CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041237	Pandoraea pnomenusa strain M202 chromosome, complete genome	1 crisprs	RT,csa3,DEDDh,DinG,cas3,WYL,cas4	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041237_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041237_1

3751326-3751403

Orphan

Consensus_repeat	Method
CCGCCCTCCCCGGTTCGCACCTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041237_1

>merge|NZ_CP041237|1|3751326-3751403|CRISPRCasFinder
CCGCCCTCCCCGGTTCGCACCTCAGTGGTAAATCAAATCAAGTCGTTCAATTTCCGCCCTCCCCGGTTCTCACCTCAG

>NZ_CP041237|1|1|3751326-3751403|CRISPRCasFinder
CCGCCCTCCCCGGTTCGCACCTCAG	TGGTAAATCAAATCAAGTCGTTCAATTT
CCGCCCTCCCCGGTTCTCACCTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041237.1\|WP_023871889.1\|3760532_3762005_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP041237.1\|WP_023595022.1\|3762070_3762742_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225222
NZ_CP041237.1\|WP_023871886.1\|3756430_3757060_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP041237.1\|WP_115344554.1\|3742003_3743116_+\|transglutaminase-domain-containing-protein	unknown	unknown	gnl\|CDD\|376628
NZ_CP041237.1\|WP_023871890.1\|3762853_3763171_-\|YnfA-family-protein	unknown	unknown	gnl\|CDD\|235016
NZ_CP041237.1\|WP_141572107.1\|3748378_3749188_+\|DUF3047-domain-containing-protein	unknown	unknown	gnl\|CDD\|378613
NZ_CP041237.1\|WP_023871891.1\|3763256_3763460_+\|SlyX	unknown	unknown	gnl\|CDD\|179824
NZ_CP041237.1\|WP_081326997.1\|3759396_3760536_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176161
NZ_CP041237.1\|WP_048806409.1\|3743233_3743842_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP041237.1\|WP_023595034.1\|3747680_3748307_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP041237.1\|WP_025250505.1\|3745063_3745612_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
NZ_CP041237.1\|WP_023871877.1\|3743874_3744798_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176142
NZ_CP041237.1\|WP_080685338.1\|3763600_3764269_+\|DUF1439-domain-containing-protein	unknown	unknown	gnl\|CDD\|377799
NZ_CP041237.1\|WP_023595041.1\|3740778_3741858_-\|selenide,-water-dikinase-SelD	unknown	unknown	gnl\|CDD\|234870
NZ_CP041237.1\|WP_023595026.1\|3757328_3757793_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP041237.1\|WP_141572105.1\|3746166_3747528_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041237.1\|WP_023595032.1\|3749464_3751249_+\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|223839
NZ_CP041237.1\|WP_025250502.1\|3754858_3755920_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP041237.1\|WP_023871884.1\|3752863_3754843_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP041237.1\|WP_023871879.1\|3745608_3746139_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780

Protein	Function_ID	Function_description	E-value
NZ_CP041237.1\|WP_023871889.1\|3760532_3762005_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.63444e-25
NZ_CP041237.1\|WP_023595022.1\|3762070_3762742_+\|transcriptional-regulator	gnl\|CDD\|225222	COG2345, COG2345, Predicted transcriptional regulator [Transcription].	2.01422e-49
NZ_CP041237.1\|WP_023871886.1\|3756430_3757060_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.99832e-39
NZ_CP041237.1\|WP_115344554.1\|3742003_3743116_+\|transglutaminase-domain-containing-protein	gnl\|CDD\|376628	pfam01841, Transglut_core, Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.	3.79764e-24
NZ_CP041237.1\|WP_023871890.1\|3762853_3763171_-\|YnfA-family-protein	gnl\|CDD\|235016	PRK02237, PRK02237, YnfA family protein.	3.73194e-44
NZ_CP041237.1\|WP_141572107.1\|3748378_3749188_+\|DUF3047-domain-containing-protein	gnl\|CDD\|378613	pfam11249, DUF3047, Protein of unknown function (DUF3047). This bacterial family of proteins has no known function.	2.44392e-85
NZ_CP041237.1\|WP_023871891.1\|3763256_3763460_+\|SlyX	gnl\|CDD\|179824	PRK04325, PRK04325, hypothetical protein; Provisional.	1.23891e-22
NZ_CP041237.1\|WP_081326997.1\|3759396_3760536_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176161	cd08472, PBP2_CrgA_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.82768e-63
NZ_CP041237.1\|WP_048806409.1\|3743233_3743842_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.22431e-42
NZ_CP041237.1\|WP_023595034.1\|3747680_3748307_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.69632e-46
NZ_CP041237.1\|WP_025250505.1\|3745063_3745612_+\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	2.63417e-33
NZ_CP041237.1\|WP_023871877.1\|3743874_3744798_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176142	cd08451, PBP2_BudR, The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.17739e-78
NZ_CP041237.1\|WP_080685338.1\|3763600_3764269_+\|DUF1439-domain-containing-protein	gnl\|CDD\|377799	pfam07273, DUF1439, Protein of unknown function (DUF1439). This family consists of several hypothetical bacterial proteins of around 190 residues in length. Several members of this family are annotated as being putative lipoproteins and are often known as YceB. The function of this family is unknown.	2.52483e-12
NZ_CP041237.1\|WP_023595041.1\|3740778_3741858_-\|selenide,-water-dikinase-SelD	gnl\|CDD\|234870	PRK00943, PRK00943, selenide, water dikinase SelD.	0
NZ_CP041237.1\|WP_023595026.1\|3757328_3757793_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.0362e-44
NZ_CP041237.1\|WP_025250502.1\|3754858_3755920_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	1.52656e-144
NZ_CP041237.1\|WP_023595032.1\|3749464_3751249_+\|penicillin-binding-protein-2	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	5.22401e-158
NZ_CP041237.1\|WP_023871884.1\|3752863_3754843_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP041237.1\|WP_023871879.1\|3745608_3746139_+\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	4.64309e-30

>NZ_CP041237.1|WP_023595032.1|3749464_3751249_+|penicillin-binding-protein-2
MQKNRQPKDVTFASSPVLQSRTSLWRSKLVVIGITLAFIGLVVRAFWIAGPGNGFYIAQGEKRYEHTIVMPAVRGKIEDRDGRVLATSLPMRTVWAVPAEVPDDLSDSDIRKASKLLDIPPKELRTKLIGEKKFVYVKRQVSPEIGKQVEALGIPGVYESSEYKRFYPEGEVAAHVVGFTNVEDKGQEGMELGEESLLEGTAGVRRVIKDRIGRTIQDLDDSSPPRDGKDIRLTLDTRVQYIAYEALKNALDRTGAKAAMAVVIDAKSGQVLALANLPTYNPNDREHLTGEQLRNRVFTDVFEPGSILKPFTMALALDLHRLTPSTLIDTGPGRYVFEGATISDDSANGVLTAAGVIQKSSNIGMTKVSTMLRAEEMWDMFTEIGLGQQPKLGFPGAVSGRLRPYKSWRRIEQATMAYGYGISASLFQLARAYTIFANDGVLVPISIIKPDTPVQPEGVRVIDARTAAEMRKMLAGVVDTGGTATTAQVAGYSIGGKTGTAYKAGAHGYDHSKYRASFVGIAPLSAPRLVIAVSVDEPKASQHFGGQAAGPAFAEIASQALPLLGIRPDLPVRPGVILAAPTSDSPPDDKGAHG
>NZ_CP041237.1|WP_141572107.1|3748378_3749188_+|DUF3047-domain-containing-protein
MPRIVSPLRSVRSPNVPSLRVLGAAACLIAGLGPVDPVFAADAAAPPPPAVAAVAFSRAAPGSTSLAGWRNLPVVSGKKLTTYTVVADGRSNVVEANAADSASALMAKGDRIDLGATPVVTWRWKVDNAIPGADNRVADKEDSPARLVFFFDGDKSKLPFGDRATMTLAKAGGEDLPYATLMYIWSNDAVPGGVIQNPHTDRVQMLVVAGGDASLGKWQTFSRNLAADYERVFREKPGRLLGYGVFTDSDNTHASAHAWYGDVRFGAEK
>NZ_CP041237.1|WP_023595034.1|3747680_3748307_+|LysE-family-translocator
MPTLATLATFVVVVLGLFLIPGPAVLLTITRTVQGGRRAGVMTGVGIALGDLVHTLCAAVGLSAVLMTSALAFDVVKYVGAAYLIYLGIKALREPPSDPQLPAAPRVSPGRAFVQAVATEVLNPKTALFFLAFMPQFVHAHEGNVFLQFLVLGMVFVAMSALYTAAIALSVRPLGRFVKRFTWLLRWQGKIIGSLFIGLGLRVAMQQR
>NZ_CP041237.1|WP_141572105.1|3746166_3747528_-|hypothetical-protein
MPMTCAGPAINPTVPPANTFLQLGMRVVTCVRDGFRDDFAGMTACLRESGWRCLLDEAWHNASERFRVRGVTLPEAADVTFACAASILAIGATCRYLWPELRALERAIAEGDGAQREWALQTDAQLRRRTLADVTAMRQCMAAFEATEADANAANTTNAGVSARDHDRMSPTSRRRLAEMRISEALVLHVADAPQCSLAQSDRVAGLCQLLAHGLGFRLPAARLRTLHVSDARPSLIRFDEAFALLRERLEPDWRRDTPGAPTFCVHPIDVQLFDPAETTDDLRADVRDARRLLTHPEALRRVRSRVVALIAASVREDCGGTGDWRALAERALRTAAQLGMTCGRVLGALGIATRSGVSARAAWRWSDEVPMAPGRHPAPAIEADVAQWVARTMLLAGKTACPPRLAALARGDTPASLVIGSAAWTDLVDGIAVLGREHWRVAYAQVCGVGRA
>NZ_CP041237.1|WP_023871879.1|3745608_3746139_+|chromate-transporter
MTGTLISLAVIFTQLSVLAFGGGNTILPEMERQVVDVHHWMTSEAFSALFALGQAAPGPNLMIVTLVGWHVAGWQGMLVTSIAKFGPSSLITVGVLHLWERFKDRPWRRIVQAGLVPMTAGLVAASAALIAQASATSWLLAGITASVAVLAIRTRVHPLWWLAAGSVAGLLGGAYL
>NZ_CP041237.1|WP_025250505.1|3745063_3745612_+|chromate-transporter
MPGDTRPAPSVRALFLGFLGLGMTAFGGALPLARRMVVEKHRWLTPAEFTDLLGLCQFLPGGNIINLSVALGMRFHGWRGALASILGLIAAPSAVVILLGMIYQHFQNDPHVKHLFAGLAAAAAGLLIQMAWKVSWPLRKSMVLGAVALACFIAIAVLRVPLVLTMAVMTPISIYATWRVSQ
>NZ_CP041237.1|WP_023871877.1|3743874_3744798_-|LysR-family-transcriptional-regulator
MANIDVRLLRYFIAVAETGHMTRAAERLGIGQPPLSQQIRVLETQLGVTLFERLPRGMALTDAGQAFLADAYEVVRKLDQAVDDVRRVAAGVKGRLSVGFTSSAALHPFVPTVIRAFRADAPSVSLMLDEASTSELLDSLRDGQLDVAFIRQPQGDTGQITFVPVLEEPMVLAAPSAHPLALTGRAGKAVVPMTAIAAEKLILYRRRTGQGLYDAIIAACHGAGFSPNIEQEAPRLLTTLSLVAAGLGVSVVPASLMRMQVEGIVYRPLAPPPRAPLYCAYREGVLAGPTARLLDHVHVAARSVAPE
>NZ_CP041237.1|WP_048806409.1|3743233_3743842_+|TlpA-family-protein-disulfide-reductase
MQRRHFLHTMGAIGAAGAVGAIGGMSAPTMAAGPSKGTAQVDDSVLAGTSGGTLSAWRGATPAFSLPALDGTTHASSAWRGRVVILNFWATWCAPCREEIPAMGAVARQYRERGLMLVAVNYKEPPATVKPFVDKVPIDGTVLLDIDGAVYKRFGPIGLPATYLIDRAGNARFWRMGELEWSDIGLHGHIETLLAQKGGTSA
>NZ_CP041237.1|WP_115344554.1|3742003_3743116_+|transglutaminase-domain-containing-protein
MPASLLTSSLLPVQAHASPRAASPHDAADGWRTFELTTQVDLPAAAAGGGPARVWLPVATSPGGGYQQALGTRWEAPGAKAELRMVRGAAGVGVPMLAVAWPDATQARTVTLVNTFATRDRRVDLSQPPSADAPKEAPAVLRQYLQPTTLQPTDGLVRETAEKITRGQQGDVEKARAIYEWIVDNCRREGSVRGCGTGDVRYMLTTGNLAGKCADINALFTALARSVGIPARDAYGVRVAASQHGFNSLGKAGDVTRAQHCRAEFHAAGYGWVPVDPADVRKVVLEEVPGGLPLDDLRVRAARAMLFGQWEMNWVAFNHGADIALPGATRANREPVPFLMYPNGEVANARLDSLDPDTFRYRMSARELTA
>NZ_CP041237.1|WP_023595041.1|3740778_3741858_-|selenide,-water-dikinase-SelD
MTAIDATQAGATPAAPRLTSLSHGGGCGCKIAPGVLSELLARNDTPLPAPAALLVGTETSDDAAVYQLNDEQAIIATTDFFMPIVDDPYDFGRIAATNALSDIYAMGGKPIFALAIVGMPINVLPRETIRDILRGGESICAEAGIPIAGGHSIDSVEPIYGLAALGVVHPKRLKRNADAQAGDVLVLGKPLGVGVMSAALKKNQLDDAGYRLMIDATTRLNRVGPALAALPGVHALTDVTGFGLLGHTLEMCRGANLAAYLRMADVPLFDGVRELADKGCITGASGRNWASYGASVELGDRLTTRDRDLLCDPQTAGGLLVSCAPGAVDDVLAVFRADGFAEAGIVGAMRPGKPGVRVI
>NZ_CP041237.1|WP_023871884.1|3752863_3754843_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MFGKLTLEAIPYHEPIIVGAVGMMVLGGLGIIALLTYFGKWKYLWNEWVTSVDHKKIGVMYVLVALVMLLRGFADAMMMRTQLALAHNSPGILPPDHYDQIFTAHGVIMIFFVAMPFMTGLVNLVVPLQIGARDVAFPFLNTLSFWLFVAGAALVNLSLGVGEFARTGWLAYPPLSGIQYSPGVGVDYYIWALQISGLGTLLTGVNFVVTILKMRAPGMNLMKMPIFTWTSLCTMVLVCAAFPVLTVTLALLSLDRYLDFHFFTNELGGNPMMYINLIWIWGHPEVYILILPAFGIFSEIISTFSGKKLFGYKSMVYATAAIMVLSFLVWAHHFFTMGSGASVNAFFGIATMIISIPTGVKIFNWLFTMYRGRVQMTTPVLWTLGFIVTFVIGGMTGVLLAVPGADFVLHNSLFLIAHFHNVIIGGVLFGYIAGMNYWFPKAFGFKLDERLGKASFWCWLIGFYLAFMPLYVLGLMGMTRRLNHYSNPEWQPWLIAALIGALFIAAGIGFQVLQLVVSIKNRKALADTTGDPWNGRTLEWMTSSPPQFYNFAEEPRVHDVDELAYRKEHGIKGDLKTSYAPIHMPKNTGAGFIISAFSLVFGFAAIWHIWWLAIVGFVGMIVTFICRSNNDSIDYYVQSPEVVAIETAHHQALAAAAKA
>NZ_CP041237.1|WP_025250502.1|3754858_3755920_-|ubiquinol-oxidase-subunit-II
MKKHRNPRLFRLLALCSPLILAGCDMTLLDPKGQIGVENKNLILTATWLMLIVVIPVILMTLWFAWKYRATNKSARYEPNWSHSTAIEVVVWLVPIIIIAILARITWVSTHELDPYKPLESEVKPITVEVVSMNYKWLFIYPEQGIASINELAVPVDTPVNFKITSESIMNSFFIPQLGSMVYTMAGMETKLHLIANHVGEYDGISANYSGGGFSGMRFKTLAMTDGDFQAWVTKVRESKKVLDKGTYASLVPMSENTPVTYYSSVDANMFQSIVHAPMASGMAQQQEGHENHGAMDMKGMDKKMEMKGAGTDAATAPAAAANVQNGQSMTMAMDNAGAHAMHAGAAAHAHKE
>NZ_CP041237.1|WP_023871886.1|3756430_3757060_-|LysE-family-translocator
MVSLQLLTVFIGALVVVYALPGPDMALVMQTSMTRGVRHGLATAGGLAMARAGHVTLSACGVAALLRAAPWLFETVRIVGAIYLAWVAIQIWRSPAFGIDAVAPSTDAPPPLSQAVRRGVLSSVLNPKALLFCSVLLPQFVRAEAGPVWSQVLELGVLLLVVGAIFDVTLAFGAARIARWLRTRPLAQKVQRWSFGAALMAFAVRLSLD
>NZ_CP041237.1|WP_023595026.1|3757328_3757793_+|Lrp/AsnC-family-transcriptional-regulator
MNELDAIDRAILAIVQRDGRISNARLAERVSLSETPCARRLKRLEAEGYITGYRAELSYRALGLGVTAFVHVRFAVHDRSLSEQFEREVQAIDRIVSCHNISGSADYLLGVVATDLDDYGMFTRDVLRALPGVSSIESMLSLREVKRDTGAPLL
>NZ_CP041237.1|WP_081326997.1|3759396_3760536_-|LysR-family-transcriptional-regulator
MIDRITAMRTFVRVAEVGSFTKAAASLDLPRATATTQVQHLERWFGVALFTRSTRRVALTMEGAAYYERCAAILADVEEVESGLFGAHVQLRGRLAVVLPPVIAREVVMPSLAEFQSRHPGLEIALDATPAHGDWRGDGVDCGVVLGELPDSRLVARHLGDLPRVTCASRRYLDVHGTPEDLDDLAMHTSVKWRSAPAESLTVPASPTSTPAADEAGTAGMTLATPTTRCGDLMLMVGSRATCVRTRGQLHVGDEAAYLAAGLEGLGLIQPTVLAAAPYLASGRLVPVLPNCPPPALRLSAAYPAQKRVSPRVRAFVDWLAQICEPLGHGGRGGAQASPRPAEPGVPAEPGVAGVVGVVALPLPEGKASSTRRSFTLPA
>NZ_CP041237.1|WP_023871889.1|3760532_3762005_-|MFS-transporter
MTTNTTNSGTPGWRDLLSGNNGWRSLALAGGVALHATNVYVSTTVLPSIVRDIGGLDLYAWNTTLFVVASILGSVLAATLMATFGPRIAYGMALLGFSAGTILCAAAPTMPWMLAGRTLQGFGGGILLSLSYALIRIVFVPSLWSRAMGLISGMWGVATLCGPALGGIFAQFGHWRWAFWSLLPVVVGLGLIIRVQVPAGRAMAAGAASPRSDEAQVIPWFKVILLCASAVAISLGAVVTSHPLAAAWMVAGLALVGWLAHRERSARHALPRLMPTGAYSLRTRLGGLYVAMGLLGLAMTSEIYIPYFLQTIHGQTPFAAGYLAALMAAGWSVGSMTSAGRQGDAAERCVRLGPVIVAIGMFALAWLLPQRSLFESTAGALSLGAALFGVGMGVGIGWPHLLTRVMTAARPGEAHLASASITTVQLYSMALGSALAGLVANSAGLADGALEAAQRASVWLFALFALAPAGAAIVASRGKAAARVSGQEAS
>NZ_CP041237.1|WP_023595022.1|3762070_3762742_+|transcriptional-regulator
MNYTNNHLDNRAVPSATGAGPERVLHWLKTQGPASTAEVAAALGITAEAARQQVQRLVSDGLLVGQTTPSRGAGRPRQTWMLTEAGHARFPDAHSHLTIQLIGSIRQLFGEDGLDRLITQRAADTRLHYKQAVDPLKGLQARLDKLAEIRSAEGYMARVERDGDDWLLIEDHCPICAAAKTCQGFCRTELELFQELIGERGTVSRETHILAGGQRCTYRVRTP
>NZ_CP041237.1|WP_023871890.1|3762853_3763171_-|YnfA-family-protein
MKTFALYVVTAVAEIVGCYLPWLWLRQDRSAWLLVPGAASLALFAWLLTLHPAAAGRVYAAYGGVYITVAIVWLWWVDGVRPTSWDMAGVTVALVGMGLIAFQPR
>NZ_CP041237.1|WP_023871891.1|3763256_3763460_+|SlyX
MEARIVELEIKTAFQEDLLETLNGIVTRQEQQIDLLQKQFKALYQQMLSQGPGGNDGNPRHEIPPHY
>NZ_CP041237.1|WP_080685338.1|3763600_3764269_+|DUF1439-domain-containing-protein
MTTRRPPSLPRSLPSPWLARATSPVEAEQLTASRREVLRIGLAGLLGLALASRMQRADAGYNIWTGEYTMTRKDIESAVDKRFPTTLNYGQLLTVELTHPQIGFNPQANRVNTQVDAQLKNILLQGQPLQGTLAISSALKYDPVRRAVLLDHPSVERVDVNGMPPAYGQQLTAIGGTVAQQVLDQYPIYTFRPEQLRYGGRDVEPGAITVLPDGIKVEVKTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

963015 : 1060448

Staphylococcus_prophage(18.75%)

integrase,transposase

attL 1028565:1028624|attR 1054300:1055621

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023593909.1\|963015_964554_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.2e-44	36.8
WP_076841690.1\|964749_964932_+	hypothetical protein	NA	NA	NA	NA
WP_004545551.1\|965075_965483_+	hypothetical protein	NA	NA	NA	NA
WP_141570870.1\|965638_966574_-	DNA adenine methylase	NA	NA	NA	NA
WP_141570872.1\|966602_968048_-	hypothetical protein	NA	NA	NA	NA
WP_141570874.1\|968280_968874_+	recombinase family protein	A0A219Y912	Aeromonas_phage	5.8e-22	38.0
WP_141570876.1\|969015_970250_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.0e-101	64.2
WP_141570878.1\|970391_970664_+	hypothetical protein	NA	NA	NA	NA
WP_141570880.1\|970958_973976_-	Reverse transcriptase	NA	NA	NA	NA
WP_081214897.1\|974836_975703_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_028731227.1\|975750_977076_+	MFS transporter	NA	NA	NA	NA
WP_141570882.1\|977172_978378_+	porin	NA	NA	NA	NA
WP_028731228.1\|978388_979273_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_028731229.1\|979240_980161_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_141570884.1\|980272_981664_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_028731230.1\|981729_982614_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023873208.1\|982746_983979_+	CoA transferase	NA	NA	NA	NA
WP_141570886.1\|983962_984820_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_038620036.1\|984858_986223_+	MFS transporter	NA	NA	NA	NA
WP_025249767.1\|986200_987079_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_025249766.1\|987189_988467_-	3-(3-hydroxy-phenyl)propionate transporter MhpT	NA	NA	NA	NA
WP_141570888.1\|988595_989381_-	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_141570890.1\|989396_990356_-	3-carboxyethylcatechol 2,3-dioxygenase	NA	NA	NA	NA
WP_141570892.1\|990359_992237_-	bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	NA	NA	NA	NA
WP_023873218.1\|992527_993343_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_023873219.1\|993512_994400_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025249762.1\|994528_996007_+	D-aminoacylase	NA	NA	NA	NA
WP_025249761.1\|996003_997341_+	MFS transporter	NA	NA	NA	NA
WP_141570894.1\|997337_998702_+	amidase	NA	NA	NA	NA
WP_036642116.1\|998916_999306_+	phosphonate transporter	NA	NA	NA	NA
WP_023873224.1\|999302_1000643_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-15	31.1
WP_141570896.1\|1000709_1001501_+	EAL domain-containing protein	NA	NA	NA	NA
WP_025249757.1\|1001570_1003220_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_141570898.1\|1003216_1005814_-	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	7.0e-11	28.1
WP_023873229.1\|1005810_1006689_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_080685199.1\|1006760_1008035_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_141572757.1\|1008390_1009317_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_141572759.1\|1009384_1010260_+	FCD domain-containing protein	NA	NA	NA	NA
WP_023873233.1\|1010277_1010913_+	flavin reductase family protein	NA	NA	NA	NA
WP_141572761.1\|1011571_1013584_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.3e-17	25.8
WP_141572763.1\|1013634_1015377_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_141572765.1\|1015516_1016368_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_141570900.1\|1016507_1028348_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	2.8e-22	29.0
WP_141570902.1\|1028344_1028602_+	hypothetical protein	NA	NA	NA	NA
1028565:1028624	attL	NA	NA	NA	NA
WP_141570904.1\|1028614_1029851_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.9e-144	88.0
WP_023873243.1\|1031210_1031408_+	DUF4926 domain-containing protein	NA	NA	NA	NA
WP_025249749.1\|1031484_1032735_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.5e-40	41.7
WP_141570906.1\|1032907_1033351_-	hypothetical protein	NA	NA	NA	NA
WP_141570908.1\|1033337_1036409_-	adhesin	NA	NA	NA	NA
WP_141570910.1\|1036465_1036885_-	hypothetical protein	NA	NA	NA	NA
WP_041612849.1\|1037318_1038290_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	3.0e-36	33.5
WP_141570912.1\|1038392_1039578_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.2e-48	38.4
WP_025249741.1\|1040137_1040353_-	hypothetical protein	NA	NA	NA	NA
WP_141570914.1\|1040733_1041968_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.0e-101	64.5
WP_025249738.1\|1045554_1045917_+	hypothetical protein	NA	NA	NA	NA
WP_051519075.1\|1046094_1046619_+	hypothetical protein	NA	NA	NA	NA
WP_058952727.1\|1046569_1048450_+	hypothetical protein	NA	NA	NA	NA
WP_141572767.1\|1048494_1048686_+	hypothetical protein	NA	NA	NA	NA
WP_141570916.1\|1049032_1050049_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-36	31.2
WP_141570918.1\|1050216_1051467_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.8e-40	41.2
WP_141570920.1\|1051405_1051774_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_141570922.1\|1051819_1052928_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_141570924.1\|1053846_1054239_+	hypothetical protein	NA	NA	NA	NA
WP_141570904.1\|1054349_1055586_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.9e-144	88.0
WP_025249734.1\|1055650_1055893_+	hypothetical protein	NA	NA	NA	NA
1054300:1055621	attR	NA	NA	NA	NA
WP_141570926.1\|1056159_1058631_+	adhesin	NA	NA	NA	NA
WP_081214901.1\|1058656_1058971_+	hypothetical protein	NA	NA	NA	NA
WP_141570928.1\|1058974_1059295_+	hypothetical protein	NA	NA	NA	NA
WP_023872376.1\|1059431_1060448_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-36	31.2

DBSCAN-SWA_2

2083723 : 2136466

Pseudomonas_phage(25.81%)

terminase,holin,protease,portal,tRNA,head,transposase,capsid,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025249315.1\|2083723_2084488_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_048806605.1\|2084574_2085207_-	NUDIX hydrolase	NA	NA	NA	NA
WP_080738753.1\|2085500_2086034_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_023596487.1\|2086111_2086996_-	EamA family transporter	NA	NA	NA	NA
WP_023596485.1\|2087235_2088249_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_141571288.1\|2088608_2089715_-	hypothetical protein	NA	NA	NA	NA
WP_141571290.1\|2089767_2090001_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_141571292.1\|2090090_2090324_+	hypothetical protein	NA	NA	NA	NA
WP_141571294.1\|2090359_2091193_-	DNA adenine methylase	A0A0K1LM14	Caulobacter_phage	7.0e-74	52.5
WP_141571296.1\|2091224_2091854_+	hypothetical protein	NA	NA	NA	NA
WP_141571298.1\|2091919_2092567_+	hypothetical protein	NA	NA	NA	NA
WP_141571300.1\|2092541_2093537_-	hypothetical protein	NA	NA	NA	NA
WP_141571302.1\|2093529_2093820_-	hypothetical protein	NA	NA	NA	NA
WP_141571304.1\|2094157_2094679_+	hypothetical protein	Q8W6Q5	Burkholderia_virus	4.3e-05	44.6
WP_025249610.1\|2094732_2095638_-	hypothetical protein	V5YTD4	Pseudomonas_phage	3.6e-55	51.9
WP_141571306.1\|2095634_2095988_-	hypothetical protein	NA	NA	NA	NA
WP_025249609.1\|2096427_2096775_+	hypothetical protein	NA	NA	NA	NA
WP_141571308.1\|2096986_2097478_+	hypothetical protein	NA	NA	NA	NA
WP_141571310.1\|2097660_2098272_-	hypothetical protein	NA	NA	NA	NA
WP_141571312.1\|2098689_2099073_-	hypothetical protein	NA	NA	NA	NA
WP_141572815.1\|2099498_2099894_-	helix-turn-helix domain-containing protein	A0A125RNS6	Pseudomonas_phage	4.6e-07	51.7
WP_141571314.1\|2099966_2100209_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_141571316.1\|2100341_2100605_-	hypothetical protein	Q8W6P6	Burkholderia_virus	3.5e-11	46.3
WP_023595576.1\|2100746_2101190_+	hypothetical protein	Q3HQZ3	Burkholderia_phage	7.4e-30	49.0
WP_141571318.1\|2101186_2101372_+	hypothetical protein	NA	NA	NA	NA
WP_141571320.1\|2101382_2101634_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_141571322.1\|2101635_2102670_+	replication protein	A0A1W6JNY0	Morganella_phage	2.5e-12	34.4
WP_141571323.1\|2102666_2104040_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.1e-87	45.7
WP_141571325.1\|2104036_2104219_+	hypothetical protein	NA	NA	NA	NA
WP_141571327.1\|2104215_2104545_+	hypothetical protein	A0A0P0I8E8	Acinetobacter_phage	6.9e-17	47.4
WP_141571329.1\|2104541_2104892_+	hypothetical protein	NA	NA	NA	NA
WP_141571331.1\|2105002_2105242_+	hypothetical protein	A0A2H4JA03	uncultured_Caudovirales_phage	3.1e-19	64.5
WP_141571333.1\|2105307_2105703_+	hypothetical protein	NA	NA	NA	NA
WP_141572817.1\|2105720_2106131_+	DUF1364 family protein	Q6JIF7	Burkholderia_virus	8.4e-20	42.1
WP_141571335.1\|2106123_2106504_+	hypothetical protein	NA	NA	NA	NA
WP_141571337.1\|2106855_2107230_+	HNH endonuclease	Q8HA82	Salmonella_phage	1.3e-06	41.3
WP_141571339.1\|2107309_2107726_+\|terminase	terminase	NA	NA	NA	NA
WP_141571341.1\|2107718_2109437_+\|terminase	terminase large subunit	A0A0U4B0M7	Pseudomonas_phage	6.4e-255	73.5
WP_141571343.1\|2109433_2110732_+\|portal	phage portal protein	G0ZT36	Aeromonas_phage	3.8e-143	62.3
WP_141571345.1\|2110736_2111594_+\|protease	Clp protease ClpP	A0A2H4PI16	Pseudomonas_phage	3.2e-74	56.7
WP_141571347.1\|2111600_2112806_+\|capsid	phage major capsid protein	A0A2H4PI18	Pseudomonas_phage	2.3e-126	59.9
WP_141571349.1\|2112855_2113122_+	hypothetical protein	NA	NA	NA	NA
WP_141572819.1\|2113307_2113559_+	hypothetical protein	A0A2H4PI01	Pseudomonas_phage	8.1e-18	50.6
WP_141571351.1\|2113576_2113888_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_141571353.1\|2113805_2114225_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_141571355.1\|2114217_2114730_+	hypothetical protein	NA	NA	NA	NA
WP_141571357.1\|2114612_2115104_+	DUF3168 domain-containing protein	A0A2H4J359	uncultured_Caudovirales_phage	2.4e-05	31.9
WP_141571359.1\|2115167_2115650_+	hypothetical protein	NA	NA	NA	NA
WP_141571361.1\|2115678_2115981_+	hypothetical protein	NA	NA	NA	NA
WP_141571363.1\|2116061_2116295_+	hypothetical protein	NA	NA	NA	NA
WP_141571365.1\|2116291_2118409_+\|tail	phage tail tape measure protein	A0A2I6PI71	Pseudomonas_phage	6.5e-15	32.8
WP_141571367.1\|2118408_2118747_+\|tail	phage tail protein	K7P7R1	Enterobacteria_phage	2.4e-28	52.7
WP_141572821.1\|2119003_2119855_+\|tail	tail fiber domain-containing protein	A0A0F7LBT2	uncultured_marine_virus	1.4e-21	46.0
WP_141571369.1\|2119859_2120564_+\|tail	phage minor tail protein L	A0A2R3UA90	Siphoviridae_environmental_samples	6.3e-84	61.9
WP_141571371.1\|2120563_2121277_+	peptidase P60	A0A1B1IV85	uncultured_Mediterranean_phage	3.4e-69	51.5
WP_141571373.1\|2121313_2121718_+	hypothetical protein	NA	NA	NA	NA
WP_141571375.1\|2121766_2122369_+\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	5.7e-49	54.0
WP_141571377.1\|2122427_2125592_+	DUF1983 domain-containing protein	A4JX16	Burkholderia_virus	0.0e+00	54.8
WP_141571379.1\|2125591_2125894_+	hypothetical protein	NA	NA	NA	NA
WP_141571381.1\|2125929_2126649_+	hypothetical protein	NA	NA	NA	NA
WP_063598141.1\|2126718_2127060_+	hypothetical protein	Q6J1Q7	Burkholderia_virus	1.0e-31	68.2
WP_141572823.1\|2127059_2127338_+\|holin	holin	Q6J1Q6	Burkholderia_virus	1.6e-22	55.4
WP_141571383.1\|2127324_2127801_+	glycoside hydrolase family protein	Q9MC90	Pseudomonas_phage	4.8e-51	62.9
WP_141571385.1\|2127797_2128283_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	1.6e-22	42.8
WP_141571387.1\|2128921_2129767_+	hypothetical protein	NA	NA	NA	NA
WP_141571389.1\|2129766_2130204_+	hypothetical protein	NA	NA	NA	NA
WP_141571391.1\|2130692_2131223_-	hypothetical protein	NA	NA	NA	NA
WP_141571393.1\|2131847_2133005_-	hypothetical protein	NA	NA	NA	NA
WP_141571395.1\|2132964_2133198_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_141571397.1\|2133287_2133521_+	hypothetical protein	NA	NA	NA	NA
WP_141572825.1\|2133559_2134807_-	DNA (cytosine-5-)-methyltransferase	Q6V7R9	Burkholderia_virus	2.1e-61	41.1
WP_141571399.1\|2134965_2135256_+	hypothetical protein	NA	NA	NA	NA
WP_063598134.1\|2135215_2136466_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.5e-40	41.7

DBSCAN-SWA_3

2972771 : 3029482

Pseudomonas_phage(25.0%)

integrase,transposase

attL 2971750:2971776|attR 3032047:3032073

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2971750:2971776	attL	NA	NA	NA	NA
WP_141571751.1\|2972771_2973050_-\|transposase	transposase	NA	NA	NA	NA
WP_141571753.1\|2973625_2974054_-	hypothetical protein	NA	NA	NA	NA
WP_141571755.1\|2974055_2974361_-	hypothetical protein	NA	NA	NA	NA
WP_141570728.1\|2974405_2975639_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.8e-102	64.8
WP_141571757.1\|2977090_2977423_-	hypothetical protein	NA	NA	NA	NA
WP_141571759.1\|2977425_2992047_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_141571761.1\|2992328_2993138_-	hypothetical protein	NA	NA	NA	NA
WP_141571763.1\|2993298_2994438_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_141571765.1\|2994456_2995134_+	pre-16S rRNA-processing nuclease YqgF	NA	NA	NA	NA
WP_141571767.1\|2995155_2995557_+	hypothetical protein	NA	NA	NA	NA
WP_141571769.1\|2995527_2996682_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_141571771.1\|2996712_2997501_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_141572878.1\|2997512_2998262_-	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_141571773.1\|2998426_2998888_-	hypothetical protein	NA	NA	NA	NA
WP_141571775.1\|2998896_2999307_-	hypothetical protein	NA	NA	NA	NA
WP_141571777.1\|2999303_3000149_-	FliM/FliN family flagellar motor switch protein	NA	NA	NA	NA
WP_141571779.1\|3000145_3001324_-	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_141571781.1\|3001337_3001739_-	flagellar hook capping protein	NA	NA	NA	NA
WP_141571783.1\|3001766_3002306_-	hypothetical protein	NA	NA	NA	NA
WP_141571785.1\|3002517_3003021_-	hypothetical protein	NA	NA	NA	NA
WP_141571787.1\|3003017_3004325_-	FliI/YscN family ATPase	NA	NA	NA	NA
WP_141571789.1\|3004317_3005226_-	hypothetical protein	NA	NA	NA	NA
WP_141571791.1\|3005180_3005756_-	hypothetical protein	NA	NA	NA	NA
WP_141571793.1\|3005752_3007192_-	flagellar M-ring protein FliF	NA	NA	NA	NA
WP_141571795.1\|3007226_3007538_-	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
WP_141571797.1\|3007534_3007963_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_141571799.1\|3007992_3008367_-	flagellar basal body protein	NA	NA	NA	NA
WP_141572880.1\|3008378_3009542_-	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_141571801.1\|3009550_3010132_-	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_141571803.1\|3010128_3011127_-	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_141571805.1\|3011135_3011930_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_141571807.1\|3012036_3012768_-	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_141571809.1\|3012784_3014857_-	flagellar type III secretion system protein FlhA	NA	NA	NA	NA
WP_141571811.1\|3014853_3015966_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_141571813.1\|3015958_3016738_-	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_141571815.1\|3016750_3017017_-	flagellar type III secretion system protein FliQ	NA	NA	NA	NA
WP_141571817.1\|3017197_3018205_-	hypothetical protein	NA	NA	NA	NA
WP_141571819.1\|3018260_3020498_-	hypothetical protein	NA	NA	NA	NA
WP_141571821.1\|3021195_3022065_-	DUF2029 domain-containing protein	NA	NA	NA	NA
WP_141570904.1\|3022762_3023999_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.9e-144	88.0
WP_141571823.1\|3024206_3024485_-	hypothetical protein	NA	NA	NA	NA
WP_141571825.1\|3024619_3024904_-	hypothetical protein	NA	NA	NA	NA
WP_141571827.1\|3024976_3026163_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	7.2e-48	38.4
WP_141570916.1\|3026552_3027569_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-36	31.2
WP_141571829.1\|3028570_3029482_+\|integrase	site-specific integrase	NA	NA	NA	NA
3032047:3032073	attR	NA	NA	NA	NA

DBSCAN-SWA_4

4036300 : 4089565

Bacillus_phage(20.0%)

integrase,transposase

attL 4036099:4036148|attR 4099919:4099968

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4036099:4036148	attL	NA	NA	NA	NA
WP_141572205.1\|4036300_4037584_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A221SAN4	Ralstonia_phage	1.6e-08	23.2
WP_141572207.1\|4038162_4038774_+	AAA family ATPase	NA	NA	NA	NA
WP_141572209.1\|4039123_4039345_+	hypothetical protein	NA	NA	NA	NA
WP_141572211.1\|4039542_4040178_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_141572213.1\|4040300_4041224_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_141572215.1\|4041250_4042783_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.4e-19	26.2
WP_141572217.1\|4042706_4044554_+	hypothetical protein	NA	NA	NA	NA
WP_141572219.1\|4044612_4045416_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_141572221.1\|4045497_4045812_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_141572223.1\|4045808_4047488_+	cation/acetate symporter ActP	NA	NA	NA	NA
WP_141572225.1\|4047567_4048518_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_141572226.1\|4048465_4049569_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_141572228.1\|4051835_4052783_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_141572024.1\|4052885_4054119_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.4e-102	65.2
WP_141572230.1\|4054268_4055315_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_141572232.1\|4055487_4055952_-	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_141572234.1\|4056000_4056855_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_141572236.1\|4057005_4057752_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.4e-11	28.3
WP_141572238.1\|4058031_4058214_+	hypothetical protein	NA	NA	NA	NA
WP_141572240.1\|4058268_4058979_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_141572242.1\|4059127_4059568_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_141572244.1\|4059564_4061469_+	cation/acetate symporter ActP	NA	NA	NA	NA
WP_141572246.1\|4061509_4062865_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_141572248.1\|4063034_4064207_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_141572250.1\|4064513_4065719_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_141572252.1\|4066132_4067410_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_023593909.1\|4068660_4070199_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.2e-44	36.8
WP_141572254.1\|4070252_4071382_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.0e-120	88.1
WP_141572256.1\|4071301_4071661_+	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_141572258.1\|4071782_4072079_+	hypothetical protein	NA	NA	NA	NA
WP_141572260.1\|4072081_4072720_+	hypothetical protein	NA	NA	NA	NA
WP_141572929.1\|4072697_4073042_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_141572262.1\|4073224_4073776_+	DUF4339 domain-containing protein	NA	NA	NA	NA
WP_141572264.1\|4073835_4074192_+	hypothetical protein	NA	NA	NA	NA
WP_141572931.1\|4074314_4074659_+	hypothetical protein	NA	NA	NA	NA
WP_141572266.1\|4075020_4076406_-	SIR2 family protein	A0A1S5SA14	Streptococcus_phage	1.6e-17	27.8
WP_141572268.1\|4076993_4079711_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_141572270.1\|4079700_4081644_-	site-specific DNA-methyltransferase	A0A2L1IZ21	Streptomyces_phage	1.6e-84	43.3
WP_141572272.1\|4081640_4084565_-	UvrD-helicase domain-containing protein	A0A068EQC7	Bacillus_phage	2.9e-37	24.6
WP_141572274.1\|4084561_4084774_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_141572276.1\|4084854_4088193_+	DUF3883 domain-containing protein	NA	NA	NA	NA
WP_141572278.1\|4088414_4088723_+\|transposase	transposase	NA	NA	NA	NA
WP_141572280.1\|4088719_4089565_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.0e-17	29.8
4099919:4099968	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041237

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection