CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021399	Bordetella hinzii strain TR-1212 chromosome, complete genome	3 crisprs	csa3,WYL,DEDDh,DinG	1	2	365	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021399_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021399_1

2742845-2742946

Orphan

Consensus_repeat	Method
CGCCGCCCGCGCCGCCGCCCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021399_1

>merge|NZ_CP021399|1|2742845-2742946|CRISPRCasFinder
GGCCGCCCGCCGAACCGCCCACCAGCAGGGTGTCCCCCACACTGAGAGAGGTGCCGTCAAGCAGGGTCAGCGTTCCATCGCCGCCCGCGCCGCCGTTACCGA

>NZ_CP021399|1|1|2742845-2742946|CRISPRCasFinder
GGCCGCCCGCCGAACCGCCCACC	AGCAGGGTGTCCCCCACACTGAGAGAGGTGCCGTCAAGCAGGGTCAGCGTTCCAT
CGCCGCCCGCGCCGCCGTTACCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021399.1\|WP_142097442.1\|2727026_2727926_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP021399.1\|WP_080700822.1\|2745550_2746240_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP021399.1\|WP_032978228.1\|2725074_2725698_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP021399.1\|WP_142098944.1\|2732139_2733525_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|129864
NZ_CP021399.1\|WP_032955754.1\|2744582_2745449_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NZ_CP021399.1\|WP_029581375.1\|2748041_2748959_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP021399.1\|WP_032962957.1\|2751884_2753009_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021399.1\|WP_142097439.1\|2725771_2727001_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP021399.1\|WP_080700476.1\|2750427_2751888_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_CP021399.1\|WP_142098949.1\|2746510_2748055_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173873
NZ_CP021399.1\|WP_095075242.1\|2735179_2735731_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372042
NZ_CP021399.1\|WP_032955771.1\|2728050_2730282_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021399.1\|WP_029581383.1\|2733524_2735180_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP021399.1\|WP_029581370.1\|2753005_2753947_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP021399.1\|WP_029581379.1\|2743863_2744463_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP021399.1\|WP_029581381.1\|2735910_2736237_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021399.1\|WP_029581385.1\|2731516_2732020_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP021399.1\|WP_029581386.1\|2730497_2731520_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP021399.1\|WP_029581373.1\|2750134_2750431_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP021399.1\|WP_142098955.1\|2749050_2750154_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737

Protein	Function_ID	Function_description	E-value
NZ_CP021399.1\|WP_142097442.1\|2727026_2727926_-\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	1.20446e-76
NZ_CP021399.1\|WP_080700822.1\|2745550_2746240_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	3.42781e-46
NZ_CP021399.1\|WP_032978228.1\|2725074_2725698_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	6.81936e-56
NZ_CP021399.1\|WP_142098944.1\|2732139_2733525_-\|c-type-cytochrome	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	3.55009e-09
NZ_CP021399.1\|WP_032955754.1\|2744582_2745449_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NZ_CP021399.1\|WP_029581375.1\|2748041_2748959_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80672e-62
NZ_CP021399.1\|WP_032962957.1\|2751884_2753009_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.96383e-58
NZ_CP021399.1\|WP_142097439.1\|2725771_2727001_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.19656e-159
NZ_CP021399.1\|WP_142098949.1\|2746510_2748055_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173873	cd08508, PBP2_NikA_DppA_OppA_like_1, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021399.1\|WP_095075242.1\|2735179_2735731_-\|hypothetical-protein	gnl\|CDD\|372042	pfam12318, FAD-SLDH, Membrane bound FAD containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria. Proteins in this family are typically between 168 and 189 amino acids in length. There is a conserved ALM sequence motif. This family is a membrane protein (FAD-SLDH) involved in oxidation of D-sorbitol to L-sorbose.	2.27058e-35
NZ_CP021399.1\|WP_032955771.1\|2728050_2730282_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.88414e-97
NZ_CP021399.1\|WP_029581383.1\|2733524_2735180_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.89685e-61
NZ_CP021399.1\|WP_029581370.1\|2753005_2753947_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40169e-121
NZ_CP021399.1\|WP_029581379.1\|2743863_2744463_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.89569e-110
NZ_CP021399.1\|WP_080700476.1\|2750427_2751888_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	2.13709e-28
NZ_CP021399.1\|WP_029581385.1\|2731516_2732020_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	1.44349e-69
NZ_CP021399.1\|WP_029581386.1\|2730497_2731520_-\|DUF4880-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	1.1192e-67
NZ_CP021399.1\|WP_029581373.1\|2750134_2750431_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.17053e-29
NZ_CP021399.1\|WP_142098955.1\|2749050_2750154_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	6.95059e-40

>NZ_CP021399.1|WP_029581381.1|2735910_2736237_+|hypothetical-protein
MELETAYWDGELVISVEPREVRMSHWIHAPRAWRALDGQLLFDLAGSDWDLCGVGGEDEDCLVLALRRYPGGAPARLLTIARGSLEMHLDGESLPAGELLPRLEARRP
>NZ_CP021399.1|WP_095075242.1|2735179_2735731_-|hypothetical-protein
MPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTDRQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIVAAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPPLLPTSKAL
>NZ_CP021399.1|WP_029581383.1|2733524_2735180_-|GMC-family-oxidoreductase
MTRQAEFQSNGDARADIIVVGSGVVGAMIADQLAARGHSVLILEAGLRIERGQAVENWRNMPFANRAGSDFQGLYPQSPDAPAPLYFPENNYVHLTGPSASSFKQGYLRTVGGTTWHWAASCWRHLPVDLRMKSAYGVGRDWPISYDELEPFYLQAENEMGVAGPNDPARQSPAERSGPYPMDMVPWAYGDQRFADVVNPHGYRSVPIPQGRSTQPWRGRPTCCGNNNCQPICPIGAMYNGIHHVQAAEEKGAIVLAQSVVYKIDTDENNRITAVHWYDAARRSHKATGQHFVLACNAMETPRLLLMAANARNPKGIANRSDQVGRNIMDHSGFHCYFQASEPLWPGRGPAQSSCLVGPRDGAFRAEYSANKMILNNITQVTLATKTALAQGLTGKALDAEIRRRAAHGVDLSISLEPLPDPNNRLTLSKTRRDPLGLPCPDVHYDVGDYVRKGAEAAHAQLRHIGSLFKATDFLITTQLNANNHMMGSVIMGSDPRDSVVDGDCRAHDHDNLWLPGGGAMPSASVVNSTLTMAALGLKTAAAIARRMEAA
>NZ_CP021399.1|WP_142098944.1|2732139_2733525_-|c-type-cytochrome
MKTLLCGLALALLPLGAHATDEARLIERGRMLSIAADCMACHTQAPSGKPYAGGYPIQSPLGTIYASNITPSTRAGIGGYSLEDFARAVRQGVRPDGSRLYPAMPYTSYTLITDEDIQALYTYFMKGVQPVDEPSPATDLPFPFGIRASMRVWNALFLEDKRFTPDPDQSAEVNRGAYLARALAHCSSCHTPRNALMAEDPKRPLGGGMVGPWHAPNISSDPQAGIGGWTNEEIVQYLRTGRVAGKGQAGGSMAEAVEHSFQHMPQADLAAIAAYLKSTPPVPADAAAPAAYARGAAISPEAGLRGADPQTANLSLKSGAALFSGYCASCHQAGGQGSAGQAYPSLFHNTATGAGSASNLIAAILYGVDRNVGGQHVLMPRFDAKSYVQPLSDAQIALIANYVLANYGNARLSVTPDDVRQARQGGPAPLLARAQPYMLPAAVTALLIVLLGLLLLRRRRA
>NZ_CP021399.1|WP_029581385.1|2731516_2732020_-|sigma-70-family-RNA-polymerase-sigma-factor
MHPATLETLYTDHHSWLRGWLHRRLGNTEQAADLAHDTFIRLLCSERVPAALDEPRAFLTTVAQRLVSNHWRREKLERAYLEALAQAPQALARSPEERAILLETLFELDRLLDGLPAVVRRAFLLSQLDGQTHAQVAQALGVSIPTVKRHIVRALARCCFADLSFHP
>NZ_CP021399.1|WP_029581386.1|2730497_2731520_-|DUF4880-domain-containing-protein
MKAGSTWYHATQEAAGIAPEVAERALQWLLDLREDATPQTRRAWAQWHDAHPDHARAWSRIESVMGQLRALSAPDSATAARSALLPRRRAGLKALAVLAMAGGSAWALRDTVAWREWAADQRTAIGQRRALTLPDGTHIVLNTHSAIDLRYGPAERRLYLVAGEVLIVTAPDRQAPPRPFLVQTRQGVARALGTEYSVRQHGNETCVSVLRGSVRIEPREHPGRGLLLAAGRHARYTAEGIAGDGPADERDLAWKDGFIMARGMRLADFLAELGRYTEASLSCDPAVAGLQVSGAFPTGDAEQVMAALAATLQLRLETQAPLWRARRLRLLAVTKFPVQG
>NZ_CP021399.1|WP_032955771.1|2728050_2730282_-|TonB-dependent-receptor
MLGRFGREAGVLLSFRPDVTQGLASPGLRGSYTVQAGLQQLLAGTGIQARPQAAGGYVLERSGGVAQLQPITVAASAAVDALPAPYAGGQIARGGGLGMLGTADVMDVPFNTTNYTAQALENQQARTLADIVINEASVRTLTSSGGFGEDFQIRGYTVSSGDVGLNGLYGLASSSRMPAAIMERVEVLKGPGTLMNGIGPNGSIGGGINVVTKRAGDDPLTRVTATYQDKSQLGGMVDMGRRFGQDNEWGIRVNGVYHNGDTTIDHGSQRQGVGALALDYRGPRLRGSLDAYTQQERTDNFRPQVGFQSSVTDLPSPPSGHRNFYPGTQLELKDSTVASRLEYDLNDSLTVYAAGGYRYGTANQTFPSGPVDQDGGFTVRNAFYDSYSRSSTGEIGLRARFDTWGVKHNLSLGATRLDQELGNFYITSTGTAASNIYHPAPLPEVTGHRGSPSKASETALTSFTLADTLSFADDRLMITGGLRQQRVALDNYSTATGDRTSSYDESAISPLAGVVFKPWSNVSLYGNFTSGLTRGGVAPATAANAGQVFAPYKSKQYEAGVKVDWGSVITSASVFQITRPNSMTDPDTNVYSFDGEQRNRGFELAATGEVTPGLRVMASATFYDAKITRSAGGVNDGNDANGVPDSAFNLGVDWDMPWVRGLSLNARVIHTSSAWFNAANTIRLPSWTRYDVGARYSTRVMGRAVVFRANIENLFNQTYWLASGTYATVAAPRAFLLSAQIDF
>NZ_CP021399.1|WP_142097442.1|2727026_2727926_-|amidohydrolase-family-protein
MTTSPPPGEVPFCLPPLPLPQQAPPAFEAPPLACDTHAHVVAADRRAYPMVAERSYTPHPATEQAYLAMLAANGMERGVLVQISVYGTDNRYMLEVLRRHPERLRGIGVVAPDIGDAQLRDMHEAGVRGLRINVLFGGGIGFDAMETLAHRIKDMGWHMQFLMDARQLPELLPRMRKLPVPGVVDHMGHMPVAEGLQSPGFQALAHLVQDHGWWVKLSGAYRISAQYDGYADVLPWAQALIAMAPDRMVWGSDWPHVHISPMVNTGKLRNQLAEWAPDPWTRQAILVDNPQRLYGFPSR
>NZ_CP021399.1|WP_142097439.1|2725771_2727001_-|MFS-transporter
MQWYRELNQTERRTFVAAFGGWAIDALDFMVFTFVISTLISLWGIEKGQAGMLGTVTLLFSAIGGWLAGILADRYGRVRVLQVTILWFSACTVAIGFAQNFEQLFVLRALQGLGFGGEWAVGSVLMGEIVRAEHRGKAVGTVQSGWAIGWGVAAILYTIAFSALPPEWAWRTLFWIGVIPALLVLYIRKHVPEPEVFQRARSQLEASAARPSFWMIFSPALLKTTVITALLCTGVQGGYYAITTWLPTFLKTERHLSVMGTGGYLMVIIVGSFCGYIAGAYLADRLGRRANLLIFSVLSGLSVYVYTLVPLTDAQMLVLGFPLGFAASGIFSGVGAYLTELFPTEVRANGQGFAYNFGRGIGALFPSLVGFLSQTQGLAWAIGAFATGAYAIVIVTALLLPETRGRVLK
>NZ_CP021399.1|WP_032978228.1|2725074_2725698_-|response-regulator-transcription-factor
MTTVLLVDDHTMFREGLALALQHTAPALQLLPAATGAQALALLDDLRGIDLVVMDYYLPDMAGTELLRRLRQRRPQLRILVLSASEDPEDRRRALEAGAQDYLHKSASSRTLASALAALGQARPGMPAAAGAAPDAAALLRALTPRQLDVLRLICDGLRNKAISEQLNMSEKTVKSHVSAILGTLGVLNRTQAALVARRGGLFGKPA
>NZ_CP021399.1|WP_029581379.1|2743863_2744463_+|nitroreductase-family-protein
MSNAYIEALKQRRTQYALGRNVSLSKDALVALIQDAVKHSPSSFNSQTSRALVLFGAESEKLWALAIDEVRKVAPAEGFDKTEAKLKSFAAGVGTVLFFEDQDVVRGLQEKFALYADNFPVWSEQASGMAQLSVWSALANAGVGASLQHYNPLIDAAVAREWKVPASWKLRAQMPFGSNEAPKSEKAFMDDADRFIVAG
>NZ_CP021399.1|WP_032955754.1|2744582_2745449_-|glutathione-dependent-disulfide-bond-oxidoreductase
MTTEYFPPKVWTWNKNSASTASNASSLNRPIAGATHEKTLPVGRHPLQLYSLGTPNGQKVTILLEELLARGHAQAEYDAWLIRIGEGDQFGSGFVDINPNSKIPALVDRSGDTPIRVFESGAILLYLAEKFGDFLPADPAARAECLSWLFWQMGSAPYVGGGFGHFYAYAPVKIEYAIDRFTMETKRQLDVLDRRLAEHEYLAGDQYTIADIAVFPWYGGLIKGWLYDAAEFLAVHEYRHVQRWADALLARPAVDRGRIVNRLRGPLSEQLHERHDASDFDTKTADKT
>NZ_CP021399.1|WP_080700822.1|2745550_2746240_-|alpha/beta-hydrolase
MAAAFIHGAPGSMLAAAAGKTETHFFAGPAGAMEVLADAPAQAPRGIALVTHPQPLLGGSPRHKIPHRLAHGLRDDGWLALRPAFRGVAGSAGHYDHGDGESEDILALARALRAQAPALPLALVGFSFGAYVQARVARALLDAGTPADRVVLAGLPVGEVPAERVYDTPPLPEEVVLIHGENDAQAPLAPLLEWARPNGHPVIVVPGADHFFSRSLPLLLKLVRQHLAA
>NZ_CP021399.1|WP_142098949.1|2746510_2748055_+|polyamine-ABC-transporter-substrate-binding-protein
MRCGLALALTACGLGSSAWAEERPMLRLSSGAADNATLDPHRATSTADKGVAAEMFNALVRFPPGSADPKALEPDLAERWEASPDSKTWTFHLRRGVQFHGGYGELKAEDVVYSIQRAADPNRSSFAATFGLIDKVEAVDDHTVRFTLKYPDAAFLGRVSNYHGGNIVSKKAAEKLGDKFGGSPVGTGPFAFGQHVTQQYVKLVANDSYFRGKPKLAGIMYRMIPSDSARELAFTSNEIDVMQGKREQRWVERSAKRGMQVDIFEPAEFRTLHINRNIKPLDNLKVREAIAAAINVDEIVRYAGKDVADKGCSVVPNGYLGQDCGAGAYAYDAGRAKQLLAEAGFPDGIQIKSVVSNISAQQPIMEIVQAQLAKAGIKLDMEVVDHATYQAKSRQDLSALVFYGAARFPNADTYLTEFYDSAAAIGAPGAMSNFSHCSVADEAIRQARIEPDAQKQLALWKDAQARIRADVCAVPLFGLKQVWVHSERVNYGYKLDGALNLQPPITEQTAVTAP
>NZ_CP021399.1|WP_029581375.1|2748041_2748959_-|LysR-family-transcriptional-regulator
MKNILNLRQIEAFKAVIEHGTVSQAATALGVSQPAVSKLLTHLEADSGLALFERVRGKLAPTAQGMRLYREVDRVFNGLRQLEQAVESIRRAEQRTLNVGVLPALAGAFIRRVSMQFLRRHPDVRISIQSRGSLFLADWLATRHIDVALVGSRVDNPYIEREPLFRQPLVCALPPNHVLTRKRVIRPRDLAGLPFISFGPESQTHQLVQQAFDAAGLPVNVALDTNTAPTACEFVAAGLGVSLIHPLFAEGMQSRLVLRRFDPELHFHFQLCRAQASRNAALVEDFVQEVRDVAAQVSREVLKGQ
>NZ_CP021399.1|WP_142098955.1|2749050_2750154_+|FAD-dependent-oxidoreductase
MAGAGMVGAAIAYGLAGLGQRVLLVDGGDTDYRAAKANFGLVWLQGKGHGNPDYQRLSHRSVLDWPDFARELQAESGIDLQYERRGGLHFCLGEADLQARAARMQAWRRQAPEVGDCVSILARDELLRRFPGLDLGPEVSGASVGELDGHANPLRLLAALQAVFLRRGGTLWGNAPVRAIRPLDGGGFEIEAGGRRARGARLVIAAGLGSAALGAQVGLAVPLRPQRGQILVTERLAPLLPVPASGIRQTGEGTVMVGLTQEEVGYDLSTTTEAAVHMSRNALRILPALAQARLVRHWSCLRVMTPDGCPVYAQSQPFPGAFVALCHSGVTLAALHAGRYARALASGAPPSFLDVFHHERFNVQKVA
>NZ_CP021399.1|WP_029581373.1|2750134_2750431_+|(2Fe-2S)-binding-protein
MFRKLHESGAASLTLTIDGQPVRAEPGESVAAVLLRQDTPASRSTPVNESPRAPYCMMGVCFECLAIIDGVASTQACMVPVRDGMRVERQHGKRSVQA
>NZ_CP021399.1|WP_080700476.1|2750427_2751888_+|FAD-dependent-oxidoreductase
MKREFDVVVIGAGPAGMSAAIRLREQHMRVLVVDEQPAPGGQIWRAVETVAGTRTGRLLGDEYRAGAALAERFRQCGAVYEPQTQVWQIETGWHVYMTRGGRAQAVRADQVLLAIGAQERPAPFPGWTLPGVLTVGAAQILLKTSNQVPAAPVWVAGSGPLPLLYMAQLLRAGGQIAGWLDTSAPGAWRRALPWAGAALASWGDIRKGLGWLRELKAAGVRRVRGVTGLRALGEGALREIEYTLADGSLRREPASVLLSHEGVVPSIHMTRALECAHHWDARQSCLAPDLDDWGQTSREGVYVAGDAAGIGGALAACARGELAALGMALRAGRMTAQAAGQAAAPLREKLRGLLRIRPMLDEMYPPRAGIFNPPDETIVCRCEELTAGDIRRAARIGQPGPNQVKSYTRAGMGPCQGRQCGYTVAHIVAAEERRPVSEVGFYRIRPPLKPLTLGELASLDVGDDGVVLAGAPESPGEAPAAREPRP
>NZ_CP021399.1|WP_032962957.1|2751884_2753009_+|FAD-binding-oxidoreductase
MSAPVFDVAVIGGGLHGLSAALHIARQGKRVVVIERHWTGRHASGATAAGVRTLNRDRRELDLSMEALDMWHDMASLVGDDCGFHAHGQICVAETEQGLAKLAGRVDSLRAAGYAHEEIIDAAELRRLLPALSPHCVGASIARRDGAADPHRALRAFRASAEAAGVTLVEHCAVTGLRRQGADWRVVTERGDWVVPAVVNAAGAWSARIAAMAGDEIPLATKSSMMMVSERLRPFIKPVVAIVGRSLSFKQSDQGTLVIGGGLQGTPDLDRETSTARMRVLAKGARAATDLFPMVRDIRIVRVWAGLEAKTEDLLPVIGPSPRAPGVFHAFGFSGHGFELVPVVGAVMADLVLRGATARPIGALQAARLMGGQP
>NZ_CP021399.1|WP_029581370.1|2753005_2753947_+|ABC-transporter-permease
MIRYAIKRLLLAIPTLLAMLTAVFILVRLVPGDPAAVMLGDQASAEALAALRLRLGLDLPTHEQYLRFLGDMLTGNFGVSMASGRTVLQEVGQVLPWTLQLTAAAILIGVVFGLPLGIWAALRRNAWPDYLGRLLSLTGLSFPAFVSAILMLLVFAIQLRWFPVIGSSAATDWGTQLRNLALPAFNLGLIMMAYVMRVTRSSMLGVMGEDYVRTARAKGLRPLRLIMRHGLRNALIPIVTVVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFAACVILVNLLTDLVYGLVDPRVKYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021399_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021399_2

2743025-2743165

Orphan

Consensus_repeat	Method
CGCCGCCCGCGCCGCCGCCCGCG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021399_2

>merge|NZ_CP021399|2|2743025-2743165|CRISPRCasFinder
AGCCGGCTGTGCCGCTGCCGCCGTTGGAGGCGCCGCCGCCGCCCCCGCCGCCGCCGACGCCGAGCACGTCGGTGCTCGCATGGCCGCTGGTCAACATGGCCCCGGACGAGGCCCTGGCGCCGCCGCCGCCATAGCCGGCCG

>NZ_CP021399|2|2|2743025-2743165|CRISPRCasFinder
AGCCGGCTGTGCCGCTGCCGCCG	TTGGAGGCGCCGCCGC
CGCCCCCGCCGCCGCCGACGCCG	AGCACGTCGGTGCTCGCATGGCCGCTGGTCAACATGGCCCCGGACGAGGCCCTGG
CGCCGCCGCCGCCATAGCCGGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021399.1\|WP_142097442.1\|2727026_2727926_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP021399.1\|WP_080700822.1\|2745550_2746240_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP021399.1\|WP_032978228.1\|2725074_2725698_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP021399.1\|WP_142098944.1\|2732139_2733525_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|129864
NZ_CP021399.1\|WP_032955754.1\|2744582_2745449_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NZ_CP021399.1\|WP_029581375.1\|2748041_2748959_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP021399.1\|WP_032962957.1\|2751884_2753009_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021399.1\|WP_142097439.1\|2725771_2727001_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP021399.1\|WP_080700476.1\|2750427_2751888_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_CP021399.1\|WP_142098949.1\|2746510_2748055_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173873
NZ_CP021399.1\|WP_095075242.1\|2735179_2735731_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372042
NZ_CP021399.1\|WP_032955771.1\|2728050_2730282_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021399.1\|WP_029581383.1\|2733524_2735180_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP021399.1\|WP_029581370.1\|2753005_2753947_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP021399.1\|WP_029581379.1\|2743863_2744463_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP021399.1\|WP_029581381.1\|2735910_2736237_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021399.1\|WP_029581385.1\|2731516_2732020_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP021399.1\|WP_029581386.1\|2730497_2731520_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP021399.1\|WP_029581373.1\|2750134_2750431_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP021399.1\|WP_142098955.1\|2749050_2750154_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737

Protein	Function_ID	Function_description	E-value
NZ_CP021399.1\|WP_142097442.1\|2727026_2727926_-\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	1.20446e-76
NZ_CP021399.1\|WP_080700822.1\|2745550_2746240_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	3.42781e-46
NZ_CP021399.1\|WP_032978228.1\|2725074_2725698_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	6.81936e-56
NZ_CP021399.1\|WP_142098944.1\|2732139_2733525_-\|c-type-cytochrome	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	3.55009e-09
NZ_CP021399.1\|WP_032955754.1\|2744582_2745449_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NZ_CP021399.1\|WP_029581375.1\|2748041_2748959_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80672e-62
NZ_CP021399.1\|WP_032962957.1\|2751884_2753009_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.96383e-58
NZ_CP021399.1\|WP_142097439.1\|2725771_2727001_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.19656e-159
NZ_CP021399.1\|WP_142098949.1\|2746510_2748055_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173873	cd08508, PBP2_NikA_DppA_OppA_like_1, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021399.1\|WP_095075242.1\|2735179_2735731_-\|hypothetical-protein	gnl\|CDD\|372042	pfam12318, FAD-SLDH, Membrane bound FAD containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria. Proteins in this family are typically between 168 and 189 amino acids in length. There is a conserved ALM sequence motif. This family is a membrane protein (FAD-SLDH) involved in oxidation of D-sorbitol to L-sorbose.	2.27058e-35
NZ_CP021399.1\|WP_032955771.1\|2728050_2730282_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.88414e-97
NZ_CP021399.1\|WP_029581383.1\|2733524_2735180_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.89685e-61
NZ_CP021399.1\|WP_029581370.1\|2753005_2753947_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40169e-121
NZ_CP021399.1\|WP_029581379.1\|2743863_2744463_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.89569e-110
NZ_CP021399.1\|WP_080700476.1\|2750427_2751888_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	2.13709e-28
NZ_CP021399.1\|WP_029581385.1\|2731516_2732020_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	1.44349e-69
NZ_CP021399.1\|WP_029581386.1\|2730497_2731520_-\|DUF4880-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	1.1192e-67
NZ_CP021399.1\|WP_029581373.1\|2750134_2750431_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.17053e-29
NZ_CP021399.1\|WP_142098955.1\|2749050_2750154_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	6.95059e-40

>NZ_CP021399.1|WP_029581381.1|2735910_2736237_+|hypothetical-protein
MELETAYWDGELVISVEPREVRMSHWIHAPRAWRALDGQLLFDLAGSDWDLCGVGGEDEDCLVLALRRYPGGAPARLLTIARGSLEMHLDGESLPAGELLPRLEARRP
>NZ_CP021399.1|WP_095075242.1|2735179_2735731_-|hypothetical-protein
MPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTDRQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIVAAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPPLLPTSKAL
>NZ_CP021399.1|WP_029581383.1|2733524_2735180_-|GMC-family-oxidoreductase
MTRQAEFQSNGDARADIIVVGSGVVGAMIADQLAARGHSVLILEAGLRIERGQAVENWRNMPFANRAGSDFQGLYPQSPDAPAPLYFPENNYVHLTGPSASSFKQGYLRTVGGTTWHWAASCWRHLPVDLRMKSAYGVGRDWPISYDELEPFYLQAENEMGVAGPNDPARQSPAERSGPYPMDMVPWAYGDQRFADVVNPHGYRSVPIPQGRSTQPWRGRPTCCGNNNCQPICPIGAMYNGIHHVQAAEEKGAIVLAQSVVYKIDTDENNRITAVHWYDAARRSHKATGQHFVLACNAMETPRLLLMAANARNPKGIANRSDQVGRNIMDHSGFHCYFQASEPLWPGRGPAQSSCLVGPRDGAFRAEYSANKMILNNITQVTLATKTALAQGLTGKALDAEIRRRAAHGVDLSISLEPLPDPNNRLTLSKTRRDPLGLPCPDVHYDVGDYVRKGAEAAHAQLRHIGSLFKATDFLITTQLNANNHMMGSVIMGSDPRDSVVDGDCRAHDHDNLWLPGGGAMPSASVVNSTLTMAALGLKTAAAIARRMEAA
>NZ_CP021399.1|WP_142098944.1|2732139_2733525_-|c-type-cytochrome
MKTLLCGLALALLPLGAHATDEARLIERGRMLSIAADCMACHTQAPSGKPYAGGYPIQSPLGTIYASNITPSTRAGIGGYSLEDFARAVRQGVRPDGSRLYPAMPYTSYTLITDEDIQALYTYFMKGVQPVDEPSPATDLPFPFGIRASMRVWNALFLEDKRFTPDPDQSAEVNRGAYLARALAHCSSCHTPRNALMAEDPKRPLGGGMVGPWHAPNISSDPQAGIGGWTNEEIVQYLRTGRVAGKGQAGGSMAEAVEHSFQHMPQADLAAIAAYLKSTPPVPADAAAPAAYARGAAISPEAGLRGADPQTANLSLKSGAALFSGYCASCHQAGGQGSAGQAYPSLFHNTATGAGSASNLIAAILYGVDRNVGGQHVLMPRFDAKSYVQPLSDAQIALIANYVLANYGNARLSVTPDDVRQARQGGPAPLLARAQPYMLPAAVTALLIVLLGLLLLRRRRA
>NZ_CP021399.1|WP_029581385.1|2731516_2732020_-|sigma-70-family-RNA-polymerase-sigma-factor
MHPATLETLYTDHHSWLRGWLHRRLGNTEQAADLAHDTFIRLLCSERVPAALDEPRAFLTTVAQRLVSNHWRREKLERAYLEALAQAPQALARSPEERAILLETLFELDRLLDGLPAVVRRAFLLSQLDGQTHAQVAQALGVSIPTVKRHIVRALARCCFADLSFHP
>NZ_CP021399.1|WP_029581386.1|2730497_2731520_-|DUF4880-domain-containing-protein
MKAGSTWYHATQEAAGIAPEVAERALQWLLDLREDATPQTRRAWAQWHDAHPDHARAWSRIESVMGQLRALSAPDSATAARSALLPRRRAGLKALAVLAMAGGSAWALRDTVAWREWAADQRTAIGQRRALTLPDGTHIVLNTHSAIDLRYGPAERRLYLVAGEVLIVTAPDRQAPPRPFLVQTRQGVARALGTEYSVRQHGNETCVSVLRGSVRIEPREHPGRGLLLAAGRHARYTAEGIAGDGPADERDLAWKDGFIMARGMRLADFLAELGRYTEASLSCDPAVAGLQVSGAFPTGDAEQVMAALAATLQLRLETQAPLWRARRLRLLAVTKFPVQG
>NZ_CP021399.1|WP_032955771.1|2728050_2730282_-|TonB-dependent-receptor
MLGRFGREAGVLLSFRPDVTQGLASPGLRGSYTVQAGLQQLLAGTGIQARPQAAGGYVLERSGGVAQLQPITVAASAAVDALPAPYAGGQIARGGGLGMLGTADVMDVPFNTTNYTAQALENQQARTLADIVINEASVRTLTSSGGFGEDFQIRGYTVSSGDVGLNGLYGLASSSRMPAAIMERVEVLKGPGTLMNGIGPNGSIGGGINVVTKRAGDDPLTRVTATYQDKSQLGGMVDMGRRFGQDNEWGIRVNGVYHNGDTTIDHGSQRQGVGALALDYRGPRLRGSLDAYTQQERTDNFRPQVGFQSSVTDLPSPPSGHRNFYPGTQLELKDSTVASRLEYDLNDSLTVYAAGGYRYGTANQTFPSGPVDQDGGFTVRNAFYDSYSRSSTGEIGLRARFDTWGVKHNLSLGATRLDQELGNFYITSTGTAASNIYHPAPLPEVTGHRGSPSKASETALTSFTLADTLSFADDRLMITGGLRQQRVALDNYSTATGDRTSSYDESAISPLAGVVFKPWSNVSLYGNFTSGLTRGGVAPATAANAGQVFAPYKSKQYEAGVKVDWGSVITSASVFQITRPNSMTDPDTNVYSFDGEQRNRGFELAATGEVTPGLRVMASATFYDAKITRSAGGVNDGNDANGVPDSAFNLGVDWDMPWVRGLSLNARVIHTSSAWFNAANTIRLPSWTRYDVGARYSTRVMGRAVVFRANIENLFNQTYWLASGTYATVAAPRAFLLSAQIDF
>NZ_CP021399.1|WP_142097442.1|2727026_2727926_-|amidohydrolase-family-protein
MTTSPPPGEVPFCLPPLPLPQQAPPAFEAPPLACDTHAHVVAADRRAYPMVAERSYTPHPATEQAYLAMLAANGMERGVLVQISVYGTDNRYMLEVLRRHPERLRGIGVVAPDIGDAQLRDMHEAGVRGLRINVLFGGGIGFDAMETLAHRIKDMGWHMQFLMDARQLPELLPRMRKLPVPGVVDHMGHMPVAEGLQSPGFQALAHLVQDHGWWVKLSGAYRISAQYDGYADVLPWAQALIAMAPDRMVWGSDWPHVHISPMVNTGKLRNQLAEWAPDPWTRQAILVDNPQRLYGFPSR
>NZ_CP021399.1|WP_142097439.1|2725771_2727001_-|MFS-transporter
MQWYRELNQTERRTFVAAFGGWAIDALDFMVFTFVISTLISLWGIEKGQAGMLGTVTLLFSAIGGWLAGILADRYGRVRVLQVTILWFSACTVAIGFAQNFEQLFVLRALQGLGFGGEWAVGSVLMGEIVRAEHRGKAVGTVQSGWAIGWGVAAILYTIAFSALPPEWAWRTLFWIGVIPALLVLYIRKHVPEPEVFQRARSQLEASAARPSFWMIFSPALLKTTVITALLCTGVQGGYYAITTWLPTFLKTERHLSVMGTGGYLMVIIVGSFCGYIAGAYLADRLGRRANLLIFSVLSGLSVYVYTLVPLTDAQMLVLGFPLGFAASGIFSGVGAYLTELFPTEVRANGQGFAYNFGRGIGALFPSLVGFLSQTQGLAWAIGAFATGAYAIVIVTALLLPETRGRVLK
>NZ_CP021399.1|WP_032978228.1|2725074_2725698_-|response-regulator-transcription-factor
MTTVLLVDDHTMFREGLALALQHTAPALQLLPAATGAQALALLDDLRGIDLVVMDYYLPDMAGTELLRRLRQRRPQLRILVLSASEDPEDRRRALEAGAQDYLHKSASSRTLASALAALGQARPGMPAAAGAAPDAAALLRALTPRQLDVLRLICDGLRNKAISEQLNMSEKTVKSHVSAILGTLGVLNRTQAALVARRGGLFGKPA
>NZ_CP021399.1|WP_029581379.1|2743863_2744463_+|nitroreductase-family-protein
MSNAYIEALKQRRTQYALGRNVSLSKDALVALIQDAVKHSPSSFNSQTSRALVLFGAESEKLWALAIDEVRKVAPAEGFDKTEAKLKSFAAGVGTVLFFEDQDVVRGLQEKFALYADNFPVWSEQASGMAQLSVWSALANAGVGASLQHYNPLIDAAVAREWKVPASWKLRAQMPFGSNEAPKSEKAFMDDADRFIVAG
>NZ_CP021399.1|WP_032955754.1|2744582_2745449_-|glutathione-dependent-disulfide-bond-oxidoreductase
MTTEYFPPKVWTWNKNSASTASNASSLNRPIAGATHEKTLPVGRHPLQLYSLGTPNGQKVTILLEELLARGHAQAEYDAWLIRIGEGDQFGSGFVDINPNSKIPALVDRSGDTPIRVFESGAILLYLAEKFGDFLPADPAARAECLSWLFWQMGSAPYVGGGFGHFYAYAPVKIEYAIDRFTMETKRQLDVLDRRLAEHEYLAGDQYTIADIAVFPWYGGLIKGWLYDAAEFLAVHEYRHVQRWADALLARPAVDRGRIVNRLRGPLSEQLHERHDASDFDTKTADKT
>NZ_CP021399.1|WP_080700822.1|2745550_2746240_-|alpha/beta-hydrolase
MAAAFIHGAPGSMLAAAAGKTETHFFAGPAGAMEVLADAPAQAPRGIALVTHPQPLLGGSPRHKIPHRLAHGLRDDGWLALRPAFRGVAGSAGHYDHGDGESEDILALARALRAQAPALPLALVGFSFGAYVQARVARALLDAGTPADRVVLAGLPVGEVPAERVYDTPPLPEEVVLIHGENDAQAPLAPLLEWARPNGHPVIVVPGADHFFSRSLPLLLKLVRQHLAA
>NZ_CP021399.1|WP_142098949.1|2746510_2748055_+|polyamine-ABC-transporter-substrate-binding-protein
MRCGLALALTACGLGSSAWAEERPMLRLSSGAADNATLDPHRATSTADKGVAAEMFNALVRFPPGSADPKALEPDLAERWEASPDSKTWTFHLRRGVQFHGGYGELKAEDVVYSIQRAADPNRSSFAATFGLIDKVEAVDDHTVRFTLKYPDAAFLGRVSNYHGGNIVSKKAAEKLGDKFGGSPVGTGPFAFGQHVTQQYVKLVANDSYFRGKPKLAGIMYRMIPSDSARELAFTSNEIDVMQGKREQRWVERSAKRGMQVDIFEPAEFRTLHINRNIKPLDNLKVREAIAAAINVDEIVRYAGKDVADKGCSVVPNGYLGQDCGAGAYAYDAGRAKQLLAEAGFPDGIQIKSVVSNISAQQPIMEIVQAQLAKAGIKLDMEVVDHATYQAKSRQDLSALVFYGAARFPNADTYLTEFYDSAAAIGAPGAMSNFSHCSVADEAIRQARIEPDAQKQLALWKDAQARIRADVCAVPLFGLKQVWVHSERVNYGYKLDGALNLQPPITEQTAVTAP
>NZ_CP021399.1|WP_029581375.1|2748041_2748959_-|LysR-family-transcriptional-regulator
MKNILNLRQIEAFKAVIEHGTVSQAATALGVSQPAVSKLLTHLEADSGLALFERVRGKLAPTAQGMRLYREVDRVFNGLRQLEQAVESIRRAEQRTLNVGVLPALAGAFIRRVSMQFLRRHPDVRISIQSRGSLFLADWLATRHIDVALVGSRVDNPYIEREPLFRQPLVCALPPNHVLTRKRVIRPRDLAGLPFISFGPESQTHQLVQQAFDAAGLPVNVALDTNTAPTACEFVAAGLGVSLIHPLFAEGMQSRLVLRRFDPELHFHFQLCRAQASRNAALVEDFVQEVRDVAAQVSREVLKGQ
>NZ_CP021399.1|WP_142098955.1|2749050_2750154_+|FAD-dependent-oxidoreductase
MAGAGMVGAAIAYGLAGLGQRVLLVDGGDTDYRAAKANFGLVWLQGKGHGNPDYQRLSHRSVLDWPDFARELQAESGIDLQYERRGGLHFCLGEADLQARAARMQAWRRQAPEVGDCVSILARDELLRRFPGLDLGPEVSGASVGELDGHANPLRLLAALQAVFLRRGGTLWGNAPVRAIRPLDGGGFEIEAGGRRARGARLVIAAGLGSAALGAQVGLAVPLRPQRGQILVTERLAPLLPVPASGIRQTGEGTVMVGLTQEEVGYDLSTTTEAAVHMSRNALRILPALAQARLVRHWSCLRVMTPDGCPVYAQSQPFPGAFVALCHSGVTLAALHAGRYARALASGAPPSFLDVFHHERFNVQKVA
>NZ_CP021399.1|WP_029581373.1|2750134_2750431_+|(2Fe-2S)-binding-protein
MFRKLHESGAASLTLTIDGQPVRAEPGESVAAVLLRQDTPASRSTPVNESPRAPYCMMGVCFECLAIIDGVASTQACMVPVRDGMRVERQHGKRSVQA
>NZ_CP021399.1|WP_080700476.1|2750427_2751888_+|FAD-dependent-oxidoreductase
MKREFDVVVIGAGPAGMSAAIRLREQHMRVLVVDEQPAPGGQIWRAVETVAGTRTGRLLGDEYRAGAALAERFRQCGAVYEPQTQVWQIETGWHVYMTRGGRAQAVRADQVLLAIGAQERPAPFPGWTLPGVLTVGAAQILLKTSNQVPAAPVWVAGSGPLPLLYMAQLLRAGGQIAGWLDTSAPGAWRRALPWAGAALASWGDIRKGLGWLRELKAAGVRRVRGVTGLRALGEGALREIEYTLADGSLRREPASVLLSHEGVVPSIHMTRALECAHHWDARQSCLAPDLDDWGQTSREGVYVAGDAAGIGGALAACARGELAALGMALRAGRMTAQAAGQAAAPLREKLRGLLRIRPMLDEMYPPRAGIFNPPDETIVCRCEELTAGDIRRAARIGQPGPNQVKSYTRAGMGPCQGRQCGYTVAHIVAAEERRPVSEVGFYRIRPPLKPLTLGELASLDVGDDGVVLAGAPESPGEAPAAREPRP
>NZ_CP021399.1|WP_032962957.1|2751884_2753009_+|FAD-binding-oxidoreductase
MSAPVFDVAVIGGGLHGLSAALHIARQGKRVVVIERHWTGRHASGATAAGVRTLNRDRRELDLSMEALDMWHDMASLVGDDCGFHAHGQICVAETEQGLAKLAGRVDSLRAAGYAHEEIIDAAELRRLLPALSPHCVGASIARRDGAADPHRALRAFRASAEAAGVTLVEHCAVTGLRRQGADWRVVTERGDWVVPAVVNAAGAWSARIAAMAGDEIPLATKSSMMMVSERLRPFIKPVVAIVGRSLSFKQSDQGTLVIGGGLQGTPDLDRETSTARMRVLAKGARAATDLFPMVRDIRIVRVWAGLEAKTEDLLPVIGPSPRAPGVFHAFGFSGHGFELVPVVGAVMADLVLRGATARPIGALQAARLMGGQP
>NZ_CP021399.1|WP_029581370.1|2753005_2753947_+|ABC-transporter-permease
MIRYAIKRLLLAIPTLLAMLTAVFILVRLVPGDPAAVMLGDQASAEALAALRLRLGLDLPTHEQYLRFLGDMLTGNFGVSMASGRTVLQEVGQVLPWTLQLTAAAILIGVVFGLPLGIWAALRRNAWPDYLGRLLSLTGLSFPAFVSAILMLLVFAIQLRWFPVIGSSAATDWGTQLRNLALPAFNLGLIMMAYVMRVTRSSMLGVMGEDYVRTARAKGLRPLRLIMRHGLRNALIPIVTVVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFAACVILVNLLTDLVYGLVDPRVKYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021399_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021399_3

2743250-2743479

Orphan

Consensus_repeat	Method
CGCCGCCCGCGCCGCCGCCCGCG	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP021399_3

>merge|NZ_CP021399|3|2743250-2743479|CRISPRCasFinder
TGGCGCCCAGCCCGCCGCCGCCGCCGGTGTATATCGCGGACATGCCGCCGCCGCCGCCGCCCAGGCCGGCGCTGCCGCCTGTTTGGGGCGCGCCGCCCGCGCCGCCGCCCGCGCCCGGACTGCTGCCGCCTGTCGGGGCCACGCCATCGGCGCCGGCGCGCAGCCCGCCGCCCGCGCCGCCGGCCGCGTAGCCGGCGTTCAAGGTGGGGCCGCCCGCGCCGCCGCCTCCG

>NZ_CP021399|3|3|2743250-2743479|CRISPRCasFinder
TGGCGCCCAGCCCGCCGCCGCCG	CCGGTGTATATCGCGGACA
TGCCGCCGCCGCCGCCGCCCAGG	CCGGCGCTGCCGCCTGTTTGGGGCG
CGCCGCCCGCGCCGCCGCCCGCG	CCCGGACTGCTGCCGCCTGTCGGGGCCACGCCATCGGCGC
CGGCGCGCAGCCCGCCGCCCGCG	CCGCCGGCCGCGTAGCCGGCGTTCAAGGTGG
GGCCGCCCGCGCCGCCGCCTCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021399.1\|WP_142097442.1\|2727026_2727926_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP021399.1\|WP_080700822.1\|2745550_2746240_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP021399.1\|WP_032962957.1\|2751884_2753009_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021399.1\|WP_142098944.1\|2732139_2733525_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|129864
NZ_CP021399.1\|WP_032955754.1\|2744582_2745449_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NZ_CP021399.1\|WP_029581375.1\|2748041_2748959_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP021399.1\|WP_142097439.1\|2725771_2727001_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP021399.1\|WP_080700476.1\|2750427_2751888_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_CP021399.1\|WP_142098949.1\|2746510_2748055_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173873
NZ_CP021399.1\|WP_095075242.1\|2735179_2735731_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372042
NZ_CP021399.1\|WP_032955771.1\|2728050_2730282_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021399.1\|WP_029581383.1\|2733524_2735180_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP021399.1\|WP_029581370.1\|2753005_2753947_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP021399.1\|WP_029581379.1\|2743863_2744463_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP021399.1\|WP_029581381.1\|2735910_2736237_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021399.1\|WP_029581385.1\|2731516_2732020_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP021399.1\|WP_029581386.1\|2730497_2731520_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP021399.1\|WP_029581373.1\|2750134_2750431_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP021399.1\|WP_142097445.1\|2736233_2743199_-\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
NZ_CP021399.1\|WP_142098955.1\|2749050_2750154_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737

Protein	Function_ID	Function_description	E-value
NZ_CP021399.1\|WP_142097442.1\|2727026_2727926_-\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	1.20446e-76
NZ_CP021399.1\|WP_080700822.1\|2745550_2746240_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	3.42781e-46
NZ_CP021399.1\|WP_032962957.1\|2751884_2753009_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.96383e-58
NZ_CP021399.1\|WP_142098944.1\|2732139_2733525_-\|c-type-cytochrome	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	3.55009e-09
NZ_CP021399.1\|WP_032955754.1\|2744582_2745449_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NZ_CP021399.1\|WP_029581375.1\|2748041_2748959_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80672e-62
NZ_CP021399.1\|WP_142097439.1\|2725771_2727001_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.19656e-159
NZ_CP021399.1\|WP_142098949.1\|2746510_2748055_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173873	cd08508, PBP2_NikA_DppA_OppA_like_1, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021399.1\|WP_095075242.1\|2735179_2735731_-\|hypothetical-protein	gnl\|CDD\|372042	pfam12318, FAD-SLDH, Membrane bound FAD containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria. Proteins in this family are typically between 168 and 189 amino acids in length. There is a conserved ALM sequence motif. This family is a membrane protein (FAD-SLDH) involved in oxidation of D-sorbitol to L-sorbose.	2.27058e-35
NZ_CP021399.1\|WP_032955771.1\|2728050_2730282_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.88414e-97
NZ_CP021399.1\|WP_029581383.1\|2733524_2735180_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.89685e-61
NZ_CP021399.1\|WP_029581370.1\|2753005_2753947_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40169e-121
NZ_CP021399.1\|WP_029581379.1\|2743863_2744463_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.89569e-110
NZ_CP021399.1\|WP_080700476.1\|2750427_2751888_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	2.13709e-28
NZ_CP021399.1\|WP_029581385.1\|2731516_2732020_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	1.44349e-69
NZ_CP021399.1\|WP_029581386.1\|2730497_2731520_-\|DUF4880-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	1.1192e-67
NZ_CP021399.1\|WP_029581373.1\|2750134_2750431_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.17053e-29
NZ_CP021399.1\|WP_142097445.1\|2736233_2743199_-\|autotransporter-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	2.76386e-40
NZ_CP021399.1\|WP_142098955.1\|2749050_2750154_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	6.95059e-40

>NZ_CP021399.1|WP_142097445.1|2736233_2743199_-|autotransporter-domain-containing-protein
MTELVTGATQPAAGYGGGGARASSGAMLTSGHASTDVLGVGGGGGGGGASNGGSGTAGSLTLSRSDVSILGSALVGGGGGGGGYIGNGGAGGDGTLTLLDGTSLSVGDTLLVGGSAGGRGEGLGGAGGAGKIDMVDSTIVIGKNLILGGYSSSSATGGSGELSIGTTTNGAAAINFQPGASFTINPNGTLRVGVALYGAAFNGLDRLTNNGNIFLTQADASYVFRPGLTGNGKVTINTIGTTILNGDLSAYNGSIAAVGLGALQIGDAGSTWASASGQISGDSQLIFGQDADLIFGGSIAGSGGLTHAGTGRLTLTRTNQVNGEIVVDRGTLALDGGSLIAPSGKLSVGTAANAGVELRNGAMLETHDANVGVAGTGSVKIGGGSSWLSNFAYIGYTNTGSLVIDSGGTATSARGVVGLAGDGSVMVSDAGSRWEASTGLLMNPQGGRQSSLTIANGGTVTARQVELGSGGGTGKSTISLQGDSTARGVLETGGIILHGADAALDFSGGILKATQDSTDFLSNIGAAQTQLTGGGLLFDTNGHQVTITSQLNGTGDLSKLGTGTLTVNRIDSTGAVGVLAGTLKLGSSQAMVTGANSVSVADGAILDLNGYEATVGRLAGDGRVAVNDAVLTVGGSNQDSTFGGIISGTGRLTKTGTGKLTLTGANDYTGMTYILAGTLAAGAANTLGRGSLAVGSPAVLDLGAYSQTVGDFLGTGTVALGGATLTTNTTGSTIFFGRLTGTGNFVKQGGGVVSLAGTSDYVGTTHVQQGSLLFLNSAALAPGALRIDAGASAYLDPAGIYSVSSLAGGGVLDLGSAPLNVGDSNSTQFTGVLAGTGGALFKTNTGTLTLSGDNTYSGNTGVLGGTLRVDGSIARSSSVTVYAGGTLAGEGVVSATTVKAGGILAPGSAGSVLTVNGALTLEQGSRLNVVLGAPGTPAAPGASSGLRVAGDLSLDGTLNLASSASDLIGYYRLISYGGALSGNGLTIGNTPVGYLPAQFTTVQNVPGNIDLKVTTLGDNALQTWQGAGGSWTTAGAQWFNDGGQTPVAWAGNHAVFMGTAGTVSVDNAASFKGLQFVSDGWQLAGAAALTTDAGGSEVRVLAGNTAAIATAIQGSGGLNKTEGGTLVLSGANGYTGGTTVSGGVLSVSSDANLGLGIGGVTLNGGTLRVSNTGYGSTARDLTVGAGNGALDLAGDFHLNGHLSGNGSLSKLGTGTLFLEQGSSAFTGTLALAAGALSAQAVNALGASAVTLAGGATLALNGYSQTLKSLAGAGNVQLGAAMLRTGADNTSTTLSGAITGTGSLIKQGTGNFTLSGANLYSGGTSIESGTLTAGRGQVLGTGGLTVANGALMDFNGYDQTLTTLDGAGEVRLGSAALTVGAGDLDSHFAGALDGDGSLTKLGAGTLTLSGTSHYTGPTTVSAGTLAVDGAISGSALQVASGARLAGNGTVGSTTVASGGRLAPSGLGSLHIAGNLSLAAGAALDYQLGAPGTPSAPGAGSHLQVDGDLSLNGTLNLDDSAGGLGYYRLIRYGGALSGGGLVLGASHLDAGQYRIVQNLPGSIDLRIGTVGSNLLQTWTGGNGVWNTSTQDWTNDGGDLPVAWAGNHAVFMQNGGARIDVQGSPSFAGLQFVADGYRLQGNGRLLTQAGGSEIRVLGGNTATIATAIGGAGGIDKTEGGTLVLAGANDYAGGTRISGGVLAVSREANLGSGGLTLNGGTLRIADAGYAVSARAIEVQAAGGALDLPHDFTLQGALSGSGALIKRGAGLLTLTADSSAYRGAATLAAGGLWLGDAARLGGTLTARDGTLLGGTGTLGSTTVQAGAVHSPGSPIGTQTIVGDYVNRGTLRIDATPSDHDRLAVSGGVDIAGATLDLRLSPDDAASWKPRTGPYTLIAKQSPGAVVGEFARLNNPLLFMNASVDTRGGDGNDVTLTLQRNDLSLASLALTANQRAVAGSIEGLPDSHEVWRTVMLSTDAAALGQALSQLSGDTHAGVVSALRAAGPAPAAQNGLAALRGNLAAPMAPGAPTAAAGASDAPAAPAALPTRATAPLWAQVSGDWMRLASDGNTAAIQQSSTNLSLGGDAAVGGGWRLGGAFGYTNARISGQDRAASAKTDSYTATLYGGKAFALGQGKLNVLAGAAYSWHDIDSRRQVRYGSLDQTLKADYGASSTQLFAEVGYALPLGAQASIEPFAGLSWNNLRMRGFAESGGSAALSGQAQSDNTTSTLAGLRGQWQLPDSAIALRGLLGWRHAYGTLRPSSTLAFDQGPAFSVAGAPIARDAARVELGADLVVVRNMTAGLAYAGEFGGGNRQHTGTLNVRWQF
>NZ_CP021399.1|WP_029581381.1|2735910_2736237_+|hypothetical-protein
MELETAYWDGELVISVEPREVRMSHWIHAPRAWRALDGQLLFDLAGSDWDLCGVGGEDEDCLVLALRRYPGGAPARLLTIARGSLEMHLDGESLPAGELLPRLEARRP
>NZ_CP021399.1|WP_095075242.1|2735179_2735731_-|hypothetical-protein
MPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTDRQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIVAAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPPLLPTSKAL
>NZ_CP021399.1|WP_029581383.1|2733524_2735180_-|GMC-family-oxidoreductase
MTRQAEFQSNGDARADIIVVGSGVVGAMIADQLAARGHSVLILEAGLRIERGQAVENWRNMPFANRAGSDFQGLYPQSPDAPAPLYFPENNYVHLTGPSASSFKQGYLRTVGGTTWHWAASCWRHLPVDLRMKSAYGVGRDWPISYDELEPFYLQAENEMGVAGPNDPARQSPAERSGPYPMDMVPWAYGDQRFADVVNPHGYRSVPIPQGRSTQPWRGRPTCCGNNNCQPICPIGAMYNGIHHVQAAEEKGAIVLAQSVVYKIDTDENNRITAVHWYDAARRSHKATGQHFVLACNAMETPRLLLMAANARNPKGIANRSDQVGRNIMDHSGFHCYFQASEPLWPGRGPAQSSCLVGPRDGAFRAEYSANKMILNNITQVTLATKTALAQGLTGKALDAEIRRRAAHGVDLSISLEPLPDPNNRLTLSKTRRDPLGLPCPDVHYDVGDYVRKGAEAAHAQLRHIGSLFKATDFLITTQLNANNHMMGSVIMGSDPRDSVVDGDCRAHDHDNLWLPGGGAMPSASVVNSTLTMAALGLKTAAAIARRMEAA
>NZ_CP021399.1|WP_142098944.1|2732139_2733525_-|c-type-cytochrome
MKTLLCGLALALLPLGAHATDEARLIERGRMLSIAADCMACHTQAPSGKPYAGGYPIQSPLGTIYASNITPSTRAGIGGYSLEDFARAVRQGVRPDGSRLYPAMPYTSYTLITDEDIQALYTYFMKGVQPVDEPSPATDLPFPFGIRASMRVWNALFLEDKRFTPDPDQSAEVNRGAYLARALAHCSSCHTPRNALMAEDPKRPLGGGMVGPWHAPNISSDPQAGIGGWTNEEIVQYLRTGRVAGKGQAGGSMAEAVEHSFQHMPQADLAAIAAYLKSTPPVPADAAAPAAYARGAAISPEAGLRGADPQTANLSLKSGAALFSGYCASCHQAGGQGSAGQAYPSLFHNTATGAGSASNLIAAILYGVDRNVGGQHVLMPRFDAKSYVQPLSDAQIALIANYVLANYGNARLSVTPDDVRQARQGGPAPLLARAQPYMLPAAVTALLIVLLGLLLLRRRRA
>NZ_CP021399.1|WP_029581385.1|2731516_2732020_-|sigma-70-family-RNA-polymerase-sigma-factor
MHPATLETLYTDHHSWLRGWLHRRLGNTEQAADLAHDTFIRLLCSERVPAALDEPRAFLTTVAQRLVSNHWRREKLERAYLEALAQAPQALARSPEERAILLETLFELDRLLDGLPAVVRRAFLLSQLDGQTHAQVAQALGVSIPTVKRHIVRALARCCFADLSFHP
>NZ_CP021399.1|WP_029581386.1|2730497_2731520_-|DUF4880-domain-containing-protein
MKAGSTWYHATQEAAGIAPEVAERALQWLLDLREDATPQTRRAWAQWHDAHPDHARAWSRIESVMGQLRALSAPDSATAARSALLPRRRAGLKALAVLAMAGGSAWALRDTVAWREWAADQRTAIGQRRALTLPDGTHIVLNTHSAIDLRYGPAERRLYLVAGEVLIVTAPDRQAPPRPFLVQTRQGVARALGTEYSVRQHGNETCVSVLRGSVRIEPREHPGRGLLLAAGRHARYTAEGIAGDGPADERDLAWKDGFIMARGMRLADFLAELGRYTEASLSCDPAVAGLQVSGAFPTGDAEQVMAALAATLQLRLETQAPLWRARRLRLLAVTKFPVQG
>NZ_CP021399.1|WP_032955771.1|2728050_2730282_-|TonB-dependent-receptor
MLGRFGREAGVLLSFRPDVTQGLASPGLRGSYTVQAGLQQLLAGTGIQARPQAAGGYVLERSGGVAQLQPITVAASAAVDALPAPYAGGQIARGGGLGMLGTADVMDVPFNTTNYTAQALENQQARTLADIVINEASVRTLTSSGGFGEDFQIRGYTVSSGDVGLNGLYGLASSSRMPAAIMERVEVLKGPGTLMNGIGPNGSIGGGINVVTKRAGDDPLTRVTATYQDKSQLGGMVDMGRRFGQDNEWGIRVNGVYHNGDTTIDHGSQRQGVGALALDYRGPRLRGSLDAYTQQERTDNFRPQVGFQSSVTDLPSPPSGHRNFYPGTQLELKDSTVASRLEYDLNDSLTVYAAGGYRYGTANQTFPSGPVDQDGGFTVRNAFYDSYSRSSTGEIGLRARFDTWGVKHNLSLGATRLDQELGNFYITSTGTAASNIYHPAPLPEVTGHRGSPSKASETALTSFTLADTLSFADDRLMITGGLRQQRVALDNYSTATGDRTSSYDESAISPLAGVVFKPWSNVSLYGNFTSGLTRGGVAPATAANAGQVFAPYKSKQYEAGVKVDWGSVITSASVFQITRPNSMTDPDTNVYSFDGEQRNRGFELAATGEVTPGLRVMASATFYDAKITRSAGGVNDGNDANGVPDSAFNLGVDWDMPWVRGLSLNARVIHTSSAWFNAANTIRLPSWTRYDVGARYSTRVMGRAVVFRANIENLFNQTYWLASGTYATVAAPRAFLLSAQIDF
>NZ_CP021399.1|WP_142097442.1|2727026_2727926_-|amidohydrolase-family-protein
MTTSPPPGEVPFCLPPLPLPQQAPPAFEAPPLACDTHAHVVAADRRAYPMVAERSYTPHPATEQAYLAMLAANGMERGVLVQISVYGTDNRYMLEVLRRHPERLRGIGVVAPDIGDAQLRDMHEAGVRGLRINVLFGGGIGFDAMETLAHRIKDMGWHMQFLMDARQLPELLPRMRKLPVPGVVDHMGHMPVAEGLQSPGFQALAHLVQDHGWWVKLSGAYRISAQYDGYADVLPWAQALIAMAPDRMVWGSDWPHVHISPMVNTGKLRNQLAEWAPDPWTRQAILVDNPQRLYGFPSR
>NZ_CP021399.1|WP_142097439.1|2725771_2727001_-|MFS-transporter
MQWYRELNQTERRTFVAAFGGWAIDALDFMVFTFVISTLISLWGIEKGQAGMLGTVTLLFSAIGGWLAGILADRYGRVRVLQVTILWFSACTVAIGFAQNFEQLFVLRALQGLGFGGEWAVGSVLMGEIVRAEHRGKAVGTVQSGWAIGWGVAAILYTIAFSALPPEWAWRTLFWIGVIPALLVLYIRKHVPEPEVFQRARSQLEASAARPSFWMIFSPALLKTTVITALLCTGVQGGYYAITTWLPTFLKTERHLSVMGTGGYLMVIIVGSFCGYIAGAYLADRLGRRANLLIFSVLSGLSVYVYTLVPLTDAQMLVLGFPLGFAASGIFSGVGAYLTELFPTEVRANGQGFAYNFGRGIGALFPSLVGFLSQTQGLAWAIGAFATGAYAIVIVTALLLPETRGRVLK
>NZ_CP021399.1|WP_029581379.1|2743863_2744463_+|nitroreductase-family-protein
MSNAYIEALKQRRTQYALGRNVSLSKDALVALIQDAVKHSPSSFNSQTSRALVLFGAESEKLWALAIDEVRKVAPAEGFDKTEAKLKSFAAGVGTVLFFEDQDVVRGLQEKFALYADNFPVWSEQASGMAQLSVWSALANAGVGASLQHYNPLIDAAVAREWKVPASWKLRAQMPFGSNEAPKSEKAFMDDADRFIVAG
>NZ_CP021399.1|WP_032955754.1|2744582_2745449_-|glutathione-dependent-disulfide-bond-oxidoreductase
MTTEYFPPKVWTWNKNSASTASNASSLNRPIAGATHEKTLPVGRHPLQLYSLGTPNGQKVTILLEELLARGHAQAEYDAWLIRIGEGDQFGSGFVDINPNSKIPALVDRSGDTPIRVFESGAILLYLAEKFGDFLPADPAARAECLSWLFWQMGSAPYVGGGFGHFYAYAPVKIEYAIDRFTMETKRQLDVLDRRLAEHEYLAGDQYTIADIAVFPWYGGLIKGWLYDAAEFLAVHEYRHVQRWADALLARPAVDRGRIVNRLRGPLSEQLHERHDASDFDTKTADKT
>NZ_CP021399.1|WP_080700822.1|2745550_2746240_-|alpha/beta-hydrolase
MAAAFIHGAPGSMLAAAAGKTETHFFAGPAGAMEVLADAPAQAPRGIALVTHPQPLLGGSPRHKIPHRLAHGLRDDGWLALRPAFRGVAGSAGHYDHGDGESEDILALARALRAQAPALPLALVGFSFGAYVQARVARALLDAGTPADRVVLAGLPVGEVPAERVYDTPPLPEEVVLIHGENDAQAPLAPLLEWARPNGHPVIVVPGADHFFSRSLPLLLKLVRQHLAA
>NZ_CP021399.1|WP_142098949.1|2746510_2748055_+|polyamine-ABC-transporter-substrate-binding-protein
MRCGLALALTACGLGSSAWAEERPMLRLSSGAADNATLDPHRATSTADKGVAAEMFNALVRFPPGSADPKALEPDLAERWEASPDSKTWTFHLRRGVQFHGGYGELKAEDVVYSIQRAADPNRSSFAATFGLIDKVEAVDDHTVRFTLKYPDAAFLGRVSNYHGGNIVSKKAAEKLGDKFGGSPVGTGPFAFGQHVTQQYVKLVANDSYFRGKPKLAGIMYRMIPSDSARELAFTSNEIDVMQGKREQRWVERSAKRGMQVDIFEPAEFRTLHINRNIKPLDNLKVREAIAAAINVDEIVRYAGKDVADKGCSVVPNGYLGQDCGAGAYAYDAGRAKQLLAEAGFPDGIQIKSVVSNISAQQPIMEIVQAQLAKAGIKLDMEVVDHATYQAKSRQDLSALVFYGAARFPNADTYLTEFYDSAAAIGAPGAMSNFSHCSVADEAIRQARIEPDAQKQLALWKDAQARIRADVCAVPLFGLKQVWVHSERVNYGYKLDGALNLQPPITEQTAVTAP
>NZ_CP021399.1|WP_029581375.1|2748041_2748959_-|LysR-family-transcriptional-regulator
MKNILNLRQIEAFKAVIEHGTVSQAATALGVSQPAVSKLLTHLEADSGLALFERVRGKLAPTAQGMRLYREVDRVFNGLRQLEQAVESIRRAEQRTLNVGVLPALAGAFIRRVSMQFLRRHPDVRISIQSRGSLFLADWLATRHIDVALVGSRVDNPYIEREPLFRQPLVCALPPNHVLTRKRVIRPRDLAGLPFISFGPESQTHQLVQQAFDAAGLPVNVALDTNTAPTACEFVAAGLGVSLIHPLFAEGMQSRLVLRRFDPELHFHFQLCRAQASRNAALVEDFVQEVRDVAAQVSREVLKGQ
>NZ_CP021399.1|WP_142098955.1|2749050_2750154_+|FAD-dependent-oxidoreductase
MAGAGMVGAAIAYGLAGLGQRVLLVDGGDTDYRAAKANFGLVWLQGKGHGNPDYQRLSHRSVLDWPDFARELQAESGIDLQYERRGGLHFCLGEADLQARAARMQAWRRQAPEVGDCVSILARDELLRRFPGLDLGPEVSGASVGELDGHANPLRLLAALQAVFLRRGGTLWGNAPVRAIRPLDGGGFEIEAGGRRARGARLVIAAGLGSAALGAQVGLAVPLRPQRGQILVTERLAPLLPVPASGIRQTGEGTVMVGLTQEEVGYDLSTTTEAAVHMSRNALRILPALAQARLVRHWSCLRVMTPDGCPVYAQSQPFPGAFVALCHSGVTLAALHAGRYARALASGAPPSFLDVFHHERFNVQKVA
>NZ_CP021399.1|WP_029581373.1|2750134_2750431_+|(2Fe-2S)-binding-protein
MFRKLHESGAASLTLTIDGQPVRAEPGESVAAVLLRQDTPASRSTPVNESPRAPYCMMGVCFECLAIIDGVASTQACMVPVRDGMRVERQHGKRSVQA
>NZ_CP021399.1|WP_080700476.1|2750427_2751888_+|FAD-dependent-oxidoreductase
MKREFDVVVIGAGPAGMSAAIRLREQHMRVLVVDEQPAPGGQIWRAVETVAGTRTGRLLGDEYRAGAALAERFRQCGAVYEPQTQVWQIETGWHVYMTRGGRAQAVRADQVLLAIGAQERPAPFPGWTLPGVLTVGAAQILLKTSNQVPAAPVWVAGSGPLPLLYMAQLLRAGGQIAGWLDTSAPGAWRRALPWAGAALASWGDIRKGLGWLRELKAAGVRRVRGVTGLRALGEGALREIEYTLADGSLRREPASVLLSHEGVVPSIHMTRALECAHHWDARQSCLAPDLDDWGQTSREGVYVAGDAAGIGGALAACARGELAALGMALRAGRMTAQAAGQAAAPLREKLRGLLRIRPMLDEMYPPRAGIFNPPDETIVCRCEELTAGDIRRAARIGQPGPNQVKSYTRAGMGPCQGRQCGYTVAHIVAAEERRPVSEVGFYRIRPPLKPLTLGELASLDVGDDGVVLAGAPESPGEAPAAREPRP
>NZ_CP021399.1|WP_032962957.1|2751884_2753009_+|FAD-binding-oxidoreductase
MSAPVFDVAVIGGGLHGLSAALHIARQGKRVVVIERHWTGRHASGATAAGVRTLNRDRRELDLSMEALDMWHDMASLVGDDCGFHAHGQICVAETEQGLAKLAGRVDSLRAAGYAHEEIIDAAELRRLLPALSPHCVGASIARRDGAADPHRALRAFRASAEAAGVTLVEHCAVTGLRRQGADWRVVTERGDWVVPAVVNAAGAWSARIAAMAGDEIPLATKSSMMMVSERLRPFIKPVVAIVGRSLSFKQSDQGTLVIGGGLQGTPDLDRETSTARMRVLAKGARAATDLFPMVRDIRIVRVWAGLEAKTEDLLPVIGPSPRAPGVFHAFGFSGHGFELVPVVGAVMADLVLRGATARPIGALQAARLMGGQP
>NZ_CP021399.1|WP_029581370.1|2753005_2753947_+|ABC-transporter-permease
MIRYAIKRLLLAIPTLLAMLTAVFILVRLVPGDPAAVMLGDQASAEALAALRLRLGLDLPTHEQYLRFLGDMLTGNFGVSMASGRTVLQEVGQVLPWTLQLTAAAILIGVVFGLPLGIWAALRRNAWPDYLGRLLSLTGLSFPAFVSAILMLLVFAIQLRWFPVIGSSAATDWGTQLRNLALPAFNLGLIMMAYVMRVTRSSMLGVMGEDYVRTARAKGLRPLRLIMRHGLRNALIPIVTVVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFAACVILVNLLTDLVYGLVDPRVKYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP021399_2	2.1\|2743048\|16\|NZ_CP021399\|CRISPRCasFinder	2743048-2743063	16	NZ_CP021399.1	3723364-3723379	0	1.0

1. spacer 2.1|2743048|16|NZ_CP021399|CRISPRCasFinder matches to position: 3723364-3723379, mismatch: 0, identity: 1.0

ttggaggcgccgccgc	CRISPR spacer
ttggaggcgccgccgc	Protospacer
****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021399_3	3.2\|2743315\|25\|NZ_CP021399\|CRISPRCasFinder	2743315-2743339	25	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	116740-116764	2	0.92
NZ_CP021399_3	3.2\|2743315\|25\|NZ_CP021399\|CRISPRCasFinder	2743315-2743339	25	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	151581-151605	4	0.84
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP010991	Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence	45761-45791	7	0.774
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	354803-354833	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP036488	Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence	4539-4569	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	35678-35708	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	45450-45480	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	45311-45341	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	45408-45438	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	45408-45438	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	45313-45343	8	0.742
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP053443	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eC, complete sequence	129196-129226	9	0.71
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	550932-550962	9	0.71
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	299300-299330	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP049319	Caballeronia sp. SBC2 plasmid pSBC2-3, complete sequence	553242-553272	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	291814-291844	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	299484-299514	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	748834-748864	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	179921-179951	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP034542	Brevibacillus sp. SCSIO 07484 plasmid unnamed, complete sequence	37792-37822	10	0.677
NZ_CP021399_3	3.4\|2743426\|31\|NZ_CP021399\|CRISPRCasFinder	2743426-2743456	31	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	437444-437474	10	0.677

1. spacer 3.2|2743315|25|NZ_CP021399|CRISPRCasFinder matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 2, identity: 0.92

ccggcgctgccgcctgtttggggcg	CRISPR spacer
ccggcgccgccgcctgtttgggggg	Protospacer
*******.*************** *

2. spacer 3.2|2743315|25|NZ_CP021399|CRISPRCasFinder matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 4, identity: 0.84

ccggcgctgccgcctgtttggggcg	CRISPR spacer
gcggcgctgccgcctgttggggctg	Protospacer
 ***************** *** .*

3. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP010991 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-2, complete sequence) position: , mismatch: 7, identity: 0.774

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
tcgccggtcgcgtcgccggcgttctacgggc	Protospacer
.******.***** ********** * * *

4. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgctggccgcgtggccggcgttcgtttccg	Protospacer
****.********.**********.   . *

5. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP036488 (Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

6. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

7. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

8. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

9. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

10. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

11. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgcccgccgcgtaaccggcgttgcgcatga	Protospacer
***** ********.********  . .**.

12. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP053443 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eC, complete sequence) position: , mismatch: 9, identity: 0.71

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaattc	Protospacer
***********.* *********   ..*

13. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
acgccgtccgcgaagccggcgttcttgtaca	Protospacer
 ***** ***** ***********  *   .

14. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaactc	Protospacer
***********.* *********   ...

15. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP049319 (Caballeronia sp. SBC2 plasmid pSBC2-3, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ttgccggccaggtagccggcgttcaccaacc	Protospacer
..*******. **************  .

16. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaactc	Protospacer
***********.* *********   ...

17. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaactc	Protospacer
***********.* *********   ...

18. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaactc	Protospacer
***********.* *********   ...

19. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaactc	Protospacer
***********.* *********   ...

20. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP034542 (Brevibacillus sp. SCSIO 07484 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
acgctggccgcgaagccggcgttccgcaacc	Protospacer
 ***.******* *********** . .

21. spacer 3.4|2743426|31|NZ_CP021399|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 10, identity: 0.677

ccgccggccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccggccgcattgccggcgttgccaactc	Protospacer
***********.* *********   ...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13239

Cedratvirus(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577413.1\|653_2033_-	hypothetical protein	NA	NA	NA	NA
WP_051594013.1\|2490_3480_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_029577415.1\|3840_4857_+	cyclase	NA	NA	NA	NA
WP_032979771.1\|4905_5877_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_051594014.1\|5908_6994_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_029577418.1\|6990_7854_-	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
WP_142095883.1\|7895_9059_-	thiolase	NA	NA	NA	NA
WP_032956188.1\|9055_9436_-	DNA-binding protein	NA	NA	NA	NA
WP_032962247.1\|9438_10221_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_029577421.1\|10239_11001_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_029577422.1\|11293_12448_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029577423.1\|12444_13239_+	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	6.8e-10	28.7

DBSCAN-SWA_2

41279 : 42206

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142095900.1\|41279_42206_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.5e-11	23.3

DBSCAN-SWA_3

50730 : 54586

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577452.1\|50730_51507_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.1e-15	32.4
WP_029577453.1\|51534_52392_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_029577454.1\|52406_53420_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_029577455.1\|53548_54586_-	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.0e-50	39.6

DBSCAN-SWA_4

59643 : 68217

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577459.1\|59643_60987_-	phosphoglucosamine mutase	A0A1X9I671	Streptococcus_phage	2.4e-07	27.1
WP_029577460.1\|60983_61826_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.5e-26	32.5
WP_029577461.1\|61856_63743_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	2.3e-112	42.3
WP_029577462.1\|63917_64589_-	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_029577463.1\|64607_65213_+	hypothetical protein	NA	NA	NA	NA
WP_029577464.1\|65455_65932_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_029577465.1\|66238_66718_-	helix-turn-helix transcriptional regulator	A0A1X9I5R1	Streptococcus_phage	2.1e-06	32.1
WP_029577466.1\|66900_68217_-	uracil transporter	Q9KX94	Enterobacteria_phage	4.4e-139	62.2

DBSCAN-SWA_5

71821 : 76188

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577470.1\|71821_72907_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-27	35.9
WP_029577471.1\|72920_73829_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032979800.1\|73821_74460_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_029577473.1\|74465_75224_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_141984694.1\|75291_76188_-	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	1.1e-35	37.2

DBSCAN-SWA_6

79502 : 83538

Halovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075210.1\|79502_80600_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.7e-49	32.5
WP_029577477.1\|80889_81846_+	transaldolase	H6WFR1	Cyanophage	1.8e-09	29.2
WP_029577478.1\|81928_82723_-	ABC transporter permease	NA	NA	NA	NA
WP_029577479.1\|82728_83538_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.3e-11	34.4

DBSCAN-SWA_7

86995 : 88963

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962203.1\|86995_88963_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	8.6e-46	37.4

DBSCAN-SWA_8

101775 : 105573

Brevibacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577492.1\|101775_102702_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.5e-24	28.8
WP_029577493.1\|102733_103645_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	9.2e-19	28.1
WP_142095932.1\|103863_105573_+	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	1.6e-27	23.8

DBSCAN-SWA_9

109230 : 109977

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075211.1\|109230_109977_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.6e-22	31.2

DBSCAN-SWA_10

113493 : 119256

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577503.1\|113493_114516_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	6.6e-66	39.8
WP_032955576.1\|114639_115668_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	1.5e-41	38.4
WP_029577505.1\|115660_116839_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_095075256.1\|116925_117399_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.1e-15	41.8
WP_029577507.1\|117560_118079_-	hypothetical protein	NA	NA	NA	NA
WP_029577509.1\|118374_119256_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	3.4e-50	36.1

DBSCAN-SWA_11

128256 : 129746

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142095937.1\|128256_128967_-	phosphonate C-P lyase system protein PhnL	G9BWD6	Planktothrix_phage	1.2e-18	33.6
WP_029577520.1\|128969_129746_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	9.0e-15	24.4

DBSCAN-SWA_12

138155 : 140984

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032959536.1\|138155_138974_-	phosphonate ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.6e-06	27.7
WP_029577531.1\|139476_139740_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_029577532.1\|139829_140120_+	hypothetical protein	NA	NA	NA	NA
WP_142098838.1\|140159_140984_-	peptidoglycan DD-metalloendopeptidase family protein	I2E8W3	Clostridium_phage	1.4e-18	48.1

DBSCAN-SWA_13

146399 : 147338

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577542.1\|146399_147338_-	DnaJ domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	2.3e-12	25.1

DBSCAN-SWA_14

178041 : 184620

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579459.1\|178041_179178_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.3
WP_029579458.1\|179318_179660_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.6e-11	42.6
WP_029579457.1\|179722_181603_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_029579456.1\|181660_182596_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.0e-41	34.8
WP_142095968.1\|182650_183550_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_029579454.1\|183645_184620_+	D-2-hydroxyacid dehydrogenase family protein	A0A1B1IVB5	uncultured_Mediterranean_phage	1.1e-17	30.4

DBSCAN-SWA_15

189289 : 190312

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956121.1\|189289_190312_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.0

DBSCAN-SWA_16

206028 : 207815

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579432.1\|206028_207027_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.4e-06	39.4
WP_051350505.1\|207023_207815_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.2e-06	34.9

DBSCAN-SWA_17

220601 : 225586

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579417.1\|220601_222680_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	2.8e-15	33.5
WP_029579416.1\|222781_223897_+	AI-2E family transporter	NA	NA	NA	NA
WP_142095984.1\|223868_224630_-	ABC transporter permease	NA	NA	NA	NA
WP_048940601.1\|224626_225586_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-23	34.0

DBSCAN-SWA_18

233118 : 235633

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579403.1\|233118_234387_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	4.0e-12	27.7
WP_142095993.1\|234478_235633_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	G9E4Q1	Emiliania_huxleyi_virus	9.9e-26	25.9

DBSCAN-SWA_19

239367 : 240210

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579398.1\|239367_240210_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	9.4e-42	38.1

DBSCAN-SWA_20

255828 : 256515

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956276.1\|255828_256515_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.0e-09	29.4

DBSCAN-SWA_21

262020 : 265344

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956270.1\|262020_262545_-	superoxide dismutase family protein	Q9MC02	Salmonella_phage	1.2e-47	63.4
WP_029579377.1\|262661_263630_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_142096000.1\|263802_265344_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.8e-27	25.0

DBSCAN-SWA_22

274226 : 277310

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096006.1\|274226_277310_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.6e-25	24.8

DBSCAN-SWA_23

281524 : 282571

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096009.1\|281524_282571_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.6e-19	29.6

DBSCAN-SWA_24

304911 : 305292

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579338.1\|304911_305292_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.6e-15	46.4

DBSCAN-SWA_25

313931 : 316535

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963084.1\|313931_316535_-	ATP-dependent chaperone ClpB	A0A223W0B1	Agrobacterium_phage	9.4e-125	33.6

DBSCAN-SWA_26

321753 : 322257

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979689.1\|321753_322257_-	peroxiredoxin	M1I839	Pelagibacter_phage	5.1e-27	48.4

DBSCAN-SWA_27

344726 : 345245

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955607.1\|344726_345245_-	RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	1.1e-08	28.0

DBSCAN-SWA_28

356438 : 361270

Cedratvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579291.1\|356438_357263_+	urea ABC transporter ATP-binding protein UrtD	A0A1M7XV31	Cedratvirus	1.9e-07	23.9
WP_032978207.1\|357264_357963_+	urea ABC transporter ATP-binding subunit UrtE	A0A2K9L0W2	Tupanvirus	1.1e-06	24.0
WP_029579289.1\|357959_358442_-	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_032961035.1\|359050_359725_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	2.0e-10	34.5
WP_029579286.1\|359884_361270_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-06	30.4

DBSCAN-SWA_29

376111 : 377782

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096062.1\|376111_377782_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-14	28.7

DBSCAN-SWA_30

384278 : 388770

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096065.1\|384278_386354_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	4.3e-64	28.7
WP_142096069.1\|386431_387331_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_029579259.1\|387327_388770_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.4e-16	28.8

DBSCAN-SWA_31

408617 : 410282

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096081.1\|408617_410282_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	6.2e-29	27.9

DBSCAN-SWA_32

419398 : 420301

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096094.1\|419398_420301_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	7.0e-19	26.7

DBSCAN-SWA_33

428116 : 436791

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096114.1\|428116_430207_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	2.4e-107	54.0
WP_032957142.1\|430214_431597_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	7.2e-23	28.5
WP_029579228.1\|431716_432187_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_029579227.1\|432156_433161_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032979022.1\|433251_436791_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.9e-27	27.8

DBSCAN-SWA_34

441146 : 442604

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954999.1\|441146_442604_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	1.4e-37	31.0

DBSCAN-SWA_35

445856 : 447443

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579216.1\|445856_447443_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.0e-36	42.9

DBSCAN-SWA_36

459295 : 460117

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579204.1\|459295_460117_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-29	29.9

DBSCAN-SWA_37

463528 : 464077

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579198.1\|463528_464077_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	5.0e-12	29.5

DBSCAN-SWA_38

467815 : 470410

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954989.1\|467815_470410_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.5e-24	20.5

DBSCAN-SWA_39

475645 : 476488

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075259.1\|475645_476488_+	hypothetical protein	A0A1I9SA48	Rhodococcus_phage	4.4e-39	40.2

DBSCAN-SWA_40

490079 : 491201

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954977.1\|490079_491201_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.0e-28	32.4

DBSCAN-SWA_41

497283 : 498069

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579163.1\|497283_498069_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-34	41.5

DBSCAN-SWA_42

514662 : 515679

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096159.1\|514662_515679_+	XdhC family protein	A0A0P0IKN7	Acinetobacter_phage	2.1e-11	29.1

DBSCAN-SWA_43

524201 : 525857

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096165.1\|524201_525857_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-25	39.6

DBSCAN-SWA_44

555067 : 557779

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032971807.1\|555067_555826_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.2e-13	26.4
WP_048940473.1\|555822_556752_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_032971809.1\|556777_557779_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.8e-63	41.6

DBSCAN-SWA_45

576671 : 578387

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579086.1\|576671_578387_-	acetolactate synthase 3 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.5e-57	29.4

DBSCAN-SWA_46

589534 : 598438

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096195.1\|589534_594952_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.4e-37	32.3
WP_142096198.1\|594967_597322_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_142096201.1\|597595_598438_-	phosphoadenosine phosphosulfate reductase family protein	A0A0F7L647	uncultured_marine_virus	1.3e-27	36.6

DBSCAN-SWA_47

612324 : 613323

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954879.1\|612324_613323_+	D-glycerate dehydrogenase	A0A2R8FCS0	Cedratvirus	2.5e-33	33.1

DBSCAN-SWA_48

621923 : 628532

Bacillus_virus(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579060.1\|621923_622619_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	4.1e-11	30.9
WP_095075213.1\|622626_622785_-	hypothetical protein	NA	NA	NA	NA
WP_032954875.1\|623112_623436_+	hypothetical protein	NA	NA	NA	NA
WP_080666543.1\|623626_623875_-	hypothetical protein	NA	NA	NA	NA
WP_029579059.1\|624118_625468_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.5e-89	49.0
WP_142096238.1\|625823_627188_+	hypothetical protein	NA	NA	NA	NA
WP_029579057.1\|627194_628532_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	6.0e-75	39.0

DBSCAN-SWA_49

633391 : 635367

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096241.1\|633391_634393_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.1e-08	23.8
WP_095075214.1\|634389_635367_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	4.8e-05	24.7

DBSCAN-SWA_50

638798 : 642157

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579046.1\|638798_641162_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	3.4e-81	48.0
WP_029579045.1\|641203_642157_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.1e-61	41.5

DBSCAN-SWA_51

647996 : 657485

Paramecium_bursaria_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954868.1\|647996_650126_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	6.1e-21	24.3
WP_142096253.1\|650138_650723_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_048939886.1\|650756_653480_+	DUF4118 domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	3.0e-12	24.6
WP_029579036.1\|653484_654177_+	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.8e-28	33.3
WP_142096256.1\|654288_655038_+	hypothetical protein	NA	NA	NA	NA
WP_126623669.1\|655135_655357_+	hypothetical protein	NA	NA	NA	NA
WP_142096259.1\|655366_656314_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_029579032.1\|656228_657485_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.5e-11	63.0

DBSCAN-SWA_52

661639 : 667645

Acanthamoeba_polyphaga_mimivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096265.1\|661639_664396_+	insulinase family protein	A0A2L2DIR8	Acanthamoeba_polyphaga_mimivirus	2.5e-19	27.8
WP_032971496.1\|664477_665602_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	6.5e-22	28.6
WP_029579022.1\|665710_667645_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.8e-147	50.2

DBSCAN-SWA_53

709392 : 710832

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578977.1\|709392_710832_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.4e-50	34.1

DBSCAN-SWA_54

715778 : 721408

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096286.1\|715778_716618_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	9.6e-63	46.6
WP_029578969.1\|716631_717492_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_142096289.1\|717564_718686_-	porin	NA	NA	NA	NA
WP_142096292.1\|718672_721408_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	6.6e-44	25.8

DBSCAN-SWA_55

728372 : 729962

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578959.1\|728372_729962_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.0e-65	46.2

DBSCAN-SWA_56

733060 : 738271

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954839.1\|733060_734128_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	7.3e-07	29.2
WP_029578953.1\|734140_735961_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	2.1e-75	33.8
WP_029578952.1\|736071_737427_-	hypothetical protein	NA	NA	NA	NA
WP_029578951.1\|737569_738271_+	response regulator	W8CYM9	Bacillus_phage	2.1e-31	36.2

DBSCAN-SWA_57

742266 : 744027

Escherichia_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578947.1\|742266_744027_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	1.4e-164	51.0

DBSCAN-SWA_58

747318 : 752790

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578941.1\|747318_748992_-	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	3.4e-43	28.4
WP_032955022.1\|749259_750138_-	DMT family transporter	NA	NA	NA	NA
WP_142096311.1\|750289_750805_+	hypothetical protein	NA	NA	NA	NA
WP_029578938.1\|750823_751819_-	dipeptide ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.0e-16	30.9
WP_029578937.1\|751815_752790_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	2.3e-07	25.5

DBSCAN-SWA_59

759627 : 760956

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578930.1\|759627_760956_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	2.6e-22	24.5

DBSCAN-SWA_60

767076 : 767838

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096317.1\|767076_767838_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.5e-09	25.6

DBSCAN-SWA_61

774249 : 775410

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954831.1\|774249_775410_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-44	38.2

DBSCAN-SWA_62

780319 : 781267

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954827.1\|780319_781267_-	2-hydroxyacid dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	4.5e-16	27.7

DBSCAN-SWA_63

791666 : 793609

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048939861.1\|791666_792650_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.7e-06	30.4
WP_032954823.1\|792646_793609_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.7e-19	34.3

DBSCAN-SWA_64

797838 : 799437

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096340.1\|797838_799437_+	catalase	A0A2K9L0T1	Tupanvirus	6.7e-97	39.9

DBSCAN-SWA_65

819228 : 821794

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578438.1\|819228_819972_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.6e-15	31.3
WP_029578437.1\|820001_820952_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_029578436.1\|821029_821794_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.2e-12	31.0

DBSCAN-SWA_66

825920 : 833373

Brazilian_cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096355.1\|825920_826640_-	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	1.9e-14	28.4
WP_029578430.1\|826632_827640_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_032954808.1\|827636_828521_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_029578428.1\|828561_830292_-	acetolactate synthase catalytic subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.5e-33	28.5
WP_080666524.1\|830398_831130_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_029578426.1\|831293_831971_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_142096358.1\|831984_833373_-	ATP-dependent RNA helicase DbpA	A0A0N9Q9J4	Chrysochromulina_ericina_virus	5.1e-53	33.0

DBSCAN-SWA_67

848497 : 852593

Micromonas_sp._RCC1109_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958864.1\|848497_849361_-	alpha/beta hydrolase	A0A068F2G2	Mycobacterium_phage	3.8e-06	26.4
WP_080700905.1\|849399_850317_-	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_032958866.1\|850601_851639_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	4.0e-42	31.9
WP_032961161.1\|851654_852593_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	3.4e-32	33.0

DBSCAN-SWA_68

859251 : 861222

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578395.1\|859251_860874_-	chaperonin GroEL	A0A240F779	uncultured_virus	4.6e-170	59.7
WP_029578394.1\|860904_861222_-	co-chaperone GroES	A0A221S322	uncultured_virus	6.0e-18	48.9

DBSCAN-SWA_69

866137 : 867193

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096385.1\|866137_867193_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.4e-23	35.4

DBSCAN-SWA_70

882324 : 884287

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578378.1\|882324_882612_+	co-chaperone GroES	A0A221S4A8	uncultured_virus	9.0e-21	51.1
WP_029578377.1\|882646_884287_+	chaperonin GroEL	A0A219YK78	uncultured_virus	3.7e-167	60.0

DBSCAN-SWA_71

888016 : 892335

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955466.1\|888016_888574_-	CinA family protein	B5TK85	Pseudomonas_phage	9.9e-24	39.8
WP_029578371.1\|888570_889074_-	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_032955467.1\|889141_890110_-	thiamine-phosphate kinase	NA	NA	NA	NA
WP_032955468.1\|890117_890609_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_032955469.1\|890628_891150_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2I2L4Y7	Orpheovirus	5.3e-11	34.5
WP_032955472.1\|891159_892335_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	M4QPK3	Synechococcus_phage	2.4e-35	41.9

DBSCAN-SWA_72

898076 : 899529

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075263.1\|898076_898847_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	3.1e-15	27.8
WP_029578360.1\|898833_899529_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-09	25.2

DBSCAN-SWA_73

906261 : 907032

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578354.1\|906261_907032_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.3e-17	37.2

DBSCAN-SWA_74

912377 : 913215

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578348.1\|912377_912890_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.5e-29	43.9
WP_029578347.1\|912960_913215_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	3.3e-19	53.4

DBSCAN-SWA_75

918255 : 920334

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098856.1\|918255_920334_+	TonB-dependent siderophore receptor	A0A0P0I887	Acinetobacter_phage	6.8e-09	30.9

DBSCAN-SWA_76

939321 : 940254

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075218.1\|939321_940254_-	ribose-phosphate pyrophosphokinase	A0A2K9L8D8	Tupanvirus	2.7e-42	36.0

DBSCAN-SWA_77

954463 : 955810

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955511.1\|954463_955810_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.4e-10	28.6

DBSCAN-SWA_78

958843 : 960229

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955515.1\|958843_960229_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.8e-53	32.4

DBSCAN-SWA_79

965197 : 970630

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578300.1\|965197_967108_-	asparagine synthase (glutamine-hydrolyzing)	A0A0N9QYX6	Chrysochromulina_ericina_virus	5.4e-21	24.4
WP_032955519.1\|967122_968247_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_029578298.1\|968247_969603_-	membrane protein	NA	NA	NA	NA
WP_029578297.1\|969604_970630_-	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	E3T4Y8	Cafeteria_roenbergensis_virus	1.4e-68	42.5

DBSCAN-SWA_80

975128 : 976588

Equid_gammaherpesvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096454.1\|975128_976100_+	thymidylate synthase	A0A0B4Q5G0	Equid_gammaherpesvirus	1.2e-53	38.0
WP_032954743.1\|976096_976588_+	dihydrofolate reductase	A0A0S2MU93	Bacillus_phage	2.9e-27	38.9

DBSCAN-SWA_81

986207 : 987860

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578283.1\|986207_987860_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.1e-06	31.8

DBSCAN-SWA_82

993146 : 996020

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096458.1\|993146_996020_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	5.7e-264	52.1

DBSCAN-SWA_83

1002181 : 1003963

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578271.1\|1002181_1003963_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	1.4e-10	30.3

DBSCAN-SWA_84

1012142 : 1012706

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578263.1\|1012142_1012706_-	dCTP deaminase	S5VM63	Pseudomonas_phage	4.4e-72	74.7

DBSCAN-SWA_85

1019973 : 1022049

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578258.1\|1019973_1022049_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	7.7e-29	23.4

DBSCAN-SWA_86

1026442 : 1030117

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958091.1\|1026442_1027366_-	arginase	A0A0N9R043	Chrysochromulina_ericina_virus	3.9e-25	37.0
WP_080700312.1\|1027577_1028003_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_029578249.1\|1027999_1028851_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_142096468.1\|1029061_1030117_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.9e-28	34.1

DBSCAN-SWA_87

1043088 : 1044542

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963730.1\|1043088_1043832_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	2.9e-10	24.0
WP_029578233.1\|1043828_1044542_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.1e-06	23.4

DBSCAN-SWA_88

1048779 : 1049823

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578227.1\|1048779_1049823_+	ornithine cyclodeaminase	A0A1V0SL93	Klosneuvirus	8.5e-101	54.5

DBSCAN-SWA_89

1060681 : 1061407

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578216.1\|1060681_1061407_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-32	37.7

DBSCAN-SWA_90

1086090 : 1088581

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096505.1\|1086090_1086846_-	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	1.6e-21	33.5
WP_142096508.1\|1087023_1087983_+	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_032958173.1\|1087984_1088581_-	cupin domain-containing protein	Q786F1	Bacillus_phage	2.9e-05	41.9

DBSCAN-SWA_91

1113325 : 1115182

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096523.1\|1113325_1115182_-	sulfatase-like hydrolase/transferase	A0A1V0SA98	Catovirus	3.0e-24	25.7

DBSCAN-SWA_92

1130601 : 1132632

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096568.1\|1130601_1132632_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	4.9e-28	25.3

DBSCAN-SWA_93

1148823 : 1150149

Acidithiobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096595.1\|1148823_1150149_+	DNA (cytosine-5-)-methyltransferase	K4HZD0	Acidithiobacillus_phage	7.8e-75	40.0

DBSCAN-SWA_94

1159415 : 1159853

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096601.1\|1159415_1159853_+	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	1.1e-33	51.2

DBSCAN-SWA_95

1194584 : 1195076

Ralstonia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_121493190.1\|1194584_1195076_+\|transposase	transposase	A0A077K814	Ralstonia_phage	7.4e-31	56.2

DBSCAN-SWA_96

1206482 : 1212230

Pseudomonas_phage(50.0%)

integrase

attL 1199752:1199766|attR 1220297:1220311

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1199752:1199766	attL	NA	NA	NA	NA
WP_062737768.1\|1206482_1208408_-\|integrase	tyrosine-type recombinase/integrase	A0A0U1UNT3	Pseudomonas_phage	5.9e-100	48.3
WP_142096650.1\|1208815_1209775_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_048939750.1\|1209798_1211268_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_032972509.1\|1211264_1212230_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	3.6e-13	28.0
1220297:1220311	attR	NA	NA	NA	NA

DBSCAN-SWA_97

1216148 : 1217171

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578084.1\|1216148_1217171_-	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	4.3e-25	26.5

DBSCAN-SWA_98

1222304 : 1225780

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578077.1\|1222304_1222751_+	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	3.0e-07	46.9
WP_032963499.1\|1222862_1223585_-	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_142096653.1\|1223581_1224475_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032963496.1\|1224697_1225780_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-31	36.8

DBSCAN-SWA_99

1231159 : 1233877

Sphingobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958372.1\|1231159_1231768_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.2e-06	29.1
WP_142096656.1\|1231782_1232403_+	glutathione S-transferase	NA	NA	NA	NA
WP_029578066.1\|1232442_1233150_-	ABC transporter ATP-binding protein	A0A2H4UU96	Bodo_saltans_virus	9.1e-06	25.7
WP_029578065.1\|1233154_1233877_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.1e-10	28.6

DBSCAN-SWA_100

1241725 : 1247948

Oenococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096659.1\|1241725_1242874_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.2e-58	37.2
WP_142096662.1\|1242900_1244202_+	MFS transporter	NA	NA	NA	NA
WP_032958379.1\|1244471_1246364_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	9.2e-122	38.3
WP_032958381.1\|1246556_1247948_+	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.5e-28	49.3

DBSCAN-SWA_101

1260484 : 1261708

Shahe_endorna-like_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096696.1\|1260484_1261708_-	glycosyltransferase family 1 protein	A0A1L3KK54	Shahe_endorna-like_virus	1.2e-08	38.8

DBSCAN-SWA_102

1273864 : 1274851

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578035.1\|1273864_1274851_+	D-2-hydroxyacid dehydrogenase	M1NSB9	Streptococcus_phage	4.5e-11	28.3

DBSCAN-SWA_103

1284039 : 1286631

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096737.1\|1284039_1286631_-	type II secretion system secretin GspD	G4WZN6	Enterobacteria_phage	9.9e-34	35.4

DBSCAN-SWA_104

1297180 : 1304278

Leptospira_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578011.1\|1297180_1298368_+	efflux RND transporter periplasmic adaptor subunit	S5VL44	Leptospira_phage	6.9e-06	22.9
WP_029578010.1\|1298393_1301579_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.8e-06	23.4
WP_032958410.1\|1301593_1303072_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_142096750.1\|1303123_1303654_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_029578007.1\|1303717_1304278_+	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	1.3e-15	32.2

DBSCAN-SWA_105

1309505 : 1311915

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096758.1\|1309505_1310048_+	GNAT family N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	8.7e-25	42.3
WP_029578001.1\|1310044_1311199_+	MFS transporter	NA	NA	NA	NA
WP_142096761.1\|1311195_1311915_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	5.2e-49	42.3

DBSCAN-SWA_106

1330599 : 1331676

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577979.1\|1330599_1331676_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	3.3e-07	40.7

DBSCAN-SWA_107

1335506 : 1339558

Pandoravirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096773.1\|1335506_1336340_+	metallophosphoesterase	S4VP02	Pandoravirus	4.2e-18	27.1
WP_029577972.1\|1336336_1337815_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.2e-164	64.5
WP_029577971.1\|1338108_1338849_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.6e-15	24.8
WP_029577970.1\|1338850_1339558_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-16	25.5

DBSCAN-SWA_108

1351311 : 1352445

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096779.1\|1351311_1352445_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	44.2

DBSCAN-SWA_109

1358475 : 1359459

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577932.1\|1358475_1359459_+	TerC family protein	K7QKE8	Escherichia_phage	1.9e-41	34.0

DBSCAN-SWA_110

1363980 : 1365432

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577927.1\|1363980_1365432_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-20	27.2

DBSCAN-SWA_111

1368457 : 1368715

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577923.1\|1368457_1368715_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	9.5e-14	46.2

DBSCAN-SWA_112

1401826 : 1403461

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096803.1\|1401826_1403461_+	FAD-binding protein	A0A1V0SI18	Klosneuvirus	3.2e-54	30.7

DBSCAN-SWA_113

1407444 : 1414392

Bacillus_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096806.1\|1407444_1408167_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.0e-09	25.9
WP_029579777.1\|1408178_1409369_+	CoA transferase	NA	NA	NA	NA
WP_032958501.1\|1409379_1410303_+	hydroxymethylglutaryl-CoA lyase	E5EQ69	Micromonas_sp._RCC1109_virus	4.1e-06	35.7
WP_032958503.1\|1410405_1410993_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	8.9e-07	23.5
WP_029579780.1\|1411003_1411582_+	hypothetical protein	NA	NA	NA	NA
WP_142096809.1\|1411578_1412214_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_029579782.1\|1412220_1412847_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_029579783.1\|1412843_1413785_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-08	41.8
WP_029579784.1\|1413879_1414392_-	peptide deformylase	E3SLL2	Synechococcus_phage	6.5e-22	44.3

DBSCAN-SWA_114

1421058 : 1424675

Thermus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032973730.1\|1421058_1422168_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	3.0e-27	41.3
WP_029579792.1\|1422244_1423153_+	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
WP_029579793.1\|1423184_1423655_+	membrane protein	NA	NA	NA	NA
WP_029579794.1\|1423658_1424675_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-74	43.2

DBSCAN-SWA_115

1435635 : 1441927

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579805.1\|1435635_1436358_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.9e-15	27.1
WP_029579806.1\|1436388_1438107_-	acid phosphatase	NA	NA	NA	NA
WP_029579807.1\|1438291_1438990_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_029579808.1\|1439154_1441125_+	AMP-binding protein	A0A1V0SBX8	Catovirus	2.4e-35	23.1
WP_029579809.1\|1441126_1441927_+	ABC transporter ATP-binding protein	M1HRF1	Paramecium_bursaria_Chlorella_virus	1.9e-07	21.7

DBSCAN-SWA_116

1452380 : 1453571

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979239.1\|1452380_1453571_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.7e-103	59.5

DBSCAN-SWA_117

1458407 : 1465648

Feline_herpesvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579829.1\|1458407_1459166_+	uracil-DNA glycosylase	O37930	Feline_herpesvirus	1.0e-42	50.6
WP_095075223.1\|1459394_1461173_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.0e-54	34.3
WP_032958539.1\|1461273_1462446_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_029579832.1\|1462442_1463534_-\|tRNA	tRNA CCA-pyrophosphorylase	A0A0F6YPT7	Sinorhizobium_phage	2.6e-52	48.7
WP_029579833.1\|1463530_1465648_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	3.2e-14	39.4

DBSCAN-SWA_118

1474899 : 1476321

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579845.1\|1474899_1476321_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	3.6e-38	28.8

DBSCAN-SWA_119

1483070 : 1488849

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579853.1\|1483070_1484234_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.3e-128	61.3
WP_029579854.1\|1484510_1485365_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_029579855.1\|1485361_1486255_+	lysophospholipid acyltransferase family protein	A0A1W6JP29	Morganella_phage	5.1e-30	29.6
WP_029579856.1\|1486279_1487176_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_029579857.1\|1487200_1487869_+	DUF484 family protein	NA	NA	NA	NA
WP_032979206.1\|1487877_1488849_+	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	4.4e-11	31.5

DBSCAN-SWA_120

1494339 : 1495089

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032959699.1\|1494339_1495089_-	metal ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-05	29.5

DBSCAN-SWA_121

1498539 : 1499874

Erwinia_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579868.1\|1498539_1499874_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	4.2e-44	29.0

DBSCAN-SWA_122

1504032 : 1508452

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579875.1\|1504032_1505304_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.2e-66	40.5
WP_029579876.1\|1505436_1506084_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_029579877.1\|1506116_1506707_-	hypothetical protein	NA	NA	NA	NA
WP_032979207.1\|1506711_1507638_-	MCE family protein	NA	NA	NA	NA
WP_032958605.1\|1507624_1508452_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.6e-22	32.9

DBSCAN-SWA_123

1513828 : 1517278

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579885.1\|1513828_1514401_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.4e-35	43.2
WP_029579886.1\|1514397_1515279_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	2.3e-99	63.0
WP_142096845.1\|1515275_1516175_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.6e-23	33.8
WP_142096848.1\|1516171_1517278_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	5.3e-85	46.1

DBSCAN-SWA_124

1523876 : 1529877

Catovirus(33.33%)

tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579895.1\|1523876_1525667_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	1.7e-08	23.6
WP_032958616.1\|1525707_1526343_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.3e-11	27.6
WP_029579897.1\|1526345_1526660_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_032971711.1\|1526832_1528113_-	membrane protein	NA	NA	NA	NA
WP_142096854.1\|1528254_1529877_-\|holin	choline dehydrogenase	A0A2I2L3D3	Orpheovirus	3.4e-24	26.8

DBSCAN-SWA_125

1537440 : 1538934

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579906.1\|1537440_1538934_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-14	27.9

DBSCAN-SWA_126

1548338 : 1549412

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579914.1\|1548338_1549412_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-25	31.0

DBSCAN-SWA_127

1555682 : 1562603

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579919.1\|1555682_1558421_-	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.4e-75	29.9
WP_029579920.1\|1558797_1559844_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_029579921.1\|1559852_1560422_+	N-acetyltransferase	NA	NA	NA	NA
WP_029579922.1\|1560429_1561524_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	1.9e-31	30.8
WP_029579923.1\|1561520_1562603_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	1.9e-47	34.4

DBSCAN-SWA_128

1565854 : 1576910

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958639.1\|1565854_1567741_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	1.0e-24	27.2
WP_142096871.1\|1567751_1568972_-	glycosyltransferase	NA	NA	NA	NA
WP_142096874.1\|1568961_1570023_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_142096877.1\|1570116_1571991_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SHV8	Klosneuvirus	7.5e-23	28.7
WP_142096880.1\|1572023_1573082_-	NAD-dependent epimerase/dehydratase family protein	M1I5F1	Acanthocystis_turfacea_Chlorella_virus	1.5e-25	27.2
WP_142096883.1\|1573104_1574037_-	NAD-dependent epimerase/dehydratase family protein	A0A0E3IB24	Synechococcus_phage	1.4e-14	25.2
WP_043207243.1\|1574042_1574984_-	NAD-dependent epimerase/dehydratase family protein	A0A0E3FNK1	Synechococcus_phage	5.6e-11	26.4
WP_142096886.1\|1574993_1576910_-	asparagine synthase (glutamine-hydrolyzing)	A0A1X9VNR2	Mimivirus	9.6e-26	27.7

DBSCAN-SWA_129

1579962 : 1584124

Micromonas_pusilla_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096892.1\|1579962_1580952_-	methyltransferase domain-containing protein	M4QQF3	Micromonas_pusilla_virus	5.0e-10	27.0
WP_142098890.1\|1581003_1581789_-	ABC transporter permease	NA	NA	NA	NA
WP_142096896.1\|1581800_1582967_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	1.2e-07	27.3
WP_142096899.1\|1582966_1584124_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-08	25.0

DBSCAN-SWA_130

1588741 : 1598118

Tupanvirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142096919.1\|1588741_1590622_-	asparagine synthase (glutamine-hydrolyzing)	L7RC73	Acanthamoeba_polyphaga_moumouvirus	3.4e-31	28.3
WP_142096922.1\|1590726_1591887_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L470	Tupanvirus	3.0e-38	32.3
WP_142096925.1\|1591883_1592861_-	NAD-dependent epimerase/dehydratase family protein	A0A2K9L4U8	Tupanvirus	1.1e-41	39.1
WP_142096928.1\|1593123_1593633_-	single-stranded DNA-binding protein	F8TUL2	EBPR_podovirus	2.4e-40	50.3
WP_142096931.1\|1593895_1595080_-	MFS transporter	NA	NA	NA	NA
WP_029579943.1\|1595259_1598118_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-297	54.1

DBSCAN-SWA_131

1601306 : 1602389

Ostreococcus_mediterraneus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579947.1\|1601306_1602389_-	3-dehydroquinate synthase	A0A0P0C619	Ostreococcus_mediterraneus_virus	9.6e-23	35.5

DBSCAN-SWA_132

1626758 : 1627577

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594423.1\|1626758_1627577_-	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	S4VR59	Pandoravirus	1.0e-21	43.4

DBSCAN-SWA_133

1633777 : 1634509

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955620.1\|1633777_1634509_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-08	22.7

DBSCAN-SWA_134

1642137 : 1648657

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579994.1\|1642137_1643328_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	29.6
WP_029577155.1\|1643404_1645507_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	3.6e-58	26.1
WP_029577156.1\|1645525_1645996_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_005017264.1\|1646161_1646539_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_029577157.1\|1646969_1647683_-	response regulator transcription factor	NA	NA	NA	NA
WP_032957244.1\|1647958_1648657_+	response regulator transcription factor	A0A220YL79	Alteromonas_virus	5.8e-05	27.0

DBSCAN-SWA_135

1654028 : 1670666

Vibrio_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577162.1\|1654028_1658270_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	2.0e-68	24.9
WP_029577163.1\|1658269_1662382_-	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	7.4e-23	23.4
WP_029577164.1\|1662543_1662924_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_029577165.1\|1663008_1663533_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_029577166.1\|1663776_1664475_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_029577167.1\|1664477_1664909_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_029577168.1\|1664968_1665502_-	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	9.9e-13	31.2
WP_029577169.1\|1665510_1665891_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_029579994.1\|1666188_1667379_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	29.6
WP_029577879.1\|1667876_1668884_-	asparaginase	NA	NA	NA	NA
WP_029577880.1\|1668876_1669785_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	4.7e-15	36.5
WP_029577881.1\|1669871_1670666_-	ParA family protein	Q8JL10	Natrialba_phage	7.3e-20	34.3

DBSCAN-SWA_136

1674296 : 1674503

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577884.1\|1674296_1674503_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.2e-16	62.5

DBSCAN-SWA_137

1703532 : 1705544

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577184.1\|1703532_1704519_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.9e-07	30.1
WP_126623694.1\|1704518_1705544_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.8e-15	30.9

DBSCAN-SWA_138

1711545 : 1718102

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080666487.1\|1711545_1711833_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	3.7e-14	53.6
WP_032962136.1\|1711829_1712201_-	ribonuclease P protein component	NA	NA	NA	NA
WP_029577875.1\|1712323_1712458_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_029577874.1\|1713002_1714454_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_095075157.1\|1714450_1715566_+	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	6.2e-41	29.6
WP_029577872.1\|1715648_1718102_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	7.8e-113	34.8

DBSCAN-SWA_139

1727170 : 1729432

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577861.1\|1727170_1729432_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	3.9e-66	29.7

DBSCAN-SWA_140

1737404 : 1738934

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032978956.1\|1737404_1738934_-	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	1.5e-05	26.3

DBSCAN-SWA_141

1743381 : 1744563

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577846.1\|1743381_1743876_+	nucleoside 2-deoxyribosyltransferase	A0A1G5S9Z4	Enterococcus_phage	3.7e-06	32.2
WP_029577845.1\|1743888_1744563_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.0e-34	41.5

DBSCAN-SWA_142

1748043 : 1749870

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577840.1\|1748043_1749870_+	biosynthetic-type acetolactate synthase large subunit	E4WLQ6	Ostreococcus_tauri_virus	9.4e-55	29.5

DBSCAN-SWA_143

1753849 : 1758420

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075158.1\|1753849_1754623_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	4.0e-15	29.0
WP_142097001.1\|1754619_1755666_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_142097005.1\|1755783_1758420_-	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	8.0e-23	26.1

DBSCAN-SWA_144

1769602 : 1774776

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577825.1\|1769602_1770793_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.7e-18	25.3
WP_029577824.1\|1770849_1771095_+	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_032957614.1\|1771115_1773143_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_029577822.1\|1773168_1774776_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	2.1e-21	73.6

DBSCAN-SWA_145

1792022 : 1795046

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577805.1\|1792022_1793063_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-20	31.0
WP_029577804.1\|1793228_1794050_-	phosphodiesterase	NA	NA	NA	NA
WP_142097017.1\|1794059_1795046_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.3e-23	32.1

DBSCAN-SWA_146

1808446 : 1815665

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577790.1\|1808446_1810054_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	1.2e-13	37.2
WP_032957635.1\|1810078_1810708_-	LysE family transporter	NA	NA	NA	NA
WP_142098910.1\|1810723_1812175_-	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	1.9e-42	30.1
WP_029577787.1\|1812442_1813048_+	LemA family protein	NA	NA	NA	NA
WP_032957640.1\|1813028_1813931_+	YgcG family protein	NA	NA	NA	NA
WP_029577785.1\|1813937_1815665_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.0e-10	28.7

DBSCAN-SWA_147

1819539 : 1820916

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577781.1\|1819539_1820916_-	GTPase/DUF3482 domain-containing protein	A0A0R6PFW5	Moraxella_phage	3.0e-53	35.7

DBSCAN-SWA_148

1826392 : 1827235

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097020.1\|1826392_1827235_-	NAD-dependent deacetylase	S5M4R0	Bacillus_phage	4.7e-09	24.0

DBSCAN-SWA_149

1833076 : 1835026

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577767.1\|1833076_1834207_+\|protease	trypsin-like serine protease	A0A1B1IRD3	uncultured_Mediterranean_phage	5.2e-11	35.8
WP_095075159.1\|1834267_1835026_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.1e-28	33.7

DBSCAN-SWA_150

1845262 : 1849824

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097026.1\|1845262_1846072_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	6.1e-22	33.7
WP_029577749.1\|1846203_1846830_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029577748.1\|1846856_1847645_-	VacJ family lipoprotein	NA	NA	NA	NA
WP_029577747.1\|1847713_1848196_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_029577746.1\|1848208_1848991_-	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
WP_029577745.1\|1848987_1849824_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	3.3e-15	30.8

DBSCAN-SWA_151

1858496 : 1866648

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577740.1\|1858496_1859603_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	6.1e-33	28.5
WP_032957656.1\|1859613_1860453_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_029577738.1\|1860510_1861194_+	hypothetical protein	NA	NA	NA	NA
WP_029577737.1\|1861292_1861751_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_029577736.1\|1861880_1862768_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.1e-40	38.5
WP_142098914.1\|1863075_1863861_-	phosphodiesterase	NA	NA	NA	NA
WP_032962870.1\|1864080_1866648_+	cyclic nucleotide-binding domain-containing protein	A0A2H4J178	uncultured_Caudovirales_phage	6.2e-12	29.9

DBSCAN-SWA_152

1870117 : 1871719

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577730.1\|1870117_1871719_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	5.2e-09	39.1

DBSCAN-SWA_153

1879062 : 1889539

Saudi_moumouvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577718.1\|1879062_1880436_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A1S5V090	Saudi_moumouvirus	9.6e-28	35.0
WP_080989788.1\|1880432_1881827_+	MFS transporter	NA	NA	NA	NA
WP_048940406.1\|1881904_1883227_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.4e-76	38.3
WP_142097032.1\|1883223_1884279_+	glycosyltransferase	NA	NA	NA	NA
WP_029577714.1\|1884279_1884792_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_032962878.1\|1884937_1886770_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	4.5e-158	48.9
WP_142097035.1\|1887046_1889539_-	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	2.7e-12	30.6

DBSCAN-SWA_154

1909688 : 1911189

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577691.1\|1909688_1910408_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.1e-09	26.6
WP_029577690.1\|1910394_1911189_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.9e-07	22.4

DBSCAN-SWA_155

1918912 : 1920329

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577682.1\|1918912_1919614_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-14	26.1
WP_029577681.1\|1919597_1920329_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	3.1e-09	23.6

DBSCAN-SWA_156

1941791 : 1944606

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_127814824.1\|1941791_1942775_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	7.6e-19	36.3
WP_029577658.1\|1943028_1943559_-	hypothetical protein	NA	NA	NA	NA
WP_029577657.1\|1943562_1944606_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.8e-17	52.7

DBSCAN-SWA_157

1955042 : 1955828

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577647.1\|1955042_1955828_-	heme ABC transporter ATP-binding protein	A0A2I4R674	Erysipelothrix_phage	2.2e-05	29.2

DBSCAN-SWA_158

1968203 : 1969634

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979618.1\|1968203_1969634_-	DUF1254 domain-containing protein	M1HIG9	Paramecium_bursaria_Chlorella_virus	2.2e-22	25.8

DBSCAN-SWA_159

1976952 : 1978881

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957978.1\|1976952_1978881_+	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	1.1e-16	30.3

DBSCAN-SWA_160

1983758 : 1988947

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957975.1\|1983758_1984793_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	2.5e-36	30.1
WP_029577620.1\|1984962_1985751_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-64	50.8
WP_029577619.1\|1985747_1986779_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.4e-71	42.9
WP_029577618.1\|1986795_1987359_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.8e-66	61.5
WP_029577617.1\|1987426_1988947_-	anthranilate synthase component I	S4VNU7	Pandoravirus	8.1e-44	33.3

DBSCAN-SWA_161

1995565 : 1996516

Escherichia_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957963.1\|1995565_1996516_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	8.2e-95	67.2

DBSCAN-SWA_162

2000710 : 2002204

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097099.1\|2000710_2002204_+	DUF1254 domain-containing protein	M1I2Z8	Paramecium_bursaria_Chlorella_virus	8.8e-43	30.1

DBSCAN-SWA_163

2014694 : 2019878

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577592.1\|2014694_2016755_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	3.4e-101	36.8
WP_029577591.1\|2016820_2017951_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_029577590.1\|2017959_2018865_-	hydrolase	NA	NA	NA	NA
WP_029577589.1\|2018867_2019878_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.4e-13	29.3

DBSCAN-SWA_164

2038433 : 2038955

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577572.1\|2038433_2038955_-	lipocalin family protein	A0A2K9L662	Tupanvirus	3.1e-19	33.8

DBSCAN-SWA_165

2052194 : 2052977

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979627.1\|2052194_2052977_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	1.8e-23	29.3

DBSCAN-SWA_166

2070213 : 2074590

Caulobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580011.1\|2070213_2070816_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	9.7e-17	35.4
WP_142097113.1\|2070820_2071279_-	YraN family protein	NA	NA	NA	NA
WP_142097116.1\|2071320_2072253_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_032957901.1\|2072249_2072807_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.3e-23	43.1
WP_032957899.1\|2072815_2073721_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	2.8e-15	46.1
WP_029580015.1\|2073717_2074590_-	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	1.7e-09	37.0

DBSCAN-SWA_167

2079008 : 2081686

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580021.1\|2079008_2079794_-	LPS export ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	8.8e-18	29.6
WP_029580022.1\|2079838_2080456_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_032957892.1\|2080452_2081076_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_029580024.1\|2081080_2081686_-	HAD hydrolase family protein	E3T535	Cafeteria_roenbergensis_virus	8.9e-10	26.8

DBSCAN-SWA_168

2087740 : 2091750

Organic_Lake_phycodnavirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580031.1\|2087740_2089483_+	thiol reductant ABC exporter subunit CydD	F2Y1V6	Organic_Lake_phycodnavirus	3.6e-11	30.4
WP_142098918.1\|2089479_2091135_+	thiol reductant ABC exporter subunit CydC	F2Y302	Organic_Lake_phycodnavirus	7.1e-17	26.6
WP_029580033.1\|2091201_2091750_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.4e-30	43.2

DBSCAN-SWA_169

2106196 : 2107396

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097123.1\|2106196_2107396_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.1e-91	43.8

DBSCAN-SWA_170

2113223 : 2115243

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957876.1\|2113223_2114531_-	phosphate regulon sensor histidine kinase PhoR	A0A1V0SGX0	Hokovirus	2.5e-17	25.5
WP_029580053.1\|2114544_2115243_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	1.0e-33	37.6

DBSCAN-SWA_171

2123324 : 2124044

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580063.1\|2123324_2124044_+	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	6.4e-07	28.9

DBSCAN-SWA_172

2132856 : 2146940

uncultured_Mediterranean_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580074.1\|2132856_2134410_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4QMK7	Micromonas_pusilla_virus	7.0e-35	32.4
WP_029580075.1\|2134593_2135481_+	ferritin	NA	NA	NA	NA
WP_029580076.1\|2135507_2135996_+	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	4.9e-19	38.1
WP_142097145.1\|2136008_2137340_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_029580078.1\|2137344_2138025_-	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.9e-14	34.7
WP_032963281.1\|2138101_2138944_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_029580080.1\|2138940_2139738_-	thiazole synthase	NA	NA	NA	NA
WP_142097148.1\|2139794_2140052_+	hypothetical protein	NA	NA	NA	NA
WP_127814825.1\|2139952_2140828_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032979287.1\|2140878_2142825_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	4.0e-11	36.1
WP_032957853.1\|2143163_2146940_+	methionine synthase	A0A140XBC7	Dickeya_phage	3.3e-09	49.2

DBSCAN-SWA_173

2161755 : 2166878

Pithovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580095.1\|2161755_2162427_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	2.1e-12	28.5
WP_029580096.1\|2162669_2163686_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.2e-72	42.7
WP_029580097.1\|2163792_2164983_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_029580098.1\|2164984_2166085_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_029580099.1\|2166137_2166878_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-34	38.8

DBSCAN-SWA_174

2186795 : 2187755

Barns_Ness_breadcrumb_sponge_sobemo-like_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097167.1\|2186795_2187755_-	Nudix family hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	5.0e-07	38.2

DBSCAN-SWA_175

2195862 : 2197346

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957350.1\|2195862_2196648_+	ABC transporter ATP-binding protein	A0A2R8FFL6	Cedratvirus	5.7e-09	26.3
WP_029580126.1\|2196641_2197346_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-08	29.3

DBSCAN-SWA_176

2200589 : 2201402

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580130.1\|2200589_2201402_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.3e-19	35.8

DBSCAN-SWA_177

2235050 : 2243385

Pseudomonas_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580165.1\|2235050_2236178_+	cytochrome c552	A0A125RNP0	Pseudomonas_phage	2.3e-27	31.9
WP_029580166.1\|2236189_2237620_+	D-alanine--poly(phosphoribitol) ligase	A0A2K9L3I8	Tupanvirus	4.5e-28	28.1
WP_142097189.1\|2237662_2238217_-	YggT family protein	NA	NA	NA	NA
WP_032956587.1\|2238374_2238947_-	histone	NA	NA	NA	NA
WP_029580169.1\|2239242_2240436_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	1.9e-32	28.0
WP_029580170.1\|2240457_2243385_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	3.0e-172	44.2

DBSCAN-SWA_178

2253775 : 2255226

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963339.1\|2253775_2254480_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	24.5
WP_029580178.1\|2254476_2255226_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.0e-12	27.9

DBSCAN-SWA_179

2259146 : 2260703

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956575.1\|2259146_2260703_-	benzoate-CoA ligase family protein	A0A2H4PQU7	Staphylococcus_phage	4.9e-52	36.0

DBSCAN-SWA_180

2277054 : 2287942

Lake_Baikal_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580200.1\|2277054_2277426_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	5.6e-31	58.3
WP_142097201.1\|2277489_2278617_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_142097204.1\|2278624_2280040_-	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	2.3e-16	42.7
WP_032979311.1\|2280316_2281546_+\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_029580204.1\|2281584_2282241_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_029580205.1\|2282445_2283696_+	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	2.3e-97	52.3
WP_032979312.1\|2283954_2284440_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_032979313.1\|2284444_2285407_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_029580208.1\|2285406_2285967_-	isochorismatase family protein	NA	NA	NA	NA
WP_142098921.1\|2286164_2287280_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.2e-39	33.5
WP_029580210.1\|2287300_2287942_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.0e-27	37.6

DBSCAN-SWA_181

2297323 : 2300208

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097210.1\|2297323_2298220_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.8e-14	27.3
WP_029580219.1\|2298681_2300208_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	2.3e-54	31.2

DBSCAN-SWA_182

2315685 : 2317347

IC4_retrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051593971.1\|2315685_2317347_-	bifunctional protein-serine/threonine kinase/phosphatase	Q67624	IC4_retrovirus	9.0e-12	32.6

DBSCAN-SWA_183

2326852 : 2327194

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051350509.1\|2326852_2327194_-	helix-turn-helix transcriptional regulator	H2BD63	Pseudomonas_phage	1.7e-05	40.0

DBSCAN-SWA_184

2333301 : 2346041

Bacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580253.1\|2333301_2334720_-	LysM peptidoglycan-binding domain-containing protein	A0A223LD43	Bacillus_phage	8.2e-06	27.5
WP_142097230.1\|2334727_2335537_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_142097233.1\|2335554_2336319_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_029580256.1\|2336388_2336850_+	ribonuclease HI	J9Q745	Salmonella_phage	7.6e-38	51.5
WP_032979324.1\|2336978_2338052_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_032955381.1\|2338067_2341133_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.3e-76	23.2
WP_029580259.1\|2341140_2341875_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	4.5e-40	42.1
WP_142097236.1\|2342336_2343323_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_029580261.1\|2343326_2346041_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	8.6e-20	30.2

DBSCAN-SWA_185

2349451 : 2354249

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097238.1\|2349451_2350498_+	glycosyltransferase	A8CG95	Salmonella_phage	2.3e-58	39.3
WP_142097241.1\|2350494_2352084_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_051621624.1\|2352019_2352529_-	GtrA family protein	NA	NA	NA	NA
WP_051621623.1\|2352454_2353363_+	ChbG/HpnK family deacetylase	NA	NA	NA	NA
WP_142097244.1\|2353352_2354249_-	alpha/beta fold hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	2.4e-11	31.8

DBSCAN-SWA_186

2358654 : 2360769

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580275.1\|2358654_2360769_+	elongation factor G	E4ZFJ7	Streptococcus_phage	3.3e-59	27.4

DBSCAN-SWA_187

2369235 : 2370966

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580287.1\|2369235_2370966_-\|tRNA	proline--tRNA ligase	A0A2K9L0T2	Tupanvirus	1.3e-10	31.7

DBSCAN-SWA_188

2400965 : 2402774

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964679.1\|2400965_2402774_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.6e-46	28.4

DBSCAN-SWA_189

2422650 : 2423631

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578507.1\|2422650_2423631_+	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	7.6e-27	35.6

DBSCAN-SWA_190

2436729 : 2438430

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956924.1\|2436729_2438430_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	1.9e-33	29.1

DBSCAN-SWA_191

2443926 : 2445015

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578525.1\|2443926_2445015_+	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	6.5e-11	25.9

DBSCAN-SWA_192

2452973 : 2455196

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578532.1\|2452973_2453822_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.6e-49	43.3
WP_032972139.1\|2453840_2455196_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	2.2e-45	30.7

DBSCAN-SWA_193

2474805 : 2483622

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940337.1\|2474805_2475468_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.5e-07	25.0
WP_029578546.1\|2475527_2476622_+	chain-length determining protein	NA	NA	NA	NA
WP_029578547.1\|2476639_2477758_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	2.1e-28	30.0
WP_048940336.1\|2477767_2479030_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	2.3e-23	27.9
WP_142097288.1\|2479038_2483622_+	glycosyltransferase	A0A1V0SL50	Klosneuvirus	1.0e-36	29.0

DBSCAN-SWA_194

2491361 : 2493920

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097300.1\|2491361_2492447_+	glycosyltransferase	A0A1V0SAE6	Catovirus	3.4e-20	27.9
WP_142097302.1\|2492456_2493920_+	glycosyltransferase	M1I091	Acanthocystis_turfacea_Chlorella_virus	2.3e-19	27.7

DBSCAN-SWA_195

2498370 : 2499120

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581576.1\|2498370_2499120_+	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	8.4e-10	24.4

DBSCAN-SWA_196

2520808 : 2521951

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940321.1\|2520808_2521951_-	glycerate kinase	W6LM47	Streptococcus_phage	2.1e-36	37.3

DBSCAN-SWA_197

2527102 : 2527636

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940319.1\|2527102_2527636_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	1.7e-12	39.6

DBSCAN-SWA_198

2546887 : 2565146

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581532.1\|2546887_2548240_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	8.9e-26	36.3
WP_032963912.1\|2548239_2548938_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_029581530.1\|2548934_2549630_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_032959520.1\|2549878_2550928_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	4.5e-70	45.4
WP_029581528.1\|2550978_2551929_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_142097334.1\|2551931_2553797_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.9e-83	34.4
WP_032957115.1\|2553917_2554553_+	membrane protein	NA	NA	NA	NA
WP_142097336.1\|2554560_2563671_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	2.1e-25	28.8
WP_029581524.1\|2563763_2565146_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.5e-17	30.5

DBSCAN-SWA_199

2573988 : 2578901

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097338.1\|2573988_2578056_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	2.4e-10	35.8
WP_029581516.1\|2578052_2578901_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	3.9e-11	42.5

DBSCAN-SWA_200

2583499 : 2586645

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581510.1\|2583499_2584681_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	6.2e-15	56.6
WP_032963933.1\|2584677_2586645_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	5.8e-34	40.1

DBSCAN-SWA_201

2592986 : 2599886

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581502.1\|2592986_2594117_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	2.1e-36	39.6
WP_032957049.1\|2594123_2599886_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.4e-199	40.1

DBSCAN-SWA_202

2607901 : 2610304

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097355.1\|2607901_2609524_+	AMP-binding protein	A0A1V0SBX8	Catovirus	1.4e-17	24.8
WP_029581492.1\|2609545_2610304_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	6.7e-15	27.5

DBSCAN-SWA_203

2630083 : 2630872

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581472.1\|2630083_2630872_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-13	24.7

DBSCAN-SWA_204

2645801 : 2654572

Leptospira_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097385.1\|2645801_2648897_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.0e-56	22.2
WP_029581462.1\|2648909_2650313_+	TolC family protein	NA	NA	NA	NA
WP_029581461.1\|2650328_2650988_+	transcriptional regulator	NA	NA	NA	NA
WP_029581460.1\|2651102_2652392_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	5.9e-19	28.4
WP_142097388.1\|2652403_2654572_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	6.8e-52	26.9

DBSCAN-SWA_205

2681946 : 2686057

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962931.1\|2681946_2682705_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.6e-14	28.9
WP_029581431.1\|2682694_2683423_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-09	24.5
WP_029581430.1\|2683618_2683834_+	transporter	NA	NA	NA	NA
WP_029581429.1\|2683842_2685192_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_029581428.1\|2685208_2686057_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-27	33.3

DBSCAN-SWA_206

2699908 : 2704017

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097420.1\|2699908_2701285_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-33	26.5
WP_029581413.1\|2701325_2702498_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_032978247.1\|2702511_2704017_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.9e-33	28.8

DBSCAN-SWA_207

2708039 : 2709502

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581407.1\|2708039_2708792_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.7e-05	29.1
WP_032955764.1\|2708788_2709502_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.1e-14	24.9

DBSCAN-SWA_208

2755822 : 2756791

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098958.1\|2755822_2756791_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.6e-16	28.0

DBSCAN-SWA_209

2775705 : 2777319

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581348.1\|2775705_2777319_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-08	28.2

DBSCAN-SWA_210

2780611 : 2782432

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700976.1\|2780611_2782432_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-27	27.9

DBSCAN-SWA_211

2806106 : 2808407

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955428.1\|2806106_2807381_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.3e-122	55.6
WP_032955430.1\|2807531_2808407_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.2e-09	26.8

DBSCAN-SWA_212

2826370 : 2827054

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581305.1\|2826370_2827054_+	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	2.7e-15	26.9

DBSCAN-SWA_213

2881890 : 2882433

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581256.1\|2881890_2882433_+	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	1.7e-12	32.5

DBSCAN-SWA_214

2906527 : 2908270

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578915.1\|2906527_2908270_+	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	4.5e-14	28.7

DBSCAN-SWA_215

2912662 : 2922749

Streptococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097591.1\|2912662_2913922_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.8e-95	45.7
WP_142097594.1\|2913951_2914992_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_032955283.1\|2914991_2915669_-	lipoprotein	NA	NA	NA	NA
WP_029578905.1\|2915680_2918338_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.9e-173	39.1
WP_029578904.1\|2918410_2919571_-	MFS transporter	NA	NA	NA	NA
WP_032955268.1\|2919603_2920116_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_029578902.1\|2920232_2920679_-	DNA-binding protein	NA	NA	NA	NA
WP_029578901.1\|2920979_2922749_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	5.1e-13	22.8

DBSCAN-SWA_216

2929980 : 2937520

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578894.1\|2929980_2931210_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-28	37.1
WP_029578893.1\|2931287_2931662_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_029578892.1\|2931710_2932892_+	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_142097603.1\|2932948_2933572_-	toxin	NA	NA	NA	NA
WP_029578890.1\|2933583_2934030_-	hypothetical protein	NA	NA	NA	NA
WP_029578889.1\|2934117_2934747_-	TIGR00730 family Rossman fold protein	A0A1D8KU27	Synechococcus_phage	2.3e-16	36.1
WP_032955274.1\|2934799_2937520_+	DNA polymerase I	A0A218MKQ4	uncultured_virus	1.6e-71	30.6

DBSCAN-SWA_217

2945597 : 2946269

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578880.1\|2945597_2946269_-	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	2.9e-09	30.5

DBSCAN-SWA_218

2958172 : 2963651

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578873.1\|2958172_2958499_-	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	3.6e-18	44.1
WP_048940262.1\|2958722_2960735_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.1e-93	35.8
WP_032964089.1\|2960734_2961322_+	YcxB family protein	NA	NA	NA	NA
WP_142097617.1\|2961335_2963651_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	9.1e-79	31.4

DBSCAN-SWA_219

2989547 : 2992169

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578845.1\|2989547_2992169_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.6e-84	39.2

DBSCAN-SWA_220

2995425 : 2999046

Klosneuvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955352.1\|2995425_2998305_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.1e-137	37.7
WP_029578838.1\|2998620_2999046_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	4.9e-23	43.6

DBSCAN-SWA_221

3012837 : 3020277

Pithovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075177.1\|3012837_3014145_+	adenylosuccinate synthase	W5S5V7	Pithovirus	8.8e-63	33.0
WP_029578824.1\|3014267_3014807_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_006218592.1\|3015096_3015309_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_142097634.1\|3015326_3017375_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	7.8e-66	42.6
WP_029578822.1\|3018012_3020277_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.4e-36	30.8

DBSCAN-SWA_222

3024733 : 3025498

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700562.1\|3024733_3025498_-	LexA family transcriptional regulator	A0A0U2QW76	Escherichia_phage	2.2e-05	40.0

DBSCAN-SWA_223

3031144 : 3043187

Yersinia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940256.1\|3031144_3032056_-	prohibitin family protein	A0A2C9CWL5	Yersinia_phage	8.9e-46	54.7
WP_142098972.1\|3032436_3033063_-	LysE family transporter	NA	NA	NA	NA
WP_142097640.1\|3033132_3034365_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_029578808.1\|3034938_3036558_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-10	56.2
WP_029578807.1\|3036563_3037067_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_142097643.1\|3037063_3038281_+	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_029578805.1\|3038273_3038900_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_029578804.1\|3038896_3041125_+	hybrid sensor histidine kinase/response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.4e-12	27.0
WP_029578803.1\|3041121_3042153_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_029578802.1\|3042164_3043187_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.0e-18	39.1

DBSCAN-SWA_224

3082724 : 3083459

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003813882.1\|3082724_3083459_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	1.3e-34	36.3

DBSCAN-SWA_225

3091961 : 3094826

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578756.1\|3091961_3094046_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.5e-152	45.4
WP_029578755.1\|3094055_3094826_-	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.9e-14	34.3

DBSCAN-SWA_226

3100304 : 3100982

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578747.1\|3100304_3100982_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-11	31.5

DBSCAN-SWA_227

3104755 : 3106591

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940247.1\|3104755_3106591_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	2.0e-12	28.6

DBSCAN-SWA_228

3114011 : 3115492

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578735.1\|3114011_3114722_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.0e-05	26.3
WP_029578734.1\|3114718_3115492_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-14	23.3

DBSCAN-SWA_229

3119727 : 3120903

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957276.1\|3119727_3120903_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	9.4e-48	32.5

DBSCAN-SWA_230

3125127 : 3126441

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578723.1\|3125127_3126441_-	MFS transporter	Q6JIH2	Burkholderia_virus	6.5e-82	40.2

DBSCAN-SWA_231

3138611 : 3139391

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097686.1\|3138611_3139391_-	N-acetylmuramoyl-L-alanine amidase	A0A223VZK2	Agrobacterium_phage	4.2e-12	32.0

DBSCAN-SWA_232

3144943 : 3155242

Trichoplusia_ni_ascovirus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578704.1\|3144943_3145696_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.6e-16	34.0
WP_003813816.1\|3145912_3146152_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	5.4e-11	46.6
WP_032978299.1\|3146324_3147554_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_080666534.1\|3147556_3147985_+	hypothetical protein	NA	NA	NA	NA
WP_005012194.1\|3147981_3148581_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	2.6e-06	26.9
WP_029578702.1\|3148593_3149079_+	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_029578701.1\|3149078_3150110_+	siderophore-interacting protein	NA	NA	NA	NA
WP_032963963.1\|3150150_3151635_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.9e-21	29.6
WP_029578699.1\|3151779_3153573_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.1e-22	23.5
WP_029578698.1\|3153596_3154481_+	signal peptidase I	NA	NA	NA	NA
WP_095075180.1\|3154477_3155242_+	ribonuclease III	M4QNJ2	Ostreococcus_lucimarinus_virus	1.2e-19	33.5

DBSCAN-SWA_233

3158304 : 3159819

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578691.1\|3158304_3159819_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	7.3e-53	38.3

DBSCAN-SWA_234

3166616 : 3173262

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578684.1\|3166616_3167282_-	C40 family peptidase	A0A0A8WF62	Clostridium_phage	1.8e-16	35.3
WP_080700566.1\|3167489_3169415_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.2e-62	30.9
WP_029578682.1\|3169414_3169822_+	hypothetical protein	NA	NA	NA	NA
WP_032957228.1\|3169905_3171132_+	MFS transporter	NA	NA	NA	NA
WP_142097698.1\|3171219_3173262_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.2e-82	44.1

DBSCAN-SWA_235

3182329 : 3184216

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578670.1\|3182329_3184216_+	dipeptide ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.9e-06	39.1

DBSCAN-SWA_236

3189743 : 3200525

Acinetobacter_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578664.1\|3189743_3191540_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	3.8e-165	49.3
WP_029578663.1\|3191778_3193431_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.5e-157	53.5
WP_029578662.1\|3193590_3193875_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_029578661.1\|3193878_3195165_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.4e-150	63.8
WP_029578660.1\|3195239_3195611_+	cell division protein FtsB	NA	NA	NA	NA
WP_142097707.1\|3195622_3196279_-	hypothetical protein	NA	NA	NA	NA
WP_032957198.1\|3196333_3197254_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_029578657.1\|3197292_3197814_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_029578656.1\|3197837_3199502_-	AMP-binding protein	A0A2K9L3I8	Tupanvirus	5.4e-17	22.9
WP_029578655.1\|3199685_3200525_-	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	6.4e-67	47.7

DBSCAN-SWA_237

3210734 : 3212513

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578643.1\|3210734_3212513_+	succinate dehydrogenase flavoprotein subunit	A0A2P0ZL82	Lactobacillus_phage	2.3e-05	24.3

DBSCAN-SWA_238

3215975 : 3217052

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097710.1\|3215975_3217052_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-29	35.8

DBSCAN-SWA_239

3223913 : 3224597

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097720.1\|3223913_3224597_-	Fe2+-dependent dioxygenase	A0A1D8KSK5	Synechococcus_phage	3.6e-15	41.0

DBSCAN-SWA_240

3238914 : 3240342

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578623.1\|3238914_3240342_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.9e-43	28.9

DBSCAN-SWA_241

3247860 : 3249906

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955832.1\|3247860_3249906_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	1.6e-74	29.5

DBSCAN-SWA_242

3267116 : 3275592

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578595.1\|3267116_3267647_-	cytochrome b	A0A0U2QLA7	Escherichia_phage	1.8e-11	43.3
WP_142097736.1\|3267793_3270367_-	cyanophycin synthetase	S4VXG8	Pandoravirus	4.3e-05	26.6
WP_095075245.1\|3270437_3273086_-	cyanophycin synthetase	NA	NA	NA	NA
WP_029578592.1\|3273315_3275592_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-57	31.1

DBSCAN-SWA_243

3279824 : 3284289

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578586.1\|3279824_3280664_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.3e-55	43.3
WP_032955821.1\|3281044_3282607_+	diguanylate cyclase	NA	NA	NA	NA
WP_029578584.1\|3282678_3284289_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.9e-11	33.3

DBSCAN-SWA_244

3296167 : 3302165

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032978152.1\|3296167_3298807_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	6.0e-103	32.6
WP_142097747.1\|3298814_3299945_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.1e-77	44.0
WP_029577248.1\|3299937_3301023_+	prephenate dehydratase	NA	NA	NA	NA
WP_032955096.1\|3301043_3302165_+	histidinol-phosphate transaminase	A0A0H3TLT9	Faustovirus	1.4e-13	24.9

DBSCAN-SWA_245

3309085 : 3314583

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051350494.1\|3309085_3310027_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	M4QF80	Synechococcus_phage	1.2e-13	30.2
WP_142097754.1\|3310023_3311013_+	ADP-glyceromanno-heptose 6-epimerase	M4PRR6	Cyanophage	2.2e-26	32.2
WP_029577257.1\|3311128_3311482_+	hypothetical protein	NA	NA	NA	NA
WP_032955093.1\|3311543_3312455_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.9e-49	40.7
WP_029577259.1\|3312509_3313649_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_032955110.1\|3313668_3314583_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.5e-42	34.7

DBSCAN-SWA_246

3323874 : 3327904

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577269.1\|3323874_3324939_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.3e-27	32.2
WP_029577270.1\|3324935_3325664_+	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_029577271.1\|3325677_3326586_+	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
WP_029577272.1\|3326599_3327904_+	sulfate adenylyltransferase	A0A1V0SGC3	Hokovirus	6.1e-32	29.1

DBSCAN-SWA_247

3335412 : 3335958

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955086.1\|3335412_3335958_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	4.2e-27	38.4

DBSCAN-SWA_248

3342728 : 3343817

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577291.1\|3342728_3343817_+	phenylacetate-CoA oxygenase/reductase subunit PaaK	V5UTY8	Synechococcus_phage	9.0e-13	44.9

DBSCAN-SWA_249

3348596 : 3351300

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577297.1\|3348596_3349826_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	4.7e-135	58.4
WP_142097780.1\|3349849_3350542_-	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	2.9e-17	28.6
WP_029577299.1\|3350556_3351300_-	urea ABC transporter ATP-binding protein UrtD	A0A2H4PQG7	Staphylococcus_phage	3.5e-16	26.5

DBSCAN-SWA_250

3354862 : 3359141

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577303.1\|3354862_3358258_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-29	27.9
WP_142097787.1\|3358226_3359141_+	response regulator	W8CYM9	Bacillus_phage	4.0e-14	33.3

DBSCAN-SWA_251

3370631 : 3371759

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577316.1\|3370631_3371759_+	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.4e-24	35.7

DBSCAN-SWA_252

3381922 : 3390374

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955077.1\|3381922_3385813_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	9.6e-49	28.9
WP_029577329.1\|3385843_3386743_-	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	1.0e-33	36.3
WP_029577330.1\|3386882_3390374_+	DNA polymerase III subunit alpha	A0A1C9LWS4	Streptomyces_phage	2.9e-185	37.3

DBSCAN-SWA_253

3398196 : 3403079

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577340.1\|3398196_3399972_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	4.4e-49	29.1
WP_142097804.1\|3400323_3402282_+	hypothetical protein	NA	NA	NA	NA
WP_142097807.1\|3402077_3403079_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.6e-43	31.2

DBSCAN-SWA_254

3412374 : 3413394

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579745.1\|3412374_3413394_-	histone deacetylase family protein	A0A2K9L473	Tupanvirus	8.4e-29	35.9

DBSCAN-SWA_255

3416629 : 3417280

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579742.1\|3416629_3417280_+	HD domain-containing protein	S4W232	Pandoravirus	9.5e-10	32.1

DBSCAN-SWA_256

3431130 : 3432645

Klebsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957442.1\|3431130_3432645_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	2.0e-79	45.6

DBSCAN-SWA_257

3439048 : 3443385

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579720.1\|3439048_3440113_-	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	2.5e-44	36.8
WP_029579719.1\|3440133_3440424_-	cupin	NA	NA	NA	NA
WP_029579718.1\|3440442_3441735_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	6.9e-28	28.2
WP_029579717.1\|3441744_3443385_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-16	29.6

DBSCAN-SWA_258

3447307 : 3448852

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579713.1\|3447307_3448852_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.1e-14	25.7

DBSCAN-SWA_259

3460801 : 3463814

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579701.1\|3460801_3461368_-	HD domain-containing protein	A0A2K9L141	Tupanvirus	4.5e-16	32.1
WP_029579700.1\|3461518_3462670_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_142097831.1\|3462809_3463814_-	acyltransferase family protein	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	5.2e-15	24.9

DBSCAN-SWA_260

3472809 : 3478049

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579687.1\|3472809_3474183_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.1e-132	57.7
WP_029579686.1\|3474243_3475203_-	bile acid:sodium symporter	NA	NA	NA	NA
WP_029579685.1\|3475290_3476268_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_029579684.1\|3476396_3478049_-	PhoH family protein	A0A1L2CUJ9	Pectobacterium_phage	1.1e-70	33.9

DBSCAN-SWA_261

3483614 : 3487351

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579677.1\|3483614_3484634_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	2.5e-49	36.1
WP_032956840.1\|3484642_3487351_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	1.6e-18	25.3

DBSCAN-SWA_262

3490840 : 3491914

Edwardsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579672.1\|3490840_3491914_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	5.1e-77	47.3

DBSCAN-SWA_263

3502547 : 3507694

Burkholderia_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579662.1\|3502547_3503468_+	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	1.4e-27	31.2
WP_142097839.1\|3503476_3504589_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_029579660.1\|3504676_3505498_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_142097841.1\|3505563_3506172_-	glutathione S-transferase	NA	NA	NA	NA
WP_142097843.1\|3506317_3507694_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.2e-107	46.6

DBSCAN-SWA_264

3514930 : 3516088

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126623591.1\|3514930_3516088_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.9e-14	30.3

DBSCAN-SWA_265

3525756 : 3527040

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579639.1\|3525756_3527040_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	8.7e-156	68.8

DBSCAN-SWA_266

3530123 : 3535343

Lactococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579635.1\|3530123_3532598_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.7e-65	32.4
WP_029579634.1\|3532707_3533448_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_029579633.1\|3533499_3534744_+	cystathionine gamma-synthase family protein	A0A0B5JD48	Pandoravirus	2.2e-10	28.0
WP_005012769.1\|3535070_3535343_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	4.2e-20	56.2

DBSCAN-SWA_267

3538806 : 3548293

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579628.1\|3538806_3539928_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.6e-15	28.9
WP_032959497.1\|3539947_3541792_+	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	2.6e-68	31.4
WP_029579626.1\|3541966_3543154_+	FkbM family methyltransferase	NA	NA	NA	NA
WP_029579625.1\|3543221_3544559_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	5.6e-57	83.3
WP_032956815.1\|3544656_3545598_-	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	9.9e-16	25.2
WP_029579623.1\|3545653_3546835_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.4e-22	28.0
WP_029579622.1\|3546993_3547284_+	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_029579621.1\|3547339_3548293_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	5.9e-16	26.6

DBSCAN-SWA_268

3567749 : 3569108

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579600.1\|3567749_3569108_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.9e-31	34.3

DBSCAN-SWA_269

3572706 : 3574072

Synechococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579596.1\|3572706_3573156_-	DUF192 domain-containing protein	A0A222YVT9	Synechococcus_phage	8.9e-15	45.6
WP_012249572.1\|3573289_3573535_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.9e-20	75.0
WP_029579595.1\|3573757_3574072_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	6.4e-12	45.1

DBSCAN-SWA_270

3581567 : 3583877

Agrobacterium_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579592.1\|3581567_3583877_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.0e-164	41.7

DBSCAN-SWA_271

3594983 : 3599819

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579584.1\|3594983_3595790_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-13	23.9
WP_029579583.1\|3595786_3596512_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_029579582.1\|3596508_3597804_-	MFS transporter	NA	NA	NA	NA
WP_029579581.1\|3597887_3598493_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_029579580.1\|3598580_3599819_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	3.4e-32	30.2

DBSCAN-SWA_272

3603676 : 3614942

Bodo_saltans_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579576.1\|3603676_3604699_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
WP_029579575.1\|3604711_3607129_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_029579574.1\|3607131_3607482_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.3e-13	43.3
WP_029579573.1\|3607539_3607938_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_080700993.1\|3608117_3609281_-	hypothetical protein	NA	NA	NA	NA
WP_142097863.1\|3609842_3609995_+	hypothetical protein	NA	NA	NA	NA
WP_142099002.1\|3610330_3611077_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	2.5e-22	33.7
WP_142097866.1\|3611146_3613108_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	4.0e-27	29.4
WP_029579569.1\|3613228_3613735_+	N-acetyltransferase	NA	NA	NA	NA
WP_029579568.1\|3613747_3613990_-	hypothetical protein	NA	NA	NA	NA
WP_029579567.1\|3614118_3614397_-	hypothetical protein	NA	NA	NA	NA
WP_029579566.1\|3614489_3614942_+	low affinity iron permease family protein	A0A1C9EHA1	Mycobacterium_phage	2.2e-05	39.5

DBSCAN-SWA_273

3620394 : 3626357

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956625.1\|3620394_3622194_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	9.6e-44	27.6
WP_080700840.1\|3622342_3623146_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	3.4e-65	47.4
WP_029579553.1\|3623149_3624136_+	aldo/keto reductase	NA	NA	NA	NA
WP_032961629.1\|3624157_3624352_-	hypothetical protein	NA	NA	NA	NA
WP_029579551.1\|3624348_3625524_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_095075188.1\|3625628_3626357_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-59	50.0

DBSCAN-SWA_274

3633256 : 3633718

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579544.1\|3633256_3633718_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.1e-17	44.1

DBSCAN-SWA_275

3655572 : 3661553

Bacillus_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579522.1\|3655572_3656322_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-30	33.5
WP_029579521.1\|3656336_3657209_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_032955635.1\|3657225_3658110_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_080700158.1\|3658310_3659084_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_142097887.1\|3659240_3661553_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.2e-125	43.5

DBSCAN-SWA_276

3665804 : 3667439

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940188.1\|3665804_3667439_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6

DBSCAN-SWA_277

3677388 : 3679251

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979605.1\|3677388_3679251_+	dipeptide ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.7e-07	23.1

DBSCAN-SWA_278

3694685 : 3695540

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955787.1\|3694685_3695540_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	4.4e-31	38.6

DBSCAN-SWA_279

3702827 : 3704594

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097900.1\|3702827_3704594_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.5e-38	25.2

DBSCAN-SWA_280

3712810 : 3722299

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579476.1\|3712810_3713191_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.0e-08	31.9
WP_142097913.1\|3713244_3715326_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_029579474.1\|3715339_3715843_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_142097916.1\|3715897_3717574_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-10	37.6
WP_095075189.1\|3717593_3718427_+	chemotaxis protein CheR	NA	NA	NA	NA
WP_029577896.1\|3718426_3719476_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_029577897.1\|3719518_3719908_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	7.0e-08	31.7
WP_029577898.1\|3719916_3720546_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_048940178.1\|3720736_3722299_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-09	32.6

DBSCAN-SWA_281

3736260 : 3737235

Sulfitobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097930.1\|3736260_3737235_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.2e-11	30.6

DBSCAN-SWA_282

3740299 : 3748176

uncultured_Caudovirales_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142097934.1\|3740299_3742129_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-10	28.8
WP_142097937.1\|3742238_3744035_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-12	28.9
WP_032955314.1\|3744106_3744541_+	hypothetical protein	NA	NA	NA	NA
WP_142097941.1\|3744658_3746392_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-12	38.4
WP_142097944.1\|3746541_3748176_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	4.6e-37	43.9

DBSCAN-SWA_283

3772105 : 3773626

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581212.1\|3772105_3773626_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.0e-96	43.9

DBSCAN-SWA_284

3782373 : 3783132

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581203.1\|3782373_3783132_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.1e-16	33.1

DBSCAN-SWA_285

3793392 : 3801824

Emiliania_huxleyi_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581193.1\|3793392_3794001_+	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	3.0e-26	41.5
WP_032956766.1\|3793997_3794777_+	RNA methyltransferase	NA	NA	NA	NA
WP_029581191.1\|3794848_3795244_+	hypothetical protein	NA	NA	NA	NA
WP_029581190.1\|3795254_3796082_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_029581189.1\|3796241_3798608_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	4.5e-166	36.1
WP_029581188.1\|3798774_3799206_+	NfeD-like family protein 1	NA	NA	NA	NA
WP_029581187.1\|3799239_3800166_+	paraslipin	NA	NA	NA	NA
WP_032956776.1\|3800222_3801353_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.0e-15	32.8
WP_029581185.1\|3801362_3801824_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.4e-28	47.9

DBSCAN-SWA_286

3809043 : 3809667

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581176.1\|3809043_3809667_+	dTMP kinase	A0A1L2BX49	Bacteriophage	3.8e-24	39.2

DBSCAN-SWA_287

3814706 : 3815471

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581169.1\|3814706_3815471_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-33	39.5

DBSCAN-SWA_288

3822924 : 3823521

Agrobacterium_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955126.1\|3822924_3823521_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.0e-54	52.0

DBSCAN-SWA_289

3827507 : 3828014

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581152.1\|3827507_3828014_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	2.4e-24	39.0

DBSCAN-SWA_290

3831325 : 3834826

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581148.1\|3831325_3832738_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	3.0e-40	27.5
WP_029581147.1\|3832961_3834416_+	carnitine dehydratase	NA	NA	NA	NA
WP_029581146.1\|3834466_3834826_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-29	58.0

DBSCAN-SWA_291

3841605 : 3842298

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955136.1\|3841605_3842298_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	3.7e-12	31.9

DBSCAN-SWA_292

3845680 : 3848410

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961829.1\|3845680_3848410_-	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	6.0e-21	29.6

DBSCAN-SWA_293

3853547 : 3858133

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581125.1\|3853547_3855734_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.9e-78	35.6
WP_142098008.1\|3855760_3858133_-	DNA ligase D	A0A068CDF3	Rhizobium_phage	2.7e-54	40.2

DBSCAN-SWA_294

3861497 : 3863741

Acidianus_spindle-shaped_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098014.1\|3861497_3863741_+	ATP-dependent DNA helicase	D1GF97	Acidianus_spindle-shaped_virus	1.3e-05	25.6

DBSCAN-SWA_295

3869091 : 3870075

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581113.1\|3869091_3870075_-	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.1e-12	26.8

DBSCAN-SWA_296

3882620 : 3884575

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581101.1\|3882620_3883604_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.3e-05	21.5
WP_029581100.1\|3883600_3884575_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.1e-12	27.3

DBSCAN-SWA_297

3920802 : 3921543

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581066.1\|3920802_3921543_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.9e-07	24.5

DBSCAN-SWA_298

3932689 : 3933601

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581051.1\|3932689_3933601_+	3-phosphoglycerate dehydrogenase	M1HBE3	Paramecium_bursaria_Chlorella_virus	1.7e-20	30.7

DBSCAN-SWA_299

3945548 : 3947198

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098103.1\|3945548_3947198_+	sulfatase-like hydrolase/transferase	A0A2P0VMN7	Tetraselmis_virus	1.5e-136	49.0

DBSCAN-SWA_300

3962965 : 3966538

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098143.1\|3962965_3966538_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.2e-50	34.2

DBSCAN-SWA_301

3983402 : 3984473

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581029.1\|3983402_3984473_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	7.8e-25	32.7

DBSCAN-SWA_302

4007429 : 4008973

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142099026.1\|4007429_4008149_-	ATP-binding cassette domain-containing protein	A0A1V0SJ29	Klosneuvirus	6.4e-07	24.2
WP_142098180.1\|4008163_4008973_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	2.5e-07	22.0

DBSCAN-SWA_303

4016176 : 4017553

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962087.1\|4016176_4017553_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.3e-29	67.4

DBSCAN-SWA_304

4051707 : 4068217

Niemeyer_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940125.1\|4051707_4052751_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	2.9e-32	32.1
WP_032972277.1\|4052747_4054112_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_142098220.1\|4054295_4057256_-	GAF domain-containing protein	B5LWN8	Feldmannia_species_virus	2.4e-07	25.0
WP_032955920.1\|4057422_4057929_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_032955922.1\|4057937_4058783_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.0e-64	49.6
WP_032955923.1\|4058933_4059917_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.7e-48	40.6
WP_051593835.1\|4059860_4060484_-	hypothetical protein	NA	NA	NA	NA
WP_051593836.1\|4060455_4061370_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_048940123.1\|4061362_4062067_-	PIG-L family deacetylase	NA	NA	NA	NA
WP_032955924.1\|4062190_4062457_+	hypothetical protein	NA	NA	NA	NA
WP_080700273.1\|4062462_4063542_-	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	2.1e-70	43.4
WP_043224171.1\|4063502_4064456_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_048940121.1\|4064445_4065501_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_032962598.1\|4065497_4066481_-	glycosyltransferase	NA	NA	NA	NA
WP_032955929.1\|4066477_4068217_-	carbamoyltransferase	A0A1B1IVF2	uncultured_Mediterranean_phage	6.4e-53	34.1

DBSCAN-SWA_305

4073307 : 4076010

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955938.1\|4073307_4076010_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	5.3e-46	31.6

DBSCAN-SWA_306

4089788 : 4096568

Brazilian_cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580979.1\|4089788_4090655_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	6.7e-11	26.6
WP_142098232.1\|4090638_4091376_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_142098235.1\|4091391_4093110_+	FAD-binding protein	M1HTN0	Paramecium_bursaria_Chlorella_virus	3.1e-23	27.7
WP_142098238.1\|4093106_4093463_+	hypothetical protein	NA	NA	NA	NA
WP_142098241.1\|4093488_4094031_+	winged helix DNA-binding protein	NA	NA	NA	NA
WP_141985010.1\|4094050_4095010_-	ABC transporter permease	NA	NA	NA	NA
WP_142098244.1\|4095056_4096568_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	5.5e-16	28.0

DBSCAN-SWA_307

4108652 : 4110311

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984949.1\|4108652_4110311_+	dipeptide ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	7.3e-06	24.4

DBSCAN-SWA_308

4128798 : 4133488

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098257.1\|4128798_4130319_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.8e-36	25.7
WP_029580942.1\|4130349_4131513_-	CoA transferase	NA	NA	NA	NA
WP_029580941.1\|4131596_4132265_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_029580940.1\|4132444_4133488_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.7e-21	26.9

DBSCAN-SWA_309

4142246 : 4145668

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956010.1\|4142246_4142975_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-07	22.3
WP_029580930.1\|4142967_4144488_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.2e-32	24.7
WP_032962662.1\|4144484_4144868_+	hypothetical protein	NA	NA	NA	NA
WP_142098260.1\|4144870_4145668_+	alpha/beta fold hydrolase	Q857G1	Mycobacterium_phage	4.7e-11	38.5

DBSCAN-SWA_310

4153806 : 4155268

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580920.1\|4153806_4154580_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.3e-12	30.2
WP_142098272.1\|4154569_4155268_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.9e-08	23.4

DBSCAN-SWA_311

4159842 : 4160058

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580914.1\|4159842_4160058_-	DUF3596 domain-containing protein	A0A1W6JTA0	Pseudomonas_phage	7.2e-07	54.7

DBSCAN-SWA_312

4167939 : 4168692

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098276.1\|4167939_4168692_-	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	5.1e-15	29.1

DBSCAN-SWA_313

4174213 : 4174978

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956101.1\|4174213_4174978_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.2e-13	28.6

DBSCAN-SWA_314

4184921 : 4186469

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580891.1\|4184921_4186469_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.0e-37	42.5

DBSCAN-SWA_315

4190896 : 4194559

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098289.1\|4190896_4194559_+	transporter substrate-binding domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	6.7e-36	31.1

DBSCAN-SWA_316

4205081 : 4206779

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956041.1\|4205081_4206779_+	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	4.7e-32	25.7

DBSCAN-SWA_317

4220460 : 4221930

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580860.1\|4220460_4221162_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-08	23.2
WP_029580859.1\|4221162_4221930_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.2e-13	25.6

DBSCAN-SWA_318

4225654 : 4226185

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075250.1\|4225654_4226185_-	queuosine precursor transporter	A0A2I7SAW6	Vibrio_phage	1.9e-16	35.8

DBSCAN-SWA_319

4230626 : 4231715

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580849.1\|4230626_4231715_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	3.0e-24	31.7

DBSCAN-SWA_320

4242129 : 4243467

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098307.1\|4242129_4243467_+	glycosyltransferase	A0A1V0SAH6	Catovirus	1.0e-13	33.1

DBSCAN-SWA_321

4248139 : 4250729

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580835.1\|4248139_4248640_-	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	2.4e-13	35.5
WP_032960163.1\|4248702_4249119_-	hypothetical protein	NA	NA	NA	NA
WP_142098310.1\|4249115_4250729_-	dehydrogenase	A0A1V0SI18	Klosneuvirus	3.4e-48	28.9

DBSCAN-SWA_322

4254078 : 4255915

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098314.1\|4254078_4254897_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.0e-29	35.2
WP_029580828.1\|4254901_4255504_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_029580827.1\|4255537_4255915_-	RidA family protein	S4W0G3	Pandoravirus	1.1e-05	35.8

DBSCAN-SWA_323

4261659 : 4262619

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580821.1\|4261659_4262619_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.7e-13	26.1

DBSCAN-SWA_324

4270510 : 4271287

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979546.1\|4270510_4271287_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	6.0e-19	31.4

DBSCAN-SWA_325

4276270 : 4284616

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098328.1\|4276270_4280698_+	response regulator	A0A1V0SGX0	Hokovirus	1.1e-75	27.0
WP_029580807.1\|4280752_4281904_+	two-component system response regulator	W8CYM9	Bacillus_phage	5.1e-14	41.9
WP_029580806.1\|4282040_4283552_-	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_029580805.1\|4283551_4284616_-	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-07	23.4

DBSCAN-SWA_326

4290018 : 4291680

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700551.1\|4290018_4291680_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-08	29.5

DBSCAN-SWA_327

4302139 : 4307600

Clostridium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080666610.1\|4302139_4302682_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	1.5e-21	39.8
WP_142098334.1\|4302700_4303471_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_029580788.1\|4303644_4304277_+	guanylate kinase	A0A223FN12	Murmansk_poxvirus	3.3e-15	33.3
WP_003811126.1\|4304316_4304520_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_029580787.1\|4304543_4306841_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	8.9e-10	36.2
WP_029580786.1\|4306871_4307600_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	9.6e-35	42.3

DBSCAN-SWA_328

4325396 : 4351205

uncultured_Mediterranean_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098348.1\|4325396_4332902_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	2.3e-22	30.2
WP_032955215.1\|4333253_4334198_+	DMT family transporter	NA	NA	NA	NA
WP_029580770.1\|4334209_4334890_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.8e-09	27.2
WP_032955214.1\|4334927_4335551_+	arylesterase	NA	NA	NA	NA
WP_029580768.1\|4335532_4337488_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_032962805.1\|4337751_4338501_+	glycerophosphodiester phosphodiesterase	A0A1J0F961	Only_Syngen_Nebraska_virus	1.2e-16	29.5
WP_029580766.1\|4338511_4339384_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_029580765.1\|4339394_4340807_-	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_029580764.1\|4340916_4341645_-	glutathione peroxidase	A0A1D8KSL1	Synechococcus_phage	1.9e-43	56.6
WP_029580763.1\|4341776_4341977_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_142098351.1\|4342128_4344402_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	6.8e-87	33.0
WP_029580761.1\|4344398_4344794_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_142098354.1\|4344790_4346185_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.7e-27	25.3
WP_032955234.1\|4346286_4347039_-	hypothetical protein	NA	NA	NA	NA
WP_142098358.1\|4347326_4347902_-	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_032955210.1\|4348019_4348799_-	3'-5' exonuclease	NA	NA	NA	NA
WP_029580756.1\|4348795_4349647_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	2.4e-13	45.0
WP_095075253.1\|4349664_4350303_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.3e-31	47.4
WP_029580754.1\|4350446_4351205_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.6e-69	52.5

DBSCAN-SWA_329

4356017 : 4369145

Moraxella_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098361.1\|4356017_4357055_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.2e-96	54.3
WP_029580746.1\|4357140_4358433_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.4e-67	36.5
WP_029580745.1\|4358615_4359632_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_029580744.1\|4359740_4360124_+	thiol reductase thioredoxin	V9SJ74	Achromobacter_phage	1.6e-09	26.8
WP_032955207.1\|4360127_4360733_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.0e-18	36.9
WP_032955206.1\|4360756_4361554_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095075204.1\|4361558_4362347_-	ABC transporter permease	NA	NA	NA	NA
WP_029580739.1\|4362322_4363321_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029580738.1\|4363370_4364135_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-31	35.0
WP_032955203.1\|4364259_4365129_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_048940076.1\|4365245_4365902_+	flavodoxin family protein	NA	NA	NA	NA
WP_095075254.1\|4365871_4367533_-	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	8.9e-52	28.5
WP_029580734.1\|4367700_4368672_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_032959135.1\|4368668_4369145_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	5.0e-08	31.5

DBSCAN-SWA_330

4387751 : 4388546

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580716.1\|4387751_4388546_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	9.8e-25	30.8

DBSCAN-SWA_331

4393643 : 4394582

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955688.1\|4393643_4394582_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-19	29.9

DBSCAN-SWA_332

4397710 : 4398478

Turkeypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955690.1\|4397710_4398478_+	NRDE family protein	A0A0M3ZEJ9	Turkeypox_virus	1.4e-23	31.2

DBSCAN-SWA_333

4402806 : 4403814

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955693.1\|4402806_4403814_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	1.3e-10	28.2

DBSCAN-SWA_334

4417552 : 4422714

Rhodococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955698.1\|4417552_4420714_+	error-prone DNA polymerase	M9MUV5	Rhodococcus_phage	6.8e-53	28.5
WP_032955699.1\|4420743_4421265_-	DNA-deoxyinosine glycosylase	NA	NA	NA	NA
WP_048940066.1\|4421254_4422079_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_029580682.1\|4422075_4422714_-	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	3.7e-06	26.0

DBSCAN-SWA_335

4428287 : 4439346

Streptococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580676.1\|4428287_4429751_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.7e-14	26.2
WP_029580675.1\|4429747_4430044_-	hypothetical protein	NA	NA	NA	NA
WP_029580674.1\|4430172_4431531_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-45	27.6
WP_080666605.1\|4431538_4432198_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	2.4e-37	52.0
WP_029580672.1\|4432041_4432845_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_126623573.1\|4432917_4433562_+	LysE family translocator	NA	NA	NA	NA
WP_142098402.1\|4433580_4434204_+	LysE family transporter	NA	NA	NA	NA
WP_029580669.1\|4434266_4435388_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B6VT43	Edwardsiella_phage	7.2e-82	47.6
WP_029580668.1\|4435458_4435803_+	lipoprotein	NA	NA	NA	NA
WP_142098405.1\|4435807_4436641_-	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	5.1e-16	28.2
WP_029580666.1\|4436660_4437272_-	peptidase S16	NA	NA	NA	NA
WP_029580665.1\|4437454_4437871_+	VOC family protein	NA	NA	NA	NA
WP_032962787.1\|4437909_4439346_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	1.4e-53	38.0

DBSCAN-SWA_336

4459428 : 4460235

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098441.1\|4459428_4460235_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.4e-31	35.3

DBSCAN-SWA_337

4518860 : 4519472

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580616.1\|4518860_4519472_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	5.7e-81	72.3

DBSCAN-SWA_338

4532795 : 4535272

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580605.1\|4532795_4533512_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.8e-09	24.1
WP_142098489.1\|4533511_4535272_-	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	1.4e-10	29.0

DBSCAN-SWA_339

4540179 : 4542190

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098498.1\|4540179_4541640_+	helix-turn-helix domain-containing protein	A0A291LAM3	Bordetella_phage	5.5e-05	33.3
WP_142098502.1\|4541650_4542190_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.6e-31	48.5

DBSCAN-SWA_340

4566274 : 4571990

Salmonella_phage(25.0%)

integrase

attL 4563981:4563995|attR 4580006:4580020

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4563981:4563995	attL	NA	NA	NA	NA
WP_142099048.1\|4566274_4566799_-	DNA-binding protein	J9Q7G7	Salmonella_phage	1.3e-09	34.6
WP_142098574.1\|4567284_4568541_-\|integrase	tyrosine-type recombinase/integrase	A0A1X9TCT6	Enterobacter_phage	1.5e-115	52.8
WP_029580584.1\|4568842_4570435_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.3e-15	33.0
WP_029580583.1\|4570529_4571990_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.6e-95	40.8
4580006:4580020	attR	NA	NA	NA	NA

DBSCAN-SWA_341

4578827 : 4579826

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098583.1\|4578827_4579826_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.2e-12	23.3

DBSCAN-SWA_342

4588466 : 4592516

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098589.1\|4588466_4592516_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	8.8e-162	68.9

DBSCAN-SWA_343

4603498 : 4614438

Catovirus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580552.1\|4603498_4604188_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	3.1e-35	40.3
WP_032957487.1\|4604180_4605461_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_029580550.1\|4605558_4606497_+	hypothetical protein	NA	NA	NA	NA
WP_029580549.1\|4606478_4608185_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	5.0e-50	28.9
WP_126623568.1\|4608262_4609366_+	peptide chain release factor 2	W8EDB3	Pseudomonas_phage	7.5e-07	38.0
WP_029580548.1\|4609416_4610166_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_029580547.1\|4610172_4611687_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	5.2e-83	36.8
WP_142098597.1\|4611699_4611987_+	hypothetical protein	NA	NA	NA	NA
WP_029580545.1\|4611991_4612609_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_032964423.1\|4612605_4614438_-	AMP-binding protein	A0A1V0SBX8	Catovirus	2.1e-54	25.4

DBSCAN-SWA_344

4618389 : 4619202

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957478.1\|4618389_4619202_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-11	30.2

DBSCAN-SWA_345

4622294 : 4625436

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580534.1\|4622294_4624157_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.6e-100	41.2
WP_032978840.1\|4624196_4624703_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_029580532.1\|4624706_4625030_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	2.3e-25	54.2
WP_029580531.1\|4625031_4625436_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	4.8e-52	79.0

DBSCAN-SWA_346

4631661 : 4640546

Lake_Baikal_phage(28.57%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580525.1\|4631661_4632315_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	1.9e-10	50.7
WP_029580524.1\|4632441_4634871_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.0e-222	52.4
WP_032955669.1\|4635036_4636335_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.4e-129	54.3
WP_029580522.1\|4636439_4637093_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.5e-55	56.4
WP_029580521.1\|4637095_4638406_-	trigger factor	NA	NA	NA	NA
WP_029580520.1\|4638611_4639151_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.1e-22	33.7
WP_029580519.1\|4639204_4639411_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-17	62.1
WP_032955668.1\|4639668_4640220_-	DUF924 family protein	NA	NA	NA	NA
WP_005014599.1\|4640342_4640546_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.6e-18	66.7

DBSCAN-SWA_347

4650508 : 4654897

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098607.1\|4650508_4652434_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	5.6e-66	32.3
WP_142098611.1\|4652623_4654897_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	1.0e-106	36.6

DBSCAN-SWA_348

4658295 : 4664612

Synechococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955663.1\|4658295_4658964_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-25	35.7
WP_029580500.1\|4659012_4659978_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_029580499.1\|4659967_4662829_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	4.3e-70	25.3
WP_142098617.1\|4662831_4663347_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_029580497.1\|4663409_4664612_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	6.9e-38	30.6

DBSCAN-SWA_349

4669272 : 4671671

Xanthomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580490.1\|4669272_4669722_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	2.2e-45	61.5
WP_142098623.1\|4669737_4670847_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_029580488.1\|4670900_4671671_-	amino acid ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.3e-10	30.2

DBSCAN-SWA_350

4678230 : 4684424

Hokovirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580480.1\|4678230_4679925_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	6.3e-05	23.6
WP_029580479.1\|4680034_4680304_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_029580478.1\|4680365_4680764_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_029580477.1\|4680777_4681734_-	glutathione synthase	NA	NA	NA	NA
WP_080666590.1\|4681902_4682451_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.5e-13	29.9
WP_029580475.1\|4682471_4684424_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.7e-126	36.2

DBSCAN-SWA_351

4690595 : 4739837

Pseudomonas_phage(38.24%)

integrase,head,terminase

attL 4684225:4684242|attR 4742977:4742994

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4684225:4684242	attL	NA	NA	NA	NA
WP_029580468.1\|4690595_4692251_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	5.7e-35	48.9
WP_142098634.1\|4692389_4692914_+	RcnB family protein	NA	NA	NA	NA
WP_142098637.1\|4693100_4693775_-	hypothetical protein	NA	NA	NA	NA
WP_142098640.1\|4693951_4694293_+	hypothetical protein	NA	NA	NA	NA
WP_142098644.1\|4694366_4695059_+	SOS response-associated peptidase	A4JX27	Burkholderia_virus	1.2e-13	33.9
WP_142098647.1\|4695508_4696579_+	DUF4325 domain-containing protein	NA	NA	NA	NA
WP_142098650.1\|4696709_4696976_-	hypothetical protein	NA	NA	NA	NA
WP_142098653.1\|4696978_4697470_-	hypothetical protein	I6NSS1	Burkholderia_phage	4.0e-45	60.5
WP_029580461.1\|4697475_4697916_-	hypothetical protein	A0A0U5LBV3	unidentified_phage	9.6e-14	34.8
WP_142098656.1\|4698013_4698490_-	hypothetical protein	NA	NA	NA	NA
WP_142098659.1\|4698492_4700514_-	hypothetical protein	G9BWE7	Planktothrix_phage	7.1e-11	47.0
WP_032962428.1\|4700513_4701179_-	DUF2612 domain-containing protein	A0A0N9SSD8	Pseudomonas_phage	6.5e-30	34.6
WP_142098661.1\|4701178_4702630_-	hypothetical protein	A0A0N9SH53	Pseudomonas_phage	9.1e-77	36.2
WP_142098664.1\|4702654_4703023_-	hypothetical protein	E5AGC2	Erwinia_phage	2.3e-13	40.9
WP_142098667.1\|4703022_4703721_-	hypothetical protein	A0A2H4J8H6	uncultured_Caudovirales_phage	1.8e-14	33.2
WP_142098671.1\|4703717_4704638_-	hypothetical protein	E5AGC0	Erwinia_phage	6.6e-41	33.6
WP_142098676.1\|4704624_4704957_-	hypothetical protein	NA	NA	NA	NA
WP_142098679.1\|4704953_4705523_-	hypothetical protein	I3PGV3	Xanthomonas_phage	1.1e-06	26.6
WP_142098683.1\|4705536_4707978_-	tape measure protein	A0A2D0W9N5	Bordetella_phage	1.6e-20	25.3
WP_142098686.1\|4708126_4708612_-	hypothetical protein	NA	NA	NA	NA
WP_142098688.1\|4708611_4709040_-	DUF3277 family protein	A0A2K9V3K6	Faecalibacterium_phage	3.2e-22	40.9
WP_142098691.1\|4709052_4710411_-	DUF3383 family protein	A0A0N9SJA3	Pseudomonas_phage	3.9e-82	41.0
WP_142098694.1\|4710474_4710999_-	hypothetical protein	NA	NA	NA	NA
WP_142098697.1\|4711172_4711541_-	hypothetical protein	NA	NA	NA	NA
WP_142098700.1\|4711544_4711997_-	hypothetical protein	A0A2I7R2V2	Vibrio_phage	9.9e-06	30.8
WP_142098703.1\|4711986_4712361_-	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_142098706.1\|4712363_4712744_-	hypothetical protein	NA	NA	NA	NA
WP_142098711.1\|4712743_4713703_-	DUF2184 domain-containing protein	A0A0N9SG07	Pseudomonas_phage	4.3e-59	39.2
WP_142098714.1\|4713764_4714220_-	hypothetical protein	NA	NA	NA	NA
WP_142098718.1\|4714219_4715302_-	DUF2213 domain-containing protein	E5AGA6	Erwinia_phage	1.2e-54	40.4
WP_142098721.1\|4715311_4716151_-\|head	phage head morphogenesis protein	I3PGT9	Xanthomonas_phage	1.7e-35	38.2
WP_142099051.1\|4716092_4717373_-	DUF1073 domain-containing protein	A0A2H4N7B7	Pectobacterium_phage	8.4e-18	25.1
WP_142099054.1\|4717372_4718875_-\|terminase	phage terminase large subunit	B5AX37	Iodobacteriophage	6.9e-112	45.7
WP_142098724.1\|4718906_4719383_-	DUF2280 domain-containing protein	A0A125RNL6	Pseudomonas_phage	1.8e-34	57.7
WP_142098727.1\|4719469_4720093_+	DUF2207 domain-containing protein	NA	NA	NA	NA
WP_142098730.1\|4720125_4720734_-	hypothetical protein	A0A1B0VRJ1	Pseudomonas_phage	1.5e-65	64.3
WP_142098734.1\|4720856_4721507_-	hypothetical protein	NA	NA	NA	NA
WP_142098738.1\|4721659_4722286_-	hypothetical protein	NA	NA	NA	NA
WP_142098742.1\|4722278_4722773_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	1.4e-29	52.1
WP_142098745.1\|4722769_4722994_-	hypothetical protein	NA	NA	NA	NA
WP_142098748.1\|4722990_4724139_-	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	7.8e-39	58.2
WP_142098757.1\|4724211_4724397_+	hypothetical protein	NA	NA	NA	NA
WP_142098758.1\|4724406_4725015_-	hypothetical protein	A0A218M303	Acidovorax_phage	6.1e-35	39.2
WP_029580426.1\|4725095_4725347_+	hypothetical protein	NA	NA	NA	NA
WP_142099057.1\|4725376_4725850_-	DNA cytosine methyltransferase	A0A2D1GMT9	Marinobacter_phage	4.5e-17	51.2
WP_029580424.1\|4725849_4726449_-	hypothetical protein	A0A0S2SYA8	Pseudomonas_phage	5.1e-42	50.0
WP_142098760.1\|4726507_4726702_+	hypothetical protein	NA	NA	NA	NA
WP_142098763.1\|4726894_4727287_-	hypothetical protein	NA	NA	NA	NA
WP_142098765.1\|4727350_4727596_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_142098768.1\|4727681_4728398_+	LexA family transcriptional regulator	Q8W6P8	Burkholderia_virus	4.4e-24	56.4
WP_142098770.1\|4728701_4729196_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_142098773.1\|4729198_4729525_+	hypothetical protein	NA	NA	NA	NA
WP_142098776.1\|4730066_4730390_+	hypothetical protein	NA	NA	NA	NA
WP_142099060.1\|4730389_4731190_+	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	2.2e-56	48.5
WP_142098779.1\|4731192_4731420_+	hypothetical protein	J7I4L3	Pseudomonas_phage	6.0e-12	52.4
WP_142098780.1\|4731421_4732666_+	hypothetical protein	J7HXB6	Pseudomonas_phage	1.6e-66	56.7
WP_142098781.1\|4732678_4733839_+	recombination-associated protein RdgC	A0A218M310	Acidovorax_phage	1.9e-53	38.1
WP_142098782.1\|4733848_4735630_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	3.8e-77	37.0
WP_142098783.1\|4735998_4736784_+	hypothetical protein	NA	NA	NA	NA
WP_142098784.1\|4737181_4737427_+	hypothetical protein	NA	NA	NA	NA
WP_142098785.1\|4737423_4737966_+	hypothetical protein	NA	NA	NA	NA
WP_142098786.1\|4737958_4738330_+	hypothetical protein	NA	NA	NA	NA
WP_142098787.1\|4738329_4738587_+	transcriptional regulator	NA	NA	NA	NA
WP_142098788.1\|4738595_4739837_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	4.0e-65	38.9
4742977:4742994	attR	NA	NA	NA	NA

DBSCAN-SWA_352

4752783 : 4753842

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580392.1\|4752783_4753842_-	chorismate synthase	A0A291AU41	Pandoravirus	8.3e-80	43.4

DBSCAN-SWA_353

4759102 : 4760575

Microcystis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580388.1\|4759102_4760575_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	6.4e-46	30.5

DBSCAN-SWA_354

4775272 : 4777612

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580371.1\|4775272_4777612_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.4e-151	41.0

DBSCAN-SWA_355

4781935 : 4782628

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580365.1\|4781935_4782628_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.9e-12	25.4

DBSCAN-SWA_356

4785971 : 4788106

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958067.1\|4785971_4786727_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-18	30.9
WP_029580359.1\|4786740_4787568_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_029580358.1\|4787572_4788106_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.8e-51	55.5

DBSCAN-SWA_357

4792769 : 4795511

Pseudomonas_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580352.1\|4792769_4793492_-	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	1.7e-44	48.2
WP_029580351.1\|4793635_4794334_-	TerC family protein	W8EBD0	Pseudomonas_phage	1.3e-17	29.6
WP_029580350.1\|4794629_4795511_-	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	2.3e-19	31.6

DBSCAN-SWA_358

4801417 : 4809844

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956477.1\|4801417_4802479_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.6e-113	64.3
WP_029580343.1\|4802807_4803503_+	response regulator transcription factor	NA	NA	NA	NA
WP_029580342.1\|4803618_4804998_+	sensor histidine kinase	W8CYF6	Bacillus_phage	2.0e-20	26.8
WP_029580341.1\|4805181_4806858_+	MHS family MFS transporter	NA	NA	NA	NA
WP_029580340.1\|4807214_4807433_-	hypothetical protein	NA	NA	NA	NA
WP_029580339.1\|4807584_4808484_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	1.4e-43	32.6
WP_029580338.1\|4808551_4809844_-	aspartate carbamoyltransferase	Q84489	Paramecium_bursaria_Chlorella_virus	1.1e-41	36.6

DBSCAN-SWA_359

4814418 : 4815333

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700357.1\|4814418_4815333_-	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.2e-63	47.7

DBSCAN-SWA_360

4864983 : 4866642

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979387.1\|4864983_4866642_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	3.9e-07	23.3

DBSCAN-SWA_361

4872052 : 4873096

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098817.1\|4872052_4873096_-	histone deacetylase family protein	A0A2K9L0J7	Tupanvirus	3.2e-31	29.8

DBSCAN-SWA_362

4884895 : 4886227

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577378.1\|4884895_4886227_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.1e-20	23.9

DBSCAN-SWA_363

4890430 : 4895382

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098826.1\|4890430_4891225_-	SDR family oxidoreductase	A0A0G2Y601	Acanthamoeba_polyphaga_mimivirus	2.6e-09	32.7
WP_029577383.1\|4891317_4892238_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_142098827.1\|4892293_4892743_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_032979395.1\|4892825_4893968_-	cell division protein FtsQ	NA	NA	NA	NA
WP_029577386.1\|4893972_4895382_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	2.9e-64	36.7

DBSCAN-SWA_364

4908893 : 4912892

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142098828.1\|4908893_4909673_-	cellulose synthase operon protein YhjQ	A0A142F1W4	Mycobacterium_phage	3.7e-08	30.7
WP_142098829.1\|4909669_4910338_-	hypothetical protein	NA	NA	NA	NA
WP_048940486.1\|4910388_4910784_-	cellulose synthase	NA	NA	NA	NA
WP_032956191.1\|4911473_4912892_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.4e-45	27.9

DBSCAN-SWA_365

4922203 : 4923268

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577406.1\|4922203_4923268_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	2.4e-18	26.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021399

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection