WP_029437997.1\|5515606_5515954_-	helix-turn-helix transcriptional regulator	A0A0A7AR52	Bacillus_phage	4.2e-49	91.3
WP_033694466.1\|5516129_5516348_+	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	4.7e-30	90.3
WP_029437999.1\|5516406_5517081_+	hypothetical protein	A0A288WFT2	Bacillus_phage	4.0e-59	52.2
WP_029438000.1\|5517118_5517394_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	2.1e-35	86.5
WP_033694467.1\|5517429_5517594_+	hypothetical protein	A0A0U3B230	Bacillus_phage	7.2e-15	70.4
WP_033694468.1\|5517623_5517800_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	2.7e-20	79.3
WP_029438001.1\|5517804_5518554_+	DnaD domain protein	A0A1B0T6C0	Bacillus_phage	3.8e-71	77.9
WP_029438002.1\|5518492_5519368_+	ATP-binding protein	Q2I8C8	Bacillus_phage	2.6e-63	45.5
WP_029438003.1\|5519383_5519578_+	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.8e-20	78.1
WP_000805170.1\|5519603_5519777_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	2.6e-23	91.2
WP_029438004.1\|5519791_5520046_+	hypothetical protein	A0A1B0T6B9	Bacillus_phage	1.1e-35	85.7
WP_029438005.1\|5520545_5520737_+	hypothetical protein	A0A1B0T6B5	Bacillus_phage	6.2e-26	92.1
WP_029438006.1\|5520795_5521014_+	hypothetical protein	NA	NA	NA	NA
WP_029438007.1\|5521190_5522420_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.0e-84	48.8
WP_029438008.1\|5522790_5523366_+	hypothetical protein	A0A219UQR9	Bacillus_phage	3.7e-13	34.7
WP_029438009.1\|5523410_5523656_+	hypothetical protein	A0A0S2MVC7	Bacillus_phage	1.6e-18	58.0
WP_000220910.1\|5523706_5523898_+	hypothetical protein	NA	NA	NA	NA
WP_029438010.1\|5523939_5524242_+	hypothetical protein	Q3HKX6	Bacillus_phage	2.2e-33	73.0
WP_118991858.1\|5524305_5524404_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_029438011.1\|5524424_5524607_+	hypothetical protein	NA	NA	NA	NA
WP_029437265.1\|5524792_5525986_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
WP_000866511.1\|5526281_5526452_+	hypothetical protein	NA	NA	NA	NA
WP_029438012.1\|5526475_5526946_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	4.6e-54	67.7
5526756:5526773	attL	NA	NA	NA	NA
WP_001028518.1\|5526942_5527485_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P746	Bacillus_phage	4.2e-96	99.4
WP_029437241.1\|5528088_5528301_+	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	2.2e-08	39.1
WP_050587850.1\|5528502_5528736_+	hypothetical protein	NA	NA	NA	NA
WP_029437243.1\|5528749_5529067_+	hypothetical protein	Q2I8B8	Bacillus_phage	2.3e-09	55.1
WP_029437244.1\|5529068_5529410_+	hypothetical protein	A0A1B1P7D2	Bacillus_phage	9.7e-06	35.2
WP_029437245.1\|5529420_5529732_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-33	68.0
WP_029437246.1\|5529735_5530035_+	hypothetical protein	NA	NA	NA	NA
WP_029440482.1\|5530141_5530462_+	hypothetical protein	A0A1B1P762	Bacillus_phage	4.2e-43	85.8
WP_118991719.1\|5530445_5532128_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	9.3e-312	94.3
WP_118991720.1\|5532142_5533300_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	3.3e-207	93.4
WP_029437250.1\|5533396_5534515_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_118991721.1\|5534865_5535585_+\|protease	Clp protease ClpP	A0A2H4JC91	uncultured_Caudovirales_phage	7.7e-53	49.4
WP_029440480.1\|5535626_5536790_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.3e-86	44.1
WP_029440479.1\|5536804_5537029_+	hypothetical protein	NA	NA	NA	NA
WP_029440478.1\|5537038_5537338_+	hypothetical protein	A0A1B1P751	Bacillus_phage	2.1e-41	87.6
WP_029440477.1\|5537318_5537717_+	hypothetical protein	A0A1B1P760	Bacillus_phage	3.9e-46	77.1
WP_033694907.1\|5537691_5538069_+	hypothetical protein	A0A1B1P759	Bacillus_phage	2.8e-46	72.8
WP_029440475.1\|5538055_5538484_+	hypothetical protein	A0A1B1P769	Bacillus_phage	2.3e-73	97.9
WP_029440474.1\|5538484_5539072_+	hypothetical protein	A0A1B1P778	Bacillus_phage	1.3e-95	86.6
WP_029440473.1\|5539145_5539607_+	hypothetical protein	A0A1B1P772	Bacillus_phage	2.1e-75	94.1
WP_029440472.1\|5539785_5541618_+	hypothetical protein	A0A1B1P775	Bacillus_phage	6.0e-134	98.9
WP_118991722.1\|5543192_5544596_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029437180.1\|5546098_5547976_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-20	24.2
WP_118991723.1\|5548107_5549742_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	3.8e-63	33.6
WP_118991859.1\|5550329_5551052_+	hypothetical protein	NA	NA	NA	NA
WP_029437178.1\|5551357_5551543_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_023523669.1\|5551664_5551946_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	4.0e-13	67.2
WP_029437177.1\|5551967_5552201_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_029437176.1\|5552253_5552532_-	HU family DNA-binding protein	A3E2K9	Sodalis_phage	1.9e-20	57.3
WP_029437794.1\|5552891_5554307_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_118991724.1\|5554825_5572945_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	4.8e-159	26.8
5554401:5554418	attR	NA	NA	NA	NA
WP_029440341.1\|5573290_5574016_+	thioesterase	NA	NA	NA	NA
WP_029440340.1\|5574176_5575304_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_029440339.1\|5576270_5576978_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_158001559.1\|5577188_5577470_-	hypothetical protein	NA	NA	NA	NA
WP_029440338.1\|5577829_5578570_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.5e-38	41.2
WP_118991843.1\|5578662_5579856_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_118991844.1\|5580263_5581457_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029440625.1\|5583467_5584154_+	hypothetical protein	A0A2H4J851	uncultured_Caudovirales_phage	2.0e-82	62.3
WP_029440626.1\|5584150_5586766_+	hypothetical protein	A0A2H4JFY7	uncultured_Caudovirales_phage	5.3e-277	52.2
WP_029440627.1\|5586755_5588480_+\|plate	BppU family phage baseplate upper protein	A0A2H4J855	uncultured_Caudovirales_phage	2.0e-38	54.0
WP_000389067.1\|5588625_5588856_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	5.3e-32	93.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041074

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17109 : 69339

Streptococcus_phage(71.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029440585.1\|17109_18303_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8
WP_118991976.1\|18598_21109_+	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_002192128.1\|21209_21551_+	hypothetical protein	NA	NA	NA	NA
WP_002170075.1\|21565_21934_+	hypothetical protein	NA	NA	NA	NA
WP_118991975.1\|21935_22649_+	hypothetical protein	NA	NA	NA	NA
WP_118991974.1\|22623_24561_+	hypothetical protein	NA	NA	NA	NA
WP_118991973.1\|24560_25640_+	hypothetical protein	A0A1S5SEZ8	Streptococcus_phage	1.6e-41	34.4
WP_118991971.1\|25924_26491_+	hypothetical protein	NA	NA	NA	NA
WP_118991970.1\|26494_27169_+	hypothetical protein	NA	NA	NA	NA
WP_118991969.1\|27183_28188_+	hypothetical protein	NA	NA	NA	NA
WP_118991968.1\|28189_29500_+	hypothetical protein	NA	NA	NA	NA
WP_118991658.1\|31516_32306_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029439035.1\|32991_33411_+	hypothetical protein	NA	NA	NA	NA
WP_162901182.1\|33411_33585_+	hypothetical protein	NA	NA	NA	NA
WP_002170063.1\|33768_33942_-	ribbon-helix-helix domain-containing protein	B5LPT4	Bacillus_virus	8.4e-06	50.9
WP_118991967.1\|34079_34613_+	hypothetical protein	NA	NA	NA	NA
WP_098778602.1\|34631_35120_+	hypothetical protein	NA	NA	NA	NA
WP_118991966.1\|35168_37376_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-69	36.8
WP_029439033.1\|37436_37877_+	hypothetical protein	NA	NA	NA	NA
WP_118991965.1\|38006_38714_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.1e-38	43.4
WP_029438007.1\|41689_42919_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.0e-84	48.8
WP_162901181.1\|43052_43361_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_167506400.1\|43914_44058_-\|transposase	transposase	NA	NA	NA	NA
WP_140611926.1\|44054_44300_-\|transposase	transposase	NA	NA	NA	NA
WP_162901180.1\|44320_44488_+	hypothetical protein	NA	NA	NA	NA
WP_118991962.1\|44484_45756_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_029437170.1\|45870_47283_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_118991961.1\|47654_49352_+	DUF2334 domain-containing protein	NA	NA	NA	NA
WP_086390279.1\|52318_52705_-	hypothetical protein	NA	NA	NA	NA
WP_086390280.1\|52718_52925_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_118991959.1\|53206_54637_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_118991958.1\|56046_59826_+	hypothetical protein	NA	NA	NA	NA
WP_118991957.1\|62844_63726_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_118991956.1\|63805_64141_-	hypothetical protein	NA	NA	NA	NA
WP_050001586.1\|64228_64438_-	hypothetical protein	NA	NA	NA	NA
WP_118991892.1\|65306_66014_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
WP_029440413.1\|66366_67053_-	hypothetical protein	NA	NA	NA	NA
WP_029440412.1\|67161_67467_-	hypothetical protein	NA	NA	NA	NA
WP_118991893.1\|67862_68231_+	hypothetical protein	NA	NA	NA	NA
WP_118991658.1\|68549_69339_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

80021 : 148002

Streptococcus_phage(53.33%)

bacteriocin,transposase,integrase,tRNA

attL 68538:68597|attR 95775:96627

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
68538:68597	attL	NA	NA	NA	NA
WP_029440407.1\|80021_81182_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_029440406.1\|81699_81897_+	hypothetical protein	NA	NA	NA	NA
WP_118991894.1\|82163_82493_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	1.1e-09	36.6
WP_118991895.1\|82527_83235_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-38	39.5
WP_029440405.1\|83838_84039_+	hypothetical protein	NA	NA	NA	NA
WP_029440404.1\|84071_85034_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_029440403.1\|85409_86303_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_158001565.1\|86965_87253_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_118991891.1\|87364_88072_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-38	39.5
WP_118991896.1\|88137_88515_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.0e-27	57.0
WP_029438007.1\|89607_90837_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.0e-84	48.8
WP_033694859.1\|91315_91567_-	hypothetical protein	NA	NA	NA	NA
WP_029437142.1\|93102_94209_-	hypothetical protein	NA	NA	NA	NA
WP_158001543.1\|94198_94669_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_029440399.1\|94956_95208_-	hypothetical protein	NA	NA	NA	NA
WP_118991658.1\|95786_96576_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029440398.1\|97056_97299_-	hypothetical protein	NA	NA	NA	NA
95775:96627	attR	NA	NA	NA	NA
WP_029440397.1\|97405_97651_-	hypothetical protein	NA	NA	NA	NA
WP_033694857.1\|97698_98235_-	hypothetical protein	NA	NA	NA	NA
WP_029437170.1\|98888_100301_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029440394.1\|101172_102372_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_029440393.1\|102368_103049_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.1e-36	40.1
WP_118991899.1\|103045_104239_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_016106960.1\|104575_104899_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_118991900.1\|104983_106690_+	hypothetical protein	NA	NA	NA	NA
WP_029440391.1\|106694_107204_+	stage II sporulation protein M	NA	NA	NA	NA
WP_030030022.1\|107217_107766_+	hypothetical protein	NA	NA	NA	NA
WP_029440390.1\|107755_108394_+	ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	5.5e-10	26.4
WP_162901171.1\|108407_108584_+	hypothetical protein	NA	NA	NA	NA
WP_029440389.1\|109134_109410_-	hypothetical protein	NA	NA	NA	NA
WP_118991901.1\|109428_110106_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	6.0e-15	30.5
WP_016122923.1\|110402_110702_+	hypothetical protein	NA	NA	NA	NA
WP_029440387.1\|110811_111144_+	hypothetical protein	NA	NA	NA	NA
WP_029440386.1\|111353_111947_+	cell division protein FtsN	NA	NA	NA	NA
WP_002204993.1\|112080_112272_-	hypothetical protein	NA	NA	NA	NA
WP_016122926.1\|112497_112731_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_029440385.1\|112752_113034_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.1e-10	59.0
WP_029440384.1\|113159_113465_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029440383.1\|113580_114165_-	hypothetical protein	NA	NA	NA	NA
WP_118991890.1\|114884_115592_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5
WP_118991658.1\|116224_117014_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_134981305.1\|117750_118419_-	hypothetical protein	NA	NA	NA	NA
WP_118991659.1\|120121_120911_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029440378.1\|121641_122343_-	ADP-ribosyltransferase	Q331X8	Clostridium_botulinum_C_phage	4.9e-28	35.3
WP_118991903.1\|122536_125137_-	iota toxin protein Ib	A0A1V0E026	Clostridioides_phage	1.6e-140	39.3
WP_029440375.1\|125544_125781_-	hypothetical protein	NA	NA	NA	NA
WP_118991658.1\|133544_134333_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_118991890.1\|134527_135235_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5
WP_029440374.1\|135688_137680_-	hypothetical protein	NA	NA	NA	NA
WP_118991904.1\|138268_138976_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.6e-37	39.0
WP_029440373.1\|139641_141144_-	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_140611931.1\|141390_141576_-	hypothetical protein	NA	NA	NA	NA
WP_029440372.1\|141743_144074_-	hypothetical protein	NA	NA	NA	NA
WP_118991905.1\|144448_145156_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5
WP_029440369.1\|146389_147289_+	kinase	NA	NA	NA	NA
WP_029440368.1\|147303_148002_+\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP041075

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3206 : 78716

Bacillus_phage(40.0%)

transposase,integrase

attL 12121:12139|attR 76211:76229

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_118991922.1\|3206_3896_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.4e-69	58.7
WP_000070738.1\|5524_6412_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_118991921.1\|7071_7779_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
WP_029441165.1\|9024_10461_-\|transposase	IS4 family transposase	NA	NA	NA	NA
12121:12139	attL	NA	NA	NA	NA
WP_118991920.1\|12582_13356_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-32	36.8
WP_029441164.1\|13330_15301_+	ABC transporter permease	NA	NA	NA	NA
WP_029441162.1\|15820_16087_-	hypothetical protein	NA	NA	NA	NA
WP_029441161.1\|16100_16292_-	hypothetical protein	NA	NA	NA	NA
WP_029441160.1\|16509_17403_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_118991950.1\|17848_18490_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	2.2e-14	33.2
WP_167506401.1\|18647_18785_+	hypothetical protein	NA	NA	NA	NA
WP_029440404.1\|18817_19780_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_118991949.1\|20158_21052_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_029437250.1\|21446_22565_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_118991948.1\|22915_24280_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029439084.1\|25561_25858_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_029439083.1\|26659_28894_-	hypothetical protein	NA	NA	NA	NA
WP_029439082.1\|29260_29767_+	helix-turn-helix domain-containing protein	A0A1B1P776	Bacillus_phage	2.4e-29	46.8
WP_118991947.1\|29664_30045_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.3e-16	58.8
WP_140611939.1\|31220_31448_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_029437398.1\|31486_31774_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	9.0e-05	37.5
WP_118991944.1\|32036_33107_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_029441152.1\|33113_34082_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_029441153.1\|34068_34665_-	hypothetical protein	NA	NA	NA	NA
WP_029441154.1\|34661_35405_-	amino acid racemase	NA	NA	NA	NA
WP_029441155.1\|35420_36332_-	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_140611944.1\|36623_37244_-	hypothetical protein	NA	NA	NA	NA
WP_029441157.1\|37573_37843_+\|transposase	transposase	NA	NA	NA	NA
WP_118991927.1\|38500_39208_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5
WP_167506404.1\|40146_42054_-	collagen-like triple helix repeat-containing protein	NA	NA	NA	NA
WP_118991943.1\|42627_43335_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
WP_118991658.1\|44592_45381_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_033694890.1\|46802_47876_+	hypothetical protein	NA	NA	NA	NA
WP_029440438.1\|48077_48947_+	ETX/MTX2 family pore-forming toxin	NA	NA	NA	NA
WP_029440439.1\|49362_50184_+	ETX/MTX2 family pore-forming toxin	NA	NA	NA	NA
WP_118991941.1\|50728_50944_-	hypothetical protein	NA	NA	NA	NA
WP_118991955.1\|51233_52580_-	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_118991940.1\|52911_54000_-	glycosyltransferase family 2 protein	A0A2K9L5M2	Tupanvirus	6.9e-13	22.1
WP_118991939.1\|54325_55636_-	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_029437250.1\|56941_58060_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_033694759.1\|58410_58647_+	hypothetical protein	NA	NA	NA	NA
WP_029437142.1\|59267_60374_-	hypothetical protein	NA	NA	NA	NA
WP_158001543.1\|60363_60834_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_033694744.1\|61768_62788_+	zinc-ribbon domain-containing protein	A0A1B1P7Q7	Bacillus_phage	2.5e-134	62.2
WP_029439513.1\|62897_63851_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_029439512.1\|64101_64983_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_029439511.1\|66032_66455_+	hypothetical protein	NA	NA	NA	NA
WP_029439510.1\|66567_66840_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.8e-23	65.6
WP_029439509.1\|66901_67180_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	6.0e-14	68.9
WP_029439508.1\|67557_67800_-	hypothetical protein	NA	NA	NA	NA
WP_029439506.1\|68531_70394_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.3e-31	30.2
WP_002205092.1\|71220_71460_-	hypothetical protein	NA	NA	NA	NA
WP_029437120.1\|71706_71895_-	hypothetical protein	NA	NA	NA	NA
WP_029437121.1\|72212_72875_-	restriction endonuclease	NA	NA	NA	NA
WP_029440585.1\|73171_74365_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8
WP_118991938.1\|74425_75445_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_029437205.1\|77303_78716_-\|transposase	IS66 family transposase	NA	NA	NA	NA
76211:76229	attR	NA	NA	NA	NA

DBSCAN-SWA_2

101938 : 150643

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158001543.1\|101938_102409_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_029437142.1\|102398_103505_+	hypothetical protein	NA	NA	NA	NA
WP_134981243.1\|103584_103914_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_118991931.1\|103923_105036_-	hypothetical protein	NA	NA	NA	NA
WP_029437145.1\|105049_106138_-	hypothetical protein	NA	NA	NA	NA
WP_029437146.1\|106234_106528_-	hypothetical protein	NA	NA	NA	NA
WP_029437147.1\|106553_106793_-	hypothetical protein	NA	NA	NA	NA
WP_029437148.1\|106818_107268_-	hypothetical protein	NA	NA	NA	NA
WP_002187991.1\|107854_108103_-	hypothetical protein	NA	NA	NA	NA
WP_029437149.1\|108251_108827_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_029437150.1\|108869_109388_-	hypothetical protein	NA	NA	NA	NA
WP_162901172.1\|109412_109559_-	hypothetical protein	NA	NA	NA	NA
WP_118991658.1\|111176_111965_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_029437152.1\|112848_113052_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029437153.1\|113255_113753_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_097984829.1\|114097_115042_+	Replicase RepFR55	NA	NA	NA	NA
WP_029437155.1\|115687_116242_+	DUF3967 domain-containing protein	NA	NA	NA	NA
WP_029437156.1\|116470_117661_+	ParM/StbA family protein	NA	NA	NA	NA
WP_029437157.1\|117667_118108_+	hypothetical protein	NA	NA	NA	NA
WP_086413261.1\|118601_118739_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_118991930.1\|118740_119835_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	3.5e-81	45.8
WP_029437159.1\|120268_120565_+	hypothetical protein	H0USY0	Bacillus_phage	2.2e-14	45.5
WP_029437160.1\|120566_120752_+	hypothetical protein	NA	NA	NA	NA
WP_029437161.1\|120852_122034_+	cell division protein FtsK	H0USY1	Bacillus_phage	4.0e-123	56.2
WP_029437162.1\|121972_122587_+	hypothetical protein	H0USY2	Bacillus_phage	8.1e-43	45.1
WP_000118337.1\|122588_122813_-	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	6.8e-16	50.6
WP_029437163.1\|123326_123575_+	DNA-binding protein	A0A2H4JDR0	uncultured_Caudovirales_phage	2.7e-13	46.1
WP_029437164.1\|123667_123904_+	hypothetical protein	NA	NA	NA	NA
WP_118991954.1\|124935_125163_+	DUF2187 family protein	NA	NA	NA	NA
WP_162901177.1\|125144_125315_+	hypothetical protein	NA	NA	NA	NA
WP_029437166.1\|125317_125614_+	hypothetical protein	NA	NA	NA	NA
WP_029437167.1\|125658_125883_+	hypothetical protein	NA	NA	NA	NA
WP_029437168.1\|126066_127179_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	1.4e-80	49.1
WP_162901176.1\|127413_127563_+	hypothetical protein	NA	NA	NA	NA
WP_029437169.1\|127613_128699_+	hypothetical protein	NA	NA	NA	NA
WP_029437170.1\|129009_130422_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029437171.1\|130478_130952_-	hypothetical protein	NA	NA	NA	NA
WP_029437172.1\|131185_131761_-	hypothetical protein	NA	NA	NA	NA
WP_118991929.1\|131892_132387_-	hypothetical protein	NA	NA	NA	NA
WP_029437170.1\|132466_133879_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_029437183.1\|134352_134955_-	recombinase family protein	I1ZBD6	Salisaeta_icosahedral_phage	1.7e-08	26.1
WP_118991928.1\|135227_142835_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	9.4e-141	26.1
WP_118991927.1\|143156_143864_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5
WP_029437184.1\|144089_144425_+	hypothetical protein	NA	NA	NA	NA
WP_050587816.1\|146535_147066_+	signal peptidase I	NA	NA	NA	NA
WP_029437187.1\|147636_147918_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P791	Bacillus_phage	8.3e-11	31.4
WP_029437188.1\|147939_148173_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_016099605.1\|148225_148504_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	7.4e-20	60.7
WP_016099606.1\|148618_148909_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016099607.1\|148978_149287_+	hypothetical protein	NA	NA	NA	NA
WP_118991926.1\|149725_150643_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041071

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP041074

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP041075

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection