CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021400	Bordetella hinzii strain 243-2 chromosome, complete genome	3 crisprs	csa3,WYL,DEDDh,DinG	1	2	362	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021400_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021400_1

2741096-2741197

Orphan

Consensus_repeat	Method
CGCCGCCCGCGCCGCCGCCCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021400_1

>merge|NZ_CP021400|1|2741096-2741197|CRISPRCasFinder
GGCCGCCCGCCGAACCGCCCACCAGCAGGGTGTCCCCCACACTGAGAGAGGTGCCGTCAAGCAGGGTCAGCGTTCCATCGCCGCCCGCGCCGCCATTACCGA

>NZ_CP021400|1|1|2741096-2741197|CRISPRCasFinder
GGCCGCCCGCCGAACCGCCCACC	AGCAGGGTGTCCCCCACACTGAGAGAGGTGCCGTCAAGCAGGGTCAGCGTTCCAT
CGCCGCCCGCGCCGCCATTACCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021400.1\|WP_032962947.1\|2729767_2730271_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP021400.1\|WP_029581373.1\|2748385_2748682_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP021400.1\|WP_029581378.1\|2742833_2743700_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NZ_CP021400.1\|WP_029581381.1\|2734161_2734488_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021400.1\|WP_029581384.1\|2730390_2731776_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|129864
NZ_CP021400.1\|WP_029581379.1\|2742114_2742714_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP021400.1\|WP_029581375.1\|2746292_2747210_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP021400.1\|WP_029581370.1\|2751256_2752198_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP021400.1\|WP_032955771.1\|2726301_2728533_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021400.1\|WP_032955770.1\|2747301_2748405_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021400.1\|WP_080700973.1\|2743801_2744491_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP021400.1\|WP_029581390.1\|2723325_2723949_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP021400.1\|WP_032955752.1\|2744761_2746306_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173873
NZ_CP021400.1\|WP_095075242.1\|2733430_2733982_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372042
NZ_CP021400.1\|WP_080700974.1\|2748678_2750139_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_CP021400.1\|WP_032962946.1\|2728748_2729771_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP021400.1\|WP_051594403.1\|2725277_2726177_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP021400.1\|WP_032979440.1\|2750135_2751260_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021400.1\|WP_029581383.1\|2731775_2733431_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP021400.1\|WP_029581389.1\|2724022_2725252_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929

Protein	Function_ID	Function_description	E-value
NZ_CP021400.1\|WP_032962947.1\|2729767_2730271_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	2.45557e-68
NZ_CP021400.1\|WP_029581373.1\|2748385_2748682_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.17053e-29
NZ_CP021400.1\|WP_029581378.1\|2742833_2743700_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NZ_CP021400.1\|WP_032955752.1\|2744761_2746306_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173873	cd08508, PBP2_NikA_DppA_OppA_like_1, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021400.1\|WP_029581384.1\|2730390_2731776_-\|c-type-cytochrome	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	3.60233e-09
NZ_CP021400.1\|WP_029581379.1\|2742114_2742714_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.89569e-110
NZ_CP021400.1\|WP_029581370.1\|2751256_2752198_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40169e-121
NZ_CP021400.1\|WP_032955771.1\|2726301_2728533_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.88414e-97
NZ_CP021400.1\|WP_032955770.1\|2747301_2748405_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.13517e-39
NZ_CP021400.1\|WP_080700973.1\|2743801_2744491_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	1.98941e-45
NZ_CP021400.1\|WP_029581390.1\|2723325_2723949_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	8.46212e-56
NZ_CP021400.1\|WP_029581375.1\|2746292_2747210_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80672e-62
NZ_CP021400.1\|WP_095075242.1\|2733430_2733982_-\|hypothetical-protein	gnl\|CDD\|372042	pfam12318, FAD-SLDH, Membrane bound FAD containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria. Proteins in this family are typically between 168 and 189 amino acids in length. There is a conserved ALM sequence motif. This family is a membrane protein (FAD-SLDH) involved in oxidation of D-sorbitol to L-sorbose.	2.27058e-35
NZ_CP021400.1\|WP_080700974.1\|2748678_2750139_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	4.56202e-28
NZ_CP021400.1\|WP_032962946.1\|2728748_2729771_-\|DUF4880-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	5.79708e-67
NZ_CP021400.1\|WP_051594403.1\|2725277_2726177_-\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	6.64608e-77
NZ_CP021400.1\|WP_032979440.1\|2750135_2751260_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.16008e-58
NZ_CP021400.1\|WP_029581383.1\|2731775_2733431_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.89685e-61
NZ_CP021400.1\|WP_029581389.1\|2724022_2725252_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.33194e-159

>NZ_CP021400.1|WP_029581381.1|2734161_2734488_+|hypothetical-protein
MELETAYWDGELVISVEPREVRMSHWIHAPRAWRALDGQLLFDLAGSDWDLCGVGGEDEDCLVLALRRYPGGAPARLLTIARGSLEMHLDGESLPAGELLPRLEARRP
>NZ_CP021400.1|WP_095075242.1|2733430_2733982_-|hypothetical-protein
MPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTDRQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIVAAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPPLLPTSKAL
>NZ_CP021400.1|WP_029581383.1|2731775_2733431_-|GMC-family-oxidoreductase
MTRQAEFQSNGDARADIIVVGSGVVGAMIADQLAARGHSVLILEAGLRIERGQAVENWRNMPFANRAGSDFQGLYPQSPDAPAPLYFPENNYVHLTGPSASSFKQGYLRTVGGTTWHWAASCWRHLPVDLRMKSAYGVGRDWPISYDELEPFYLQAENEMGVAGPNDPARQSPAERSGPYPMDMVPWAYGDQRFADVVNPHGYRSVPIPQGRSTQPWRGRPTCCGNNNCQPICPIGAMYNGIHHVQAAEEKGAIVLAQSVVYKIDTDENNRITAVHWYDAARRSHKATGQHFVLACNAMETPRLLLMAANARNPKGIANRSDQVGRNIMDHSGFHCYFQASEPLWPGRGPAQSSCLVGPRDGAFRAEYSANKMILNNITQVTLATKTALAQGLTGKALDAEIRRRAAHGVDLSISLEPLPDPNNRLTLSKTRRDPLGLPCPDVHYDVGDYVRKGAEAAHAQLRHIGSLFKATDFLITTQLNANNHMMGSVIMGSDPRDSVVDGDCRAHDHDNLWLPGGGAMPSASVVNSTLTMAALGLKTAAAIARRMEAA
>NZ_CP021400.1|WP_029581384.1|2730390_2731776_-|c-type-cytochrome
MKTLLCGLALALLPLGAHAADEARLIERGRMLSIAADCMACHTQAPSGKPYAGGYPIQSPLGTIYASNITPSTRAGIGGYSLEDFARAVRQGVRPDGSRLYPAMPYTSYTLITDEDIQALYTYFMKGVQPVDEPSPATDLPFPFGIRASMRVWNALFLEDKRFTPDPDQSAEVNRGAYLARALAHCSSCHTPRNALMAEDPKRPLGGGMVGPWHAPNISSDPQAGIGGWTNEEIVQYLRTGRVAGKGQAGGSMAEAVEHSFQHMPQADLAAIAAYLKSTPPVPADAAAPAAYARGAAISPEAGLRGADPQTANLSLKSGAALFSGYCASCHQAGGQGSAGQAYPSLFHNTATGAGSASNLIAAILYGVDRNVGGQHVLMPRFDAKSYVQPLSDAQIALIANYVLANYGNARLSVTPDDVRQARQGGPAPLLARAQPYMLPAAVTALLIVLLGLLLLRRRRA
>NZ_CP021400.1|WP_032962947.1|2729767_2730271_-|sigma-70-family-RNA-polymerase-sigma-factor
MHPATLETLYTDHHSWLRGWLHRRLGNTEQAADLAHDTFIRLLCSERVPAALDEPRAFLTTVAQRLVSNHWRREKLERAYLEALAQAPQALARSPEERAILLETLFELDRLLDDLPAVVRRAFLLSQLDGQTHAQVAQALGVSIPTVKRHIVRALARCCFADLSFHP
>NZ_CP021400.1|WP_032962946.1|2728748_2729771_-|DUF4880-domain-containing-protein
MKAGSTWYHATQEAAGIAPEVAERALQWLLDLREDATPQTRRAWAQWHDAHPDHARAWSRIESVMGQLRALSAPDSATAARSALLPRRRAGLKALAALAMAGGSAWALRDTVAWREWAADQRTAIGQRRALTLPDGTHIVLNTHSAIDLRYGPAERRLYLVAGEVLIVTAPDRQAPPRPFLVQTRQGVARALGTEYSVRQHGNETCVSVLRGSVRIEPREHPGRGLLLAAGRHARYTAEGIAGDGPADERDLAWKDGFIMARGMRLADFLAELGRYTEASLSCDPAVAGLQVSGAFPTGDAEQVMAALAATLQLRLETQAPLWRARRLRLLSVTKFPVQG
>NZ_CP021400.1|WP_032955771.1|2726301_2728533_-|TonB-dependent-receptor
MLGRFGREAGVLLSFRPDVTQGLASPGLRGSYTVQAGLQQLLAGTGIQARPQAAGGYVLERSGGVAQLQPITVAASAAVDALPAPYAGGQIARGGGLGMLGTADVMDVPFNTTNYTAQALENQQARTLADIVINEASVRTLTSSGGFGEDFQIRGYTVSSGDVGLNGLYGLASSSRMPAAIMERVEVLKGPGTLMNGIGPNGSIGGGINVVTKRAGDDPLTRVTATYQDKSQLGGMVDMGRRFGQDNEWGIRVNGVYHNGDTTIDHGSQRQGVGALALDYRGPRLRGSLDAYTQQERTDNFRPQVGFQSSVTDLPSPPSGHRNFYPGTQLELKDSTVASRLEYDLNDSLTVYAAGGYRYGTANQTFPSGPVDQDGGFTVRNAFYDSYSRSSTGEIGLRARFDTWGVKHNLSLGATRLDQELGNFYITSTGTAASNIYHPAPLPEVTGHRGSPSKASETALTSFTLADTLSFADDRLMITGGLRQQRVALDNYSTATGDRTSSYDESAISPLAGVVFKPWSNVSLYGNFTSGLTRGGVAPATAANAGQVFAPYKSKQYEAGVKVDWGSVITSASVFQITRPNSMTDPDTNVYSFDGEQRNRGFELAATGEVTPGLRVMASATFYDAKITRSAGGVNDGNDANGVPDSAFNLGVDWDMPWVRGLSLNARVIHTSSAWFNAANTIRLPSWTRYDVGARYSTRVMGRAVVFRANIENLFNQTYWLASGTYATVAAPRAFLLSAQIDF
>NZ_CP021400.1|WP_051594403.1|2725277_2726177_-|amidohydrolase-family-protein
MTTSPPPGEVPFCLPPLPLPQQAPPAFEAPPLACDTHAHVVAADRRAYPMVAERSYTPHPATEEAYLAMLAANGMERGVLVQISVYGTDNRYMLEVLRRHPERLRGIGVVAPDIGDAQLRDMHEAGVRGLRINVLFGGGIGFDAMETLAHRIKDMGWHMQFLMDARQLPELLPRMRKLPVSGVVDHMGHMPVAEGLQSPGFQALAHLVQDHGWWVKLSGAYRISAQYDGYADVLPWAQALIAMAPDRMVWGSDWPHVHISPMVNTGKLRNQLAEWAPDPWTRQAILVDNPQRLYGFPSR
>NZ_CP021400.1|WP_029581389.1|2724022_2725252_-|MFS-transporter
MQWYRELNQTERRTFVAAFGGWAIDALDFMVFTFVISTLISLWGIEKGQAGMLGTVTLLFSAIGGWLAGILADRYGRVRVLQVTILWFSACTVAIGFAQNFEQLFVLRALQGLGFGGEWAVGSVLMGEIVRAEHRGKAVGTVQSGWAIGWGVAAILYTIAFSVLPPEWAWRTLFWIGVIPALLVLYIRKHVPEPEVFQRARSQLEASAARPSFWMIFSPALLKTTVITALLCTGVQGGYYAITTWLPTFLKTERHLSVMGTGGYLMVIIVGSFCGYIAGAYLADRLGRRANLLIFSVLSGLSVYVYTLVPLTDAQMLVLGFPLGFAASGIFSGVGAYLTELFPTEVRANGQGFAYNFGRGIGALFPSLVGFLSQTQGLAWAIGAFATGAYAIVIVTALLLPETRGRVLK
>NZ_CP021400.1|WP_029581390.1|2723325_2723949_-|response-regulator-transcription-factor
MTTVLLVDDHTMFREGLALALQHTAPALQLLPAATGAQALALLDDLRGIDLVVMDYYLPDMAGTELLRRLRQRRPQLRILVLSASEDPEDRRRALEAGAQDYLHKSASSRTLASALAALGQARPDMPAAAGAAPDAAALLRALTPRQLDVLRLICDGLRNKAISEQLNMSEKTVKSHVSAILGTLGVLNRTQAALVARRGGLFGKPA
>NZ_CP021400.1|WP_029581379.1|2742114_2742714_+|nitroreductase-family-protein
MSNAYIEALKQRRTQYALGRNVSLSKDALVALIQDAVKHSPSSFNSQTSRALVLFGAESEKLWALAIDEVRKVAPAEGFDKTEAKLKSFAAGVGTVLFFEDQDVVRGLQEKFALYADNFPVWSEQASGMAQLSVWSALANAGVGASLQHYNPLIDAAVAREWKVPASWKLRAQMPFGSNEAPKSEKAFMDDADRFIVAG
>NZ_CP021400.1|WP_029581378.1|2742833_2743700_-|glutathione-dependent-disulfide-bond-oxidoreductase
MTTEYFPPKVWTWNKNSASTASNASSLNRPIAGATHEKTLPVGRHPLQLYSLGTPNGQKVTILLEELLARGHAQAEYDAWLIRIGEGDQFGSGFVDINPNSKIPALVDRSGDTPIRVFESGAILLYLAEKFGDFLPADPAARAECLSWLFWQMGSAPYVGGGFGHFYAYAPVKIEYAIDRFTMETKRQLDVLDRRLAEHEYLAGDQYTIADIAVFPWYGGLIKGWLYDAAEFLAVHEYRHVQRWADTLLARPAVDRGRIVNRLRGPLSEQLHERHDASDFDTKTADKT
>NZ_CP021400.1|WP_080700973.1|2743801_2744491_-|alpha/beta-hydrolase
MAAAFIHGAPGSMLAAAAGKTETHFFAGPAGAMEVLADAPAQAPRGIALVTHPQPLLGGSPRHKIPHRLAHGLRDDGWLALRPAFRGVAGSAGHYDHGDGESEDILALARALRAQAPALPLALVGFSFGAYVQARVARALLDAGTPADRVVLAGLPVGEVPAERVYDTPPLPEEVVLIHGENDAQAPLAPLLEWARPNGHPVTVVPGADHFFSRSLPLLLKLVRQHLAA
>NZ_CP021400.1|WP_032955752.1|2744761_2746306_+|polyamine-ABC-transporter-substrate-binding-protein
MRCGLALALTACGLGSSAWAEERPMLRLSSGAADNATLDPHRATSTADKGVAAEMFNALVRFPPGSADPKALEPDLAERWEASPDSKTWTFHLRRGVQFHGGYGELKAEDVVYSIQRAADPNRSSFAATFGLIDKVEAVDDHTVRFTLKYPDAAFLGRVSNYHGGNIVSKKAAEKLGDKFGGSPVGTGPFAFGQHVTQQYVKLVANDSYFRGKPKLAGIMYRMIPSDSARELAFTSNEIDVMQGKREQRWVERSAKRGMQVDIFEPAEFRTLHINRNIKPLDNLKVREAIAAAINVDEIVRYAGKDVADKGCSVVPNGYLGQDCGAGAYAYDAGRAKQLLAEAGFPDGIQIKSVVSNISAQQPIMEIVQAQLAKAGIKLDMEVVDHATYQAKSRQDLSALVFYGAARFPNADTYLTEFYDSAAAIGAPGAMSNFSHCSVADEAIRQARIEPDAQKQLALWKDAQARIRADVCAVPLFGLKQVWVHSERVNYGYKLDGALNLQPPITEQTTVTAP
>NZ_CP021400.1|WP_029581375.1|2746292_2747210_-|LysR-family-transcriptional-regulator
MKNILNLRQIEAFKAVIEHGTVSQAATALGVSQPAVSKLLTHLEADSGLALFERVRGKLAPTAQGMRLYREVDRVFNGLRQLEQAVESIRRAEQRTLNVGVLPALAGAFIRRVSMQFLRRHPDVRISIQSRGSLFLADWLATRHIDVALVGSRVDNPYIEREPLFRQPLVCALPPNHVLTRKRVIRPRDLAGLPFISFGPESQTHQLVQQAFDAAGLPVNVALDTNTAPTACEFVAAGLGVSLIHPLFAEGMQSRLVLRRFDPELHFHFQLCRAQASRNAALVEDFVQEVRDVAAQVSREVLKGQ
>NZ_CP021400.1|WP_032955770.1|2747301_2748405_+|FAD-binding-oxidoreductase
MAGAGMVGAAIAYGLAGLGQRVLLVDGGDTDYRAAKANFGLVWLQGKGHGNPDYQRLSHRSVLDWPDFARELQAESGIDLQYERRGGLHFCLGEADLQARAARMQAWRRQAPEVGDCVSVLARDELLRRFPGLDLGPEVSGASVGELDGHANPLRLLAALQAVFLRRGGTLWGNAPVRAIRPLDGGGFEIEAGGRRARGARLVIAAGLGSAALGAQVGLAVPLRPQRGQILVTERLAPLLPVPASGIRQTGEGTVMVGLTQEEAGYDLSTTTEAAVHMSRNALRILPALAQARLVRHWSCLRVMTPDGCPVYAQSQPFPGAFVALCHSGVTLAALHAGRYARALASGAPPSFLDVFHHERFNVQKVA
>NZ_CP021400.1|WP_029581373.1|2748385_2748682_+|(2Fe-2S)-binding-protein
MFRKLHESGAASLTLTIDGQPVRAEPGESVAAVLLRQDTPASRSTPVNESPRAPYCMMGVCFECLAIIDGVASTQACMVPVRDGMRVERQHGKRSVQA
>NZ_CP021400.1|WP_080700974.1|2748678_2750139_+|FAD-dependent-oxidoreductase
MKREFDVVVIGAGPAGMSAAIRLREQHMRVLVVDEQPAPGGQIWRAVETVAGTRTGRLLGDEYRAGAALAERFRQCGAVYEPQTQVWQIETGWHVYMTRGGRAQAVRADQVLLAIGAQERPAPFPGWTLPGVLTVGAAQILLKTSNQVPAAPVWVAGSGPLPLLYMAQLLRAGGQIAGWLDTSAPGAWRRALPWAGAALASWGDIRKGLGWLRELKAAGVRRVRGVTGLRALGEGALREIEYTLADGSLRREPASVLLSHEGVVPSIHMTRALECAHHWDARQSCLAPDLDDWGQTSREGVYVAGDAAGIGGALAACARGELAALGMALRAGCMTAQAAGQAAAPLREKLRGLLRIRPMLDEMYPPRAGIFNPPDETIVCRCEELTAGDIRRAARIGQPGPNQVKSYTRAGMGPCQGRQCGYTVAHIVAAEERRPVSEVGFYRIRPPLKPLTLGELASLDVGDDGVVLAGAPESPGEAPAAREPRP
>NZ_CP021400.1|WP_032979440.1|2750135_2751260_+|FAD-binding-oxidoreductase
MSAPVFDVAVIGGGLHGLSAALHIARQGKRVVVIERHWTGRHASGATAAGVRTLNRDRRELDLSMEALDMWHDMASLVGDDCGFHAHGQICVAETEQGLAKLAGRVDSLRAAGYAHEDIIDAAELRRLLPALSPHCVGASIARRDGAADPHRALRAFRASAEAAGVTLVEHCAVTGLRRQGADWRVVTERGDWVVPAVVNAAGAWSARIAAMAGDEIPLATKSSMMMVSERLRPFIKPVVAIVGRSLSFKQSDQGTLVIGGGLQGTPDLDRETSTARMRVLAKGARAATDLFPMVRDIRIVRVWAGLEAKTEDLLPVIGPSPRAPGLFHAFGFSGHGFELVPVVGAVMADLVLRGATARPIGALQAARLMGGQP
>NZ_CP021400.1|WP_029581370.1|2751256_2752198_+|ABC-transporter-permease
MIRYAIKRLLLAIPTLLAMLTAVFILVRLVPGDPAAVMLGDQASAEALAALRLRLGLDLPTHEQYLRFLGDMLTGNFGVSMASGRTVLQEVGQVLPWTLQLTAAAILIGVVFGLPLGIWAALRRNAWPDYLGRLLSLTGLSFPAFVSAILMLLVFAIQLRWFPVIGSSAATDWGTQLRNLALPAFNLGLIMMAYVMRVTRSSMLGVMGEDYVRTARAKGLRPLRLIMRHGLRNALIPIVTVVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFAACVILVNLLTDLVYGLVDPRVKYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021400_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021400_2

2741276-2741416

Orphan

Consensus_repeat	Method
CGCCGCCCGCGCCGCCGCCCGCG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021400_2

>merge|NZ_CP021400|2|2741276-2741416|CRISPRCasFinder
AGCCGGCTGTGCCGCTGCCGCCGTTGGAGGCGCCGCCGCCGCCCCCGCCGCCGCCGACGCCGAGCACGTCGGTGCTCGCATGGCCGCTGGTCAACATGGCCCCGGACGAGGTCCTGGCGCCGCCGCCGCCATAGCCGGCCG

>NZ_CP021400|2|2|2741276-2741416|CRISPRCasFinder
AGCCGGCTGTGCCGCTGCCGCCG	TTGGAGGCGCCGCCGC
CGCCCCCGCCGCCGCCGACGCCG	AGCACGTCGGTGCTCGCATGGCCGCTGGTCAACATGGCCCCGGACGAGGTCCTGG
CGCCGCCGCCGCCATAGCCGGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021400.1\|WP_032962947.1\|2729767_2730271_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP021400.1\|WP_029581373.1\|2748385_2748682_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP021400.1\|WP_029581378.1\|2742833_2743700_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NZ_CP021400.1\|WP_029581381.1\|2734161_2734488_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021400.1\|WP_029581384.1\|2730390_2731776_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|129864
NZ_CP021400.1\|WP_029581379.1\|2742114_2742714_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP021400.1\|WP_029581375.1\|2746292_2747210_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP021400.1\|WP_029581370.1\|2751256_2752198_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP021400.1\|WP_032955771.1\|2726301_2728533_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021400.1\|WP_032955770.1\|2747301_2748405_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021400.1\|WP_080700973.1\|2743801_2744491_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP021400.1\|WP_029581390.1\|2723325_2723949_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP021400.1\|WP_032955752.1\|2744761_2746306_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173873
NZ_CP021400.1\|WP_095075242.1\|2733430_2733982_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372042
NZ_CP021400.1\|WP_080700974.1\|2748678_2750139_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_CP021400.1\|WP_032962946.1\|2728748_2729771_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP021400.1\|WP_051594403.1\|2725277_2726177_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP021400.1\|WP_032979440.1\|2750135_2751260_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021400.1\|WP_029581383.1\|2731775_2733431_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP021400.1\|WP_029581389.1\|2724022_2725252_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929

Protein	Function_ID	Function_description	E-value
NZ_CP021400.1\|WP_032962947.1\|2729767_2730271_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	2.45557e-68
NZ_CP021400.1\|WP_029581373.1\|2748385_2748682_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.17053e-29
NZ_CP021400.1\|WP_029581378.1\|2742833_2743700_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NZ_CP021400.1\|WP_032955752.1\|2744761_2746306_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173873	cd08508, PBP2_NikA_DppA_OppA_like_1, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021400.1\|WP_029581384.1\|2730390_2731776_-\|c-type-cytochrome	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	3.60233e-09
NZ_CP021400.1\|WP_029581379.1\|2742114_2742714_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.89569e-110
NZ_CP021400.1\|WP_029581370.1\|2751256_2752198_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40169e-121
NZ_CP021400.1\|WP_032955771.1\|2726301_2728533_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.88414e-97
NZ_CP021400.1\|WP_032955770.1\|2747301_2748405_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.13517e-39
NZ_CP021400.1\|WP_080700973.1\|2743801_2744491_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	1.98941e-45
NZ_CP021400.1\|WP_029581390.1\|2723325_2723949_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	8.46212e-56
NZ_CP021400.1\|WP_029581375.1\|2746292_2747210_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80672e-62
NZ_CP021400.1\|WP_095075242.1\|2733430_2733982_-\|hypothetical-protein	gnl\|CDD\|372042	pfam12318, FAD-SLDH, Membrane bound FAD containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria. Proteins in this family are typically between 168 and 189 amino acids in length. There is a conserved ALM sequence motif. This family is a membrane protein (FAD-SLDH) involved in oxidation of D-sorbitol to L-sorbose.	2.27058e-35
NZ_CP021400.1\|WP_080700974.1\|2748678_2750139_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	4.56202e-28
NZ_CP021400.1\|WP_032962946.1\|2728748_2729771_-\|DUF4880-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	5.79708e-67
NZ_CP021400.1\|WP_051594403.1\|2725277_2726177_-\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	6.64608e-77
NZ_CP021400.1\|WP_032979440.1\|2750135_2751260_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.16008e-58
NZ_CP021400.1\|WP_029581383.1\|2731775_2733431_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.89685e-61
NZ_CP021400.1\|WP_029581389.1\|2724022_2725252_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.33194e-159

>NZ_CP021400.1|WP_029581381.1|2734161_2734488_+|hypothetical-protein
MELETAYWDGELVISVEPREVRMSHWIHAPRAWRALDGQLLFDLAGSDWDLCGVGGEDEDCLVLALRRYPGGAPARLLTIARGSLEMHLDGESLPAGELLPRLEARRP
>NZ_CP021400.1|WP_095075242.1|2733430_2733982_-|hypothetical-protein
MPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTDRQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIVAAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPPLLPTSKAL
>NZ_CP021400.1|WP_029581383.1|2731775_2733431_-|GMC-family-oxidoreductase
MTRQAEFQSNGDARADIIVVGSGVVGAMIADQLAARGHSVLILEAGLRIERGQAVENWRNMPFANRAGSDFQGLYPQSPDAPAPLYFPENNYVHLTGPSASSFKQGYLRTVGGTTWHWAASCWRHLPVDLRMKSAYGVGRDWPISYDELEPFYLQAENEMGVAGPNDPARQSPAERSGPYPMDMVPWAYGDQRFADVVNPHGYRSVPIPQGRSTQPWRGRPTCCGNNNCQPICPIGAMYNGIHHVQAAEEKGAIVLAQSVVYKIDTDENNRITAVHWYDAARRSHKATGQHFVLACNAMETPRLLLMAANARNPKGIANRSDQVGRNIMDHSGFHCYFQASEPLWPGRGPAQSSCLVGPRDGAFRAEYSANKMILNNITQVTLATKTALAQGLTGKALDAEIRRRAAHGVDLSISLEPLPDPNNRLTLSKTRRDPLGLPCPDVHYDVGDYVRKGAEAAHAQLRHIGSLFKATDFLITTQLNANNHMMGSVIMGSDPRDSVVDGDCRAHDHDNLWLPGGGAMPSASVVNSTLTMAALGLKTAAAIARRMEAA
>NZ_CP021400.1|WP_029581384.1|2730390_2731776_-|c-type-cytochrome
MKTLLCGLALALLPLGAHAADEARLIERGRMLSIAADCMACHTQAPSGKPYAGGYPIQSPLGTIYASNITPSTRAGIGGYSLEDFARAVRQGVRPDGSRLYPAMPYTSYTLITDEDIQALYTYFMKGVQPVDEPSPATDLPFPFGIRASMRVWNALFLEDKRFTPDPDQSAEVNRGAYLARALAHCSSCHTPRNALMAEDPKRPLGGGMVGPWHAPNISSDPQAGIGGWTNEEIVQYLRTGRVAGKGQAGGSMAEAVEHSFQHMPQADLAAIAAYLKSTPPVPADAAAPAAYARGAAISPEAGLRGADPQTANLSLKSGAALFSGYCASCHQAGGQGSAGQAYPSLFHNTATGAGSASNLIAAILYGVDRNVGGQHVLMPRFDAKSYVQPLSDAQIALIANYVLANYGNARLSVTPDDVRQARQGGPAPLLARAQPYMLPAAVTALLIVLLGLLLLRRRRA
>NZ_CP021400.1|WP_032962947.1|2729767_2730271_-|sigma-70-family-RNA-polymerase-sigma-factor
MHPATLETLYTDHHSWLRGWLHRRLGNTEQAADLAHDTFIRLLCSERVPAALDEPRAFLTTVAQRLVSNHWRREKLERAYLEALAQAPQALARSPEERAILLETLFELDRLLDDLPAVVRRAFLLSQLDGQTHAQVAQALGVSIPTVKRHIVRALARCCFADLSFHP
>NZ_CP021400.1|WP_032962946.1|2728748_2729771_-|DUF4880-domain-containing-protein
MKAGSTWYHATQEAAGIAPEVAERALQWLLDLREDATPQTRRAWAQWHDAHPDHARAWSRIESVMGQLRALSAPDSATAARSALLPRRRAGLKALAALAMAGGSAWALRDTVAWREWAADQRTAIGQRRALTLPDGTHIVLNTHSAIDLRYGPAERRLYLVAGEVLIVTAPDRQAPPRPFLVQTRQGVARALGTEYSVRQHGNETCVSVLRGSVRIEPREHPGRGLLLAAGRHARYTAEGIAGDGPADERDLAWKDGFIMARGMRLADFLAELGRYTEASLSCDPAVAGLQVSGAFPTGDAEQVMAALAATLQLRLETQAPLWRARRLRLLSVTKFPVQG
>NZ_CP021400.1|WP_032955771.1|2726301_2728533_-|TonB-dependent-receptor
MLGRFGREAGVLLSFRPDVTQGLASPGLRGSYTVQAGLQQLLAGTGIQARPQAAGGYVLERSGGVAQLQPITVAASAAVDALPAPYAGGQIARGGGLGMLGTADVMDVPFNTTNYTAQALENQQARTLADIVINEASVRTLTSSGGFGEDFQIRGYTVSSGDVGLNGLYGLASSSRMPAAIMERVEVLKGPGTLMNGIGPNGSIGGGINVVTKRAGDDPLTRVTATYQDKSQLGGMVDMGRRFGQDNEWGIRVNGVYHNGDTTIDHGSQRQGVGALALDYRGPRLRGSLDAYTQQERTDNFRPQVGFQSSVTDLPSPPSGHRNFYPGTQLELKDSTVASRLEYDLNDSLTVYAAGGYRYGTANQTFPSGPVDQDGGFTVRNAFYDSYSRSSTGEIGLRARFDTWGVKHNLSLGATRLDQELGNFYITSTGTAASNIYHPAPLPEVTGHRGSPSKASETALTSFTLADTLSFADDRLMITGGLRQQRVALDNYSTATGDRTSSYDESAISPLAGVVFKPWSNVSLYGNFTSGLTRGGVAPATAANAGQVFAPYKSKQYEAGVKVDWGSVITSASVFQITRPNSMTDPDTNVYSFDGEQRNRGFELAATGEVTPGLRVMASATFYDAKITRSAGGVNDGNDANGVPDSAFNLGVDWDMPWVRGLSLNARVIHTSSAWFNAANTIRLPSWTRYDVGARYSTRVMGRAVVFRANIENLFNQTYWLASGTYATVAAPRAFLLSAQIDF
>NZ_CP021400.1|WP_051594403.1|2725277_2726177_-|amidohydrolase-family-protein
MTTSPPPGEVPFCLPPLPLPQQAPPAFEAPPLACDTHAHVVAADRRAYPMVAERSYTPHPATEEAYLAMLAANGMERGVLVQISVYGTDNRYMLEVLRRHPERLRGIGVVAPDIGDAQLRDMHEAGVRGLRINVLFGGGIGFDAMETLAHRIKDMGWHMQFLMDARQLPELLPRMRKLPVSGVVDHMGHMPVAEGLQSPGFQALAHLVQDHGWWVKLSGAYRISAQYDGYADVLPWAQALIAMAPDRMVWGSDWPHVHISPMVNTGKLRNQLAEWAPDPWTRQAILVDNPQRLYGFPSR
>NZ_CP021400.1|WP_029581389.1|2724022_2725252_-|MFS-transporter
MQWYRELNQTERRTFVAAFGGWAIDALDFMVFTFVISTLISLWGIEKGQAGMLGTVTLLFSAIGGWLAGILADRYGRVRVLQVTILWFSACTVAIGFAQNFEQLFVLRALQGLGFGGEWAVGSVLMGEIVRAEHRGKAVGTVQSGWAIGWGVAAILYTIAFSVLPPEWAWRTLFWIGVIPALLVLYIRKHVPEPEVFQRARSQLEASAARPSFWMIFSPALLKTTVITALLCTGVQGGYYAITTWLPTFLKTERHLSVMGTGGYLMVIIVGSFCGYIAGAYLADRLGRRANLLIFSVLSGLSVYVYTLVPLTDAQMLVLGFPLGFAASGIFSGVGAYLTELFPTEVRANGQGFAYNFGRGIGALFPSLVGFLSQTQGLAWAIGAFATGAYAIVIVTALLLPETRGRVLK
>NZ_CP021400.1|WP_029581390.1|2723325_2723949_-|response-regulator-transcription-factor
MTTVLLVDDHTMFREGLALALQHTAPALQLLPAATGAQALALLDDLRGIDLVVMDYYLPDMAGTELLRRLRQRRPQLRILVLSASEDPEDRRRALEAGAQDYLHKSASSRTLASALAALGQARPDMPAAAGAAPDAAALLRALTPRQLDVLRLICDGLRNKAISEQLNMSEKTVKSHVSAILGTLGVLNRTQAALVARRGGLFGKPA
>NZ_CP021400.1|WP_029581379.1|2742114_2742714_+|nitroreductase-family-protein
MSNAYIEALKQRRTQYALGRNVSLSKDALVALIQDAVKHSPSSFNSQTSRALVLFGAESEKLWALAIDEVRKVAPAEGFDKTEAKLKSFAAGVGTVLFFEDQDVVRGLQEKFALYADNFPVWSEQASGMAQLSVWSALANAGVGASLQHYNPLIDAAVAREWKVPASWKLRAQMPFGSNEAPKSEKAFMDDADRFIVAG
>NZ_CP021400.1|WP_029581378.1|2742833_2743700_-|glutathione-dependent-disulfide-bond-oxidoreductase
MTTEYFPPKVWTWNKNSASTASNASSLNRPIAGATHEKTLPVGRHPLQLYSLGTPNGQKVTILLEELLARGHAQAEYDAWLIRIGEGDQFGSGFVDINPNSKIPALVDRSGDTPIRVFESGAILLYLAEKFGDFLPADPAARAECLSWLFWQMGSAPYVGGGFGHFYAYAPVKIEYAIDRFTMETKRQLDVLDRRLAEHEYLAGDQYTIADIAVFPWYGGLIKGWLYDAAEFLAVHEYRHVQRWADTLLARPAVDRGRIVNRLRGPLSEQLHERHDASDFDTKTADKT
>NZ_CP021400.1|WP_080700973.1|2743801_2744491_-|alpha/beta-hydrolase
MAAAFIHGAPGSMLAAAAGKTETHFFAGPAGAMEVLADAPAQAPRGIALVTHPQPLLGGSPRHKIPHRLAHGLRDDGWLALRPAFRGVAGSAGHYDHGDGESEDILALARALRAQAPALPLALVGFSFGAYVQARVARALLDAGTPADRVVLAGLPVGEVPAERVYDTPPLPEEVVLIHGENDAQAPLAPLLEWARPNGHPVTVVPGADHFFSRSLPLLLKLVRQHLAA
>NZ_CP021400.1|WP_032955752.1|2744761_2746306_+|polyamine-ABC-transporter-substrate-binding-protein
MRCGLALALTACGLGSSAWAEERPMLRLSSGAADNATLDPHRATSTADKGVAAEMFNALVRFPPGSADPKALEPDLAERWEASPDSKTWTFHLRRGVQFHGGYGELKAEDVVYSIQRAADPNRSSFAATFGLIDKVEAVDDHTVRFTLKYPDAAFLGRVSNYHGGNIVSKKAAEKLGDKFGGSPVGTGPFAFGQHVTQQYVKLVANDSYFRGKPKLAGIMYRMIPSDSARELAFTSNEIDVMQGKREQRWVERSAKRGMQVDIFEPAEFRTLHINRNIKPLDNLKVREAIAAAINVDEIVRYAGKDVADKGCSVVPNGYLGQDCGAGAYAYDAGRAKQLLAEAGFPDGIQIKSVVSNISAQQPIMEIVQAQLAKAGIKLDMEVVDHATYQAKSRQDLSALVFYGAARFPNADTYLTEFYDSAAAIGAPGAMSNFSHCSVADEAIRQARIEPDAQKQLALWKDAQARIRADVCAVPLFGLKQVWVHSERVNYGYKLDGALNLQPPITEQTTVTAP
>NZ_CP021400.1|WP_029581375.1|2746292_2747210_-|LysR-family-transcriptional-regulator
MKNILNLRQIEAFKAVIEHGTVSQAATALGVSQPAVSKLLTHLEADSGLALFERVRGKLAPTAQGMRLYREVDRVFNGLRQLEQAVESIRRAEQRTLNVGVLPALAGAFIRRVSMQFLRRHPDVRISIQSRGSLFLADWLATRHIDVALVGSRVDNPYIEREPLFRQPLVCALPPNHVLTRKRVIRPRDLAGLPFISFGPESQTHQLVQQAFDAAGLPVNVALDTNTAPTACEFVAAGLGVSLIHPLFAEGMQSRLVLRRFDPELHFHFQLCRAQASRNAALVEDFVQEVRDVAAQVSREVLKGQ
>NZ_CP021400.1|WP_032955770.1|2747301_2748405_+|FAD-binding-oxidoreductase
MAGAGMVGAAIAYGLAGLGQRVLLVDGGDTDYRAAKANFGLVWLQGKGHGNPDYQRLSHRSVLDWPDFARELQAESGIDLQYERRGGLHFCLGEADLQARAARMQAWRRQAPEVGDCVSVLARDELLRRFPGLDLGPEVSGASVGELDGHANPLRLLAALQAVFLRRGGTLWGNAPVRAIRPLDGGGFEIEAGGRRARGARLVIAAGLGSAALGAQVGLAVPLRPQRGQILVTERLAPLLPVPASGIRQTGEGTVMVGLTQEEAGYDLSTTTEAAVHMSRNALRILPALAQARLVRHWSCLRVMTPDGCPVYAQSQPFPGAFVALCHSGVTLAALHAGRYARALASGAPPSFLDVFHHERFNVQKVA
>NZ_CP021400.1|WP_029581373.1|2748385_2748682_+|(2Fe-2S)-binding-protein
MFRKLHESGAASLTLTIDGQPVRAEPGESVAAVLLRQDTPASRSTPVNESPRAPYCMMGVCFECLAIIDGVASTQACMVPVRDGMRVERQHGKRSVQA
>NZ_CP021400.1|WP_080700974.1|2748678_2750139_+|FAD-dependent-oxidoreductase
MKREFDVVVIGAGPAGMSAAIRLREQHMRVLVVDEQPAPGGQIWRAVETVAGTRTGRLLGDEYRAGAALAERFRQCGAVYEPQTQVWQIETGWHVYMTRGGRAQAVRADQVLLAIGAQERPAPFPGWTLPGVLTVGAAQILLKTSNQVPAAPVWVAGSGPLPLLYMAQLLRAGGQIAGWLDTSAPGAWRRALPWAGAALASWGDIRKGLGWLRELKAAGVRRVRGVTGLRALGEGALREIEYTLADGSLRREPASVLLSHEGVVPSIHMTRALECAHHWDARQSCLAPDLDDWGQTSREGVYVAGDAAGIGGALAACARGELAALGMALRAGCMTAQAAGQAAAPLREKLRGLLRIRPMLDEMYPPRAGIFNPPDETIVCRCEELTAGDIRRAARIGQPGPNQVKSYTRAGMGPCQGRQCGYTVAHIVAAEERRPVSEVGFYRIRPPLKPLTLGELASLDVGDDGVVLAGAPESPGEAPAAREPRP
>NZ_CP021400.1|WP_032979440.1|2750135_2751260_+|FAD-binding-oxidoreductase
MSAPVFDVAVIGGGLHGLSAALHIARQGKRVVVIERHWTGRHASGATAAGVRTLNRDRRELDLSMEALDMWHDMASLVGDDCGFHAHGQICVAETEQGLAKLAGRVDSLRAAGYAHEDIIDAAELRRLLPALSPHCVGASIARRDGAADPHRALRAFRASAEAAGVTLVEHCAVTGLRRQGADWRVVTERGDWVVPAVVNAAGAWSARIAAMAGDEIPLATKSSMMMVSERLRPFIKPVVAIVGRSLSFKQSDQGTLVIGGGLQGTPDLDRETSTARMRVLAKGARAATDLFPMVRDIRIVRVWAGLEAKTEDLLPVIGPSPRAPGLFHAFGFSGHGFELVPVVGAVMADLVLRGATARPIGALQAARLMGGQP
>NZ_CP021400.1|WP_029581370.1|2751256_2752198_+|ABC-transporter-permease
MIRYAIKRLLLAIPTLLAMLTAVFILVRLVPGDPAAVMLGDQASAEALAALRLRLGLDLPTHEQYLRFLGDMLTGNFGVSMASGRTVLQEVGQVLPWTLQLTAAAILIGVVFGLPLGIWAALRRNAWPDYLGRLLSLTGLSFPAFVSAILMLLVFAIQLRWFPVIGSSAATDWGTQLRNLALPAFNLGLIMMAYVMRVTRSSMLGVMGEDYVRTARAKGLRPLRLIMRHGLRNALIPIVTVVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFAACVILVNLLTDLVYGLVDPRVKYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021400_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021400_3

2741501-2741730

Orphan

Consensus_repeat	Method
CGCCGCCCGCGCCGCCGCCCGCG	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP021400_3

>merge|NZ_CP021400|3|2741501-2741730|CRISPRCasFinder
TGGCGCCCAGCCCGCCGCCGCCGCCGGTGTATATCGCGGACATGCCGCCGCCGCCGCCGCCCAGGCCGGCGCTGCCGCCTGTTTGGGGCGCGCCGCCCGCGCCGCCGCCCGCGCCCGGACTGCTGCCGCCTGTCGGGGCCACGCCATCGGCGCCGGCGCGCAGCCCGCCGCCCGCGCCGCCGACCGCGTAGCCGGCGTTCAAGGTGGGGCCGCCCGCGCCGCCGCCTCCG

>NZ_CP021400|3|3|2741501-2741730|CRISPRCasFinder
TGGCGCCCAGCCCGCCGCCGCCG	CCGGTGTATATCGCGGACA
TGCCGCCGCCGCCGCCGCCCAGG	CCGGCGCTGCCGCCTGTTTGGGGCG
CGCCGCCCGCGCCGCCGCCCGCG	CCCGGACTGCTGCCGCCTGTCGGGGCCACGCCATCGGCGC
CGGCGCGCAGCCCGCCGCCCGCG	CCGCCGACCGCGTAGCCGGCGTTCAAGGTGG
GGCCGCCCGCGCCGCCGCCTCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021400.1\|WP_032962947.1\|2729767_2730271_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP021400.1\|WP_126623609.1\|2734484_2741450_-\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
NZ_CP021400.1\|WP_029581378.1\|2742833_2743700_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NZ_CP021400.1\|WP_029581381.1\|2734161_2734488_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021400.1\|WP_029581384.1\|2730390_2731776_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|129864
NZ_CP021400.1\|WP_029581379.1\|2742114_2742714_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP021400.1\|WP_029581375.1\|2746292_2747210_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP021400.1\|WP_029581370.1\|2751256_2752198_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP021400.1\|WP_032955771.1\|2726301_2728533_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021400.1\|WP_032955770.1\|2747301_2748405_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021400.1\|WP_080700973.1\|2743801_2744491_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NZ_CP021400.1\|WP_032955752.1\|2744761_2746306_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173873
NZ_CP021400.1\|WP_095075242.1\|2733430_2733982_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372042
NZ_CP021400.1\|WP_080700974.1\|2748678_2750139_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273584
NZ_CP021400.1\|WP_032962946.1\|2728748_2729771_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP021400.1\|WP_051594403.1\|2725277_2726177_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP021400.1\|WP_032979440.1\|2750135_2751260_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP021400.1\|WP_029581373.1\|2748385_2748682_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP021400.1\|WP_029581383.1\|2731775_2733431_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP021400.1\|WP_029581389.1\|2724022_2725252_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929

Protein	Function_ID	Function_description	E-value
NZ_CP021400.1\|WP_032962947.1\|2729767_2730271_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	2.45557e-68
NZ_CP021400.1\|WP_126623609.1\|2734484_2741450_-\|autotransporter-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	2.86784e-40
NZ_CP021400.1\|WP_029581378.1\|2742833_2743700_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NZ_CP021400.1\|WP_032955752.1\|2744761_2746306_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173873	cd08508, PBP2_NikA_DppA_OppA_like_1, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021400.1\|WP_029581384.1\|2730390_2731776_-\|c-type-cytochrome	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	3.60233e-09
NZ_CP021400.1\|WP_029581379.1\|2742114_2742714_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.89569e-110
NZ_CP021400.1\|WP_029581373.1\|2748385_2748682_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.17053e-29
NZ_CP021400.1\|WP_029581370.1\|2751256_2752198_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40169e-121
NZ_CP021400.1\|WP_032955771.1\|2726301_2728533_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.88414e-97
NZ_CP021400.1\|WP_032955770.1\|2747301_2748405_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.13517e-39
NZ_CP021400.1\|WP_080700973.1\|2743801_2744491_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	1.98941e-45
NZ_CP021400.1\|WP_029581375.1\|2746292_2747210_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80672e-62
NZ_CP021400.1\|WP_095075242.1\|2733430_2733982_-\|hypothetical-protein	gnl\|CDD\|372042	pfam12318, FAD-SLDH, Membrane bound FAD containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria. Proteins in this family are typically between 168 and 189 amino acids in length. There is a conserved ALM sequence motif. This family is a membrane protein (FAD-SLDH) involved in oxidation of D-sorbitol to L-sorbose.	2.27058e-35
NZ_CP021400.1\|WP_080700974.1\|2748678_2750139_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	4.56202e-28
NZ_CP021400.1\|WP_032962946.1\|2728748_2729771_-\|DUF4880-domain-containing-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	5.79708e-67
NZ_CP021400.1\|WP_051594403.1\|2725277_2726177_-\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	6.64608e-77
NZ_CP021400.1\|WP_032979440.1\|2750135_2751260_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.16008e-58
NZ_CP021400.1\|WP_029581383.1\|2731775_2733431_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.89685e-61
NZ_CP021400.1\|WP_029581389.1\|2724022_2725252_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.33194e-159

>NZ_CP021400.1|WP_126623609.1|2734484_2741450_-|autotransporter-domain-containing-protein
MTELVTGATQPAAGYGGGGARTSSGAMLTSGHASTDVLGVGGGGGGGGASNGGSGTAGSLTLSRSDVSILGSALVGGGGGGGGYIGNGGAGGDGTLTLLDGTSLSVGDTLLVGGSAGGRGEGLGGAGGAGKIDMVDSTIVIGKNLILGGYSSSSATGGSGELSIGTTTNGAAAINFQPGASFTINPNGTLRVGVALYGAAFNGLDRLTNNGNIFLTQADASYVFRPGLTGNGKVTINTIGTTILNGDLSAYNGSIAAVGLGALQIGDAGSTWASASGQISGDSQLIFGQDADLIFGGSIAGSGGLTHAGTGRLTLTRTNQVNGEIVVDRGTLALDGGSLIAPSGKLSVGTAANAGVELRNGAMLETHDANIGVAGTGSVKIGGGSSWLSNFAYIGYTNTGSLVIDSGGTATSARGVVGLAGDGSVMVSDAGSRWEASTGLLMNPQGGRQSSLTIANGGTVTARQVELGSGGGTGKSTISLQGDSTARGVLETGGIILHGADAALDFNGGILKATQDSTDFLSNIGAAQTQLTGGGLLFDTNGHQVTITSQLNGTGDLSKLGTGTLTVNRIDSTGAVGVLAGTLKLGSSQAMVTGANSVSVADGAILDLNGYEATVGRLAGDGRVAVNDAVLTVGGSNQDSTFGGIISGTGRLTKTGTGKLTLTGANDYTGMTYILAGTLAAGAANTLGRGSLAVGSPAVLDLGAYSQTVGDFLGTGTVALGGATLTTNTTGSTIFFGRLTGTGNFVKQGGGVVSLAGTSDYVGTTHVQQGSLLFLNSAALAPGALRIDAGASAYLDPAGIYSVSSLAGGGVLDLGSAPLNVGDSNSTQFTGVLAGTGGALFKTNTGTLTLSGDNTYSGNTGVLGGTLRVDGSIARSSSVTVYAGGTLAGEGVVSATTVKAGGILAPGSAGSVLTVNGALTLEQGSRLNVVLGAPGTPAAPGASSGLRVAGDLSLDGTLNLASSASDLIGYYRLISYGGALSGNGLTIGNTPVGYLPAQFTTVQNVPGNIDLKVTTLGDNALQTWQGAGGSWTTAGAQWFNDGGQTPVAWAGNHAVFMGTAGTVSVDNAASFKGLQFVSDGWQLAGAAALTTDAGGSEVRVLAGNTAAIATAIQGSGGLNKTEGGTLVLSGANGYTGGTTVSGGVLSVSSDANLGLGIGGVTLNGGTLRVSNTGYGSTARDLTVGAGNGALDLAGDFHLNGHLSGNGSLSKLGTGTLFLEQGSSAFTGTLALAAGALSAQAVNALGASAVTLAGGATLALNGYSQTLKSLAGAGNVQLGAATLRTGADNTSTTLSGAITGTGSLIKQGTGNFTLSGANLYSGGTSIESGTLTAGRGQVLGTGGLTVANGALMDFNGYDQTLTTLDGAGEVRLGSAALTVGAGDLDSHFAGALDGDGSLTKLGAGTLTLSGTSHYTGPTTVSAGTLAVDGAISGSALQVASGARLAGNGTVGSTTVASGGRLAPSGLGSLHIAGNLSLAAGAALDYQLGAPGTPSAPGAGSHLQVDGDLSLNGTLNLDDSAGGLGYYRLIRYGGALSGGGLVLGASHLDAGQYRIVQNLPGSIDLRIGTVGSNLLQTWTGGNGVWNTSTQDWTNDGGDLPVAWAGNHAVFMQNGGARIDVQGSPSFAGLQFVADGYRLQGNGRLLTQAGGSEIRVLGGNTATIATAIGGAGGIDKTEGGTLVLAGANDYAGGTRISGGVLAVSREANLGSGGLTLNGGTLRIADAGYAVSARAIEVQAAGGALDLPHDFTLQGALSGSGALIKRGAGLLTLTADSSAYRGAATLAAGGLWLGDAARLGGTLTARDGTLLGGTGTLGSTTVQAGAVHSPGSPIGTQTIVGDYVNRGTLRIDATPSDHDRLAVSGGVDIAGATLDLRLSPDDAASWKPRTGPYTLIAKQSPGAVVGEFARLNNPLLFMNASVDTRGGDGNDVTLTLQRNDLSLASLALTANQRAVAGSIEGLPDSHEVWRTVMLSTDAAALGQALSQLSGDTHAGVVSALRATGPAPAAQNGLAALRGNLAAPMAPGAPTAAAGASDAPAAPAALPTRATAPLWAQVSGDWMRLASDGNTAAIQQSSTNLSLGGDAAVGGGWRLGGAFGYTNARISGQDRAASAKTDSYTATLYGGKAFALGQGKLNVLAGAAYSWHDIDSRRQVRYGSLDQTLKADYGASSTQLFAEVGYALPLGAQASIEPFAGLSWNNLRMRGFAESGGSAALSGQAQSDNTTSTLAGLRGQWQLPDSAIALRGLLGWRHAYGTLRPSSTLAFDQGPAFSVAGAPIARDAARVELGADLVVVRNMTAGLAYAGEFGGGNRQHTGTLNVRWQF
>NZ_CP021400.1|WP_029581381.1|2734161_2734488_+|hypothetical-protein
MELETAYWDGELVISVEPREVRMSHWIHAPRAWRALDGQLLFDLAGSDWDLCGVGGEDEDCLVLALRRYPGGAPARLLTIARGSLEMHLDGESLPAGELLPRLEARRP
>NZ_CP021400.1|WP_095075242.1|2733430_2733982_-|hypothetical-protein
MPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTDRQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIVAAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPPLLPTSKAL
>NZ_CP021400.1|WP_029581383.1|2731775_2733431_-|GMC-family-oxidoreductase
MTRQAEFQSNGDARADIIVVGSGVVGAMIADQLAARGHSVLILEAGLRIERGQAVENWRNMPFANRAGSDFQGLYPQSPDAPAPLYFPENNYVHLTGPSASSFKQGYLRTVGGTTWHWAASCWRHLPVDLRMKSAYGVGRDWPISYDELEPFYLQAENEMGVAGPNDPARQSPAERSGPYPMDMVPWAYGDQRFADVVNPHGYRSVPIPQGRSTQPWRGRPTCCGNNNCQPICPIGAMYNGIHHVQAAEEKGAIVLAQSVVYKIDTDENNRITAVHWYDAARRSHKATGQHFVLACNAMETPRLLLMAANARNPKGIANRSDQVGRNIMDHSGFHCYFQASEPLWPGRGPAQSSCLVGPRDGAFRAEYSANKMILNNITQVTLATKTALAQGLTGKALDAEIRRRAAHGVDLSISLEPLPDPNNRLTLSKTRRDPLGLPCPDVHYDVGDYVRKGAEAAHAQLRHIGSLFKATDFLITTQLNANNHMMGSVIMGSDPRDSVVDGDCRAHDHDNLWLPGGGAMPSASVVNSTLTMAALGLKTAAAIARRMEAA
>NZ_CP021400.1|WP_029581384.1|2730390_2731776_-|c-type-cytochrome
MKTLLCGLALALLPLGAHAADEARLIERGRMLSIAADCMACHTQAPSGKPYAGGYPIQSPLGTIYASNITPSTRAGIGGYSLEDFARAVRQGVRPDGSRLYPAMPYTSYTLITDEDIQALYTYFMKGVQPVDEPSPATDLPFPFGIRASMRVWNALFLEDKRFTPDPDQSAEVNRGAYLARALAHCSSCHTPRNALMAEDPKRPLGGGMVGPWHAPNISSDPQAGIGGWTNEEIVQYLRTGRVAGKGQAGGSMAEAVEHSFQHMPQADLAAIAAYLKSTPPVPADAAAPAAYARGAAISPEAGLRGADPQTANLSLKSGAALFSGYCASCHQAGGQGSAGQAYPSLFHNTATGAGSASNLIAAILYGVDRNVGGQHVLMPRFDAKSYVQPLSDAQIALIANYVLANYGNARLSVTPDDVRQARQGGPAPLLARAQPYMLPAAVTALLIVLLGLLLLRRRRA
>NZ_CP021400.1|WP_032962947.1|2729767_2730271_-|sigma-70-family-RNA-polymerase-sigma-factor
MHPATLETLYTDHHSWLRGWLHRRLGNTEQAADLAHDTFIRLLCSERVPAALDEPRAFLTTVAQRLVSNHWRREKLERAYLEALAQAPQALARSPEERAILLETLFELDRLLDDLPAVVRRAFLLSQLDGQTHAQVAQALGVSIPTVKRHIVRALARCCFADLSFHP
>NZ_CP021400.1|WP_032962946.1|2728748_2729771_-|DUF4880-domain-containing-protein
MKAGSTWYHATQEAAGIAPEVAERALQWLLDLREDATPQTRRAWAQWHDAHPDHARAWSRIESVMGQLRALSAPDSATAARSALLPRRRAGLKALAALAMAGGSAWALRDTVAWREWAADQRTAIGQRRALTLPDGTHIVLNTHSAIDLRYGPAERRLYLVAGEVLIVTAPDRQAPPRPFLVQTRQGVARALGTEYSVRQHGNETCVSVLRGSVRIEPREHPGRGLLLAAGRHARYTAEGIAGDGPADERDLAWKDGFIMARGMRLADFLAELGRYTEASLSCDPAVAGLQVSGAFPTGDAEQVMAALAATLQLRLETQAPLWRARRLRLLSVTKFPVQG
>NZ_CP021400.1|WP_032955771.1|2726301_2728533_-|TonB-dependent-receptor
MLGRFGREAGVLLSFRPDVTQGLASPGLRGSYTVQAGLQQLLAGTGIQARPQAAGGYVLERSGGVAQLQPITVAASAAVDALPAPYAGGQIARGGGLGMLGTADVMDVPFNTTNYTAQALENQQARTLADIVINEASVRTLTSSGGFGEDFQIRGYTVSSGDVGLNGLYGLASSSRMPAAIMERVEVLKGPGTLMNGIGPNGSIGGGINVVTKRAGDDPLTRVTATYQDKSQLGGMVDMGRRFGQDNEWGIRVNGVYHNGDTTIDHGSQRQGVGALALDYRGPRLRGSLDAYTQQERTDNFRPQVGFQSSVTDLPSPPSGHRNFYPGTQLELKDSTVASRLEYDLNDSLTVYAAGGYRYGTANQTFPSGPVDQDGGFTVRNAFYDSYSRSSTGEIGLRARFDTWGVKHNLSLGATRLDQELGNFYITSTGTAASNIYHPAPLPEVTGHRGSPSKASETALTSFTLADTLSFADDRLMITGGLRQQRVALDNYSTATGDRTSSYDESAISPLAGVVFKPWSNVSLYGNFTSGLTRGGVAPATAANAGQVFAPYKSKQYEAGVKVDWGSVITSASVFQITRPNSMTDPDTNVYSFDGEQRNRGFELAATGEVTPGLRVMASATFYDAKITRSAGGVNDGNDANGVPDSAFNLGVDWDMPWVRGLSLNARVIHTSSAWFNAANTIRLPSWTRYDVGARYSTRVMGRAVVFRANIENLFNQTYWLASGTYATVAAPRAFLLSAQIDF
>NZ_CP021400.1|WP_051594403.1|2725277_2726177_-|amidohydrolase-family-protein
MTTSPPPGEVPFCLPPLPLPQQAPPAFEAPPLACDTHAHVVAADRRAYPMVAERSYTPHPATEEAYLAMLAANGMERGVLVQISVYGTDNRYMLEVLRRHPERLRGIGVVAPDIGDAQLRDMHEAGVRGLRINVLFGGGIGFDAMETLAHRIKDMGWHMQFLMDARQLPELLPRMRKLPVSGVVDHMGHMPVAEGLQSPGFQALAHLVQDHGWWVKLSGAYRISAQYDGYADVLPWAQALIAMAPDRMVWGSDWPHVHISPMVNTGKLRNQLAEWAPDPWTRQAILVDNPQRLYGFPSR
>NZ_CP021400.1|WP_029581389.1|2724022_2725252_-|MFS-transporter
MQWYRELNQTERRTFVAAFGGWAIDALDFMVFTFVISTLISLWGIEKGQAGMLGTVTLLFSAIGGWLAGILADRYGRVRVLQVTILWFSACTVAIGFAQNFEQLFVLRALQGLGFGGEWAVGSVLMGEIVRAEHRGKAVGTVQSGWAIGWGVAAILYTIAFSVLPPEWAWRTLFWIGVIPALLVLYIRKHVPEPEVFQRARSQLEASAARPSFWMIFSPALLKTTVITALLCTGVQGGYYAITTWLPTFLKTERHLSVMGTGGYLMVIIVGSFCGYIAGAYLADRLGRRANLLIFSVLSGLSVYVYTLVPLTDAQMLVLGFPLGFAASGIFSGVGAYLTELFPTEVRANGQGFAYNFGRGIGALFPSLVGFLSQTQGLAWAIGAFATGAYAIVIVTALLLPETRGRVLK
>NZ_CP021400.1|WP_029581379.1|2742114_2742714_+|nitroreductase-family-protein
MSNAYIEALKQRRTQYALGRNVSLSKDALVALIQDAVKHSPSSFNSQTSRALVLFGAESEKLWALAIDEVRKVAPAEGFDKTEAKLKSFAAGVGTVLFFEDQDVVRGLQEKFALYADNFPVWSEQASGMAQLSVWSALANAGVGASLQHYNPLIDAAVAREWKVPASWKLRAQMPFGSNEAPKSEKAFMDDADRFIVAG
>NZ_CP021400.1|WP_029581378.1|2742833_2743700_-|glutathione-dependent-disulfide-bond-oxidoreductase
MTTEYFPPKVWTWNKNSASTASNASSLNRPIAGATHEKTLPVGRHPLQLYSLGTPNGQKVTILLEELLARGHAQAEYDAWLIRIGEGDQFGSGFVDINPNSKIPALVDRSGDTPIRVFESGAILLYLAEKFGDFLPADPAARAECLSWLFWQMGSAPYVGGGFGHFYAYAPVKIEYAIDRFTMETKRQLDVLDRRLAEHEYLAGDQYTIADIAVFPWYGGLIKGWLYDAAEFLAVHEYRHVQRWADTLLARPAVDRGRIVNRLRGPLSEQLHERHDASDFDTKTADKT
>NZ_CP021400.1|WP_080700973.1|2743801_2744491_-|alpha/beta-hydrolase
MAAAFIHGAPGSMLAAAAGKTETHFFAGPAGAMEVLADAPAQAPRGIALVTHPQPLLGGSPRHKIPHRLAHGLRDDGWLALRPAFRGVAGSAGHYDHGDGESEDILALARALRAQAPALPLALVGFSFGAYVQARVARALLDAGTPADRVVLAGLPVGEVPAERVYDTPPLPEEVVLIHGENDAQAPLAPLLEWARPNGHPVTVVPGADHFFSRSLPLLLKLVRQHLAA
>NZ_CP021400.1|WP_032955752.1|2744761_2746306_+|polyamine-ABC-transporter-substrate-binding-protein
MRCGLALALTACGLGSSAWAEERPMLRLSSGAADNATLDPHRATSTADKGVAAEMFNALVRFPPGSADPKALEPDLAERWEASPDSKTWTFHLRRGVQFHGGYGELKAEDVVYSIQRAADPNRSSFAATFGLIDKVEAVDDHTVRFTLKYPDAAFLGRVSNYHGGNIVSKKAAEKLGDKFGGSPVGTGPFAFGQHVTQQYVKLVANDSYFRGKPKLAGIMYRMIPSDSARELAFTSNEIDVMQGKREQRWVERSAKRGMQVDIFEPAEFRTLHINRNIKPLDNLKVREAIAAAINVDEIVRYAGKDVADKGCSVVPNGYLGQDCGAGAYAYDAGRAKQLLAEAGFPDGIQIKSVVSNISAQQPIMEIVQAQLAKAGIKLDMEVVDHATYQAKSRQDLSALVFYGAARFPNADTYLTEFYDSAAAIGAPGAMSNFSHCSVADEAIRQARIEPDAQKQLALWKDAQARIRADVCAVPLFGLKQVWVHSERVNYGYKLDGALNLQPPITEQTTVTAP
>NZ_CP021400.1|WP_029581375.1|2746292_2747210_-|LysR-family-transcriptional-regulator
MKNILNLRQIEAFKAVIEHGTVSQAATALGVSQPAVSKLLTHLEADSGLALFERVRGKLAPTAQGMRLYREVDRVFNGLRQLEQAVESIRRAEQRTLNVGVLPALAGAFIRRVSMQFLRRHPDVRISIQSRGSLFLADWLATRHIDVALVGSRVDNPYIEREPLFRQPLVCALPPNHVLTRKRVIRPRDLAGLPFISFGPESQTHQLVQQAFDAAGLPVNVALDTNTAPTACEFVAAGLGVSLIHPLFAEGMQSRLVLRRFDPELHFHFQLCRAQASRNAALVEDFVQEVRDVAAQVSREVLKGQ
>NZ_CP021400.1|WP_032955770.1|2747301_2748405_+|FAD-binding-oxidoreductase
MAGAGMVGAAIAYGLAGLGQRVLLVDGGDTDYRAAKANFGLVWLQGKGHGNPDYQRLSHRSVLDWPDFARELQAESGIDLQYERRGGLHFCLGEADLQARAARMQAWRRQAPEVGDCVSVLARDELLRRFPGLDLGPEVSGASVGELDGHANPLRLLAALQAVFLRRGGTLWGNAPVRAIRPLDGGGFEIEAGGRRARGARLVIAAGLGSAALGAQVGLAVPLRPQRGQILVTERLAPLLPVPASGIRQTGEGTVMVGLTQEEAGYDLSTTTEAAVHMSRNALRILPALAQARLVRHWSCLRVMTPDGCPVYAQSQPFPGAFVALCHSGVTLAALHAGRYARALASGAPPSFLDVFHHERFNVQKVA
>NZ_CP021400.1|WP_029581373.1|2748385_2748682_+|(2Fe-2S)-binding-protein
MFRKLHESGAASLTLTIDGQPVRAEPGESVAAVLLRQDTPASRSTPVNESPRAPYCMMGVCFECLAIIDGVASTQACMVPVRDGMRVERQHGKRSVQA
>NZ_CP021400.1|WP_080700974.1|2748678_2750139_+|FAD-dependent-oxidoreductase
MKREFDVVVIGAGPAGMSAAIRLREQHMRVLVVDEQPAPGGQIWRAVETVAGTRTGRLLGDEYRAGAALAERFRQCGAVYEPQTQVWQIETGWHVYMTRGGRAQAVRADQVLLAIGAQERPAPFPGWTLPGVLTVGAAQILLKTSNQVPAAPVWVAGSGPLPLLYMAQLLRAGGQIAGWLDTSAPGAWRRALPWAGAALASWGDIRKGLGWLRELKAAGVRRVRGVTGLRALGEGALREIEYTLADGSLRREPASVLLSHEGVVPSIHMTRALECAHHWDARQSCLAPDLDDWGQTSREGVYVAGDAAGIGGALAACARGELAALGMALRAGCMTAQAAGQAAAPLREKLRGLLRIRPMLDEMYPPRAGIFNPPDETIVCRCEELTAGDIRRAARIGQPGPNQVKSYTRAGMGPCQGRQCGYTVAHIVAAEERRPVSEVGFYRIRPPLKPLTLGELASLDVGDDGVVLAGAPESPGEAPAAREPRP
>NZ_CP021400.1|WP_032979440.1|2750135_2751260_+|FAD-binding-oxidoreductase
MSAPVFDVAVIGGGLHGLSAALHIARQGKRVVVIERHWTGRHASGATAAGVRTLNRDRRELDLSMEALDMWHDMASLVGDDCGFHAHGQICVAETEQGLAKLAGRVDSLRAAGYAHEDIIDAAELRRLLPALSPHCVGASIARRDGAADPHRALRAFRASAEAAGVTLVEHCAVTGLRRQGADWRVVTERGDWVVPAVVNAAGAWSARIAAMAGDEIPLATKSSMMMVSERLRPFIKPVVAIVGRSLSFKQSDQGTLVIGGGLQGTPDLDRETSTARMRVLAKGARAATDLFPMVRDIRIVRVWAGLEAKTEDLLPVIGPSPRAPGLFHAFGFSGHGFELVPVVGAVMADLVLRGATARPIGALQAARLMGGQP
>NZ_CP021400.1|WP_029581370.1|2751256_2752198_+|ABC-transporter-permease
MIRYAIKRLLLAIPTLLAMLTAVFILVRLVPGDPAAVMLGDQASAEALAALRLRLGLDLPTHEQYLRFLGDMLTGNFGVSMASGRTVLQEVGQVLPWTLQLTAAAILIGVVFGLPLGIWAALRRNAWPDYLGRLLSLTGLSFPAFVSAILMLLVFAIQLRWFPVIGSSAATDWGTQLRNLALPAFNLGLIMMAYVMRVTRSSMLGVMGEDYVRTARAKGLRPLRLIMRHGLRNALIPIVTVVGLYFGTLIGNSVLTEIVFNRPGLGKLILGALNTRDYTLLQGLMVVFAACVILVNLLTDLVYGLVDPRVKYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP021400_2	2.1\|2741299\|16\|NZ_CP021400\|CRISPRCasFinder	2741299-2741314	16	NZ_CP021400.1	3725942-3725957	0	1.0

1. spacer 2.1|2741299|16|NZ_CP021400|CRISPRCasFinder matches to position: 3725942-3725957, mismatch: 0, identity: 1.0

ttggaggcgccgccgc	CRISPR spacer
ttggaggcgccgccgc	Protospacer
****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021400_3	3.2\|2741566\|25\|NZ_CP021400\|CRISPRCasFinder	2741566-2741590	25	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	116740-116764	2	0.92
NZ_CP021400_3	3.2\|2741566\|25\|NZ_CP021400\|CRISPRCasFinder	2741566-2741590	25	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	151581-151605	4	0.84
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	510925-510955	7	0.774
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	MH338238	Mycobacterium phage Michley, complete genome	50174-50204	7	0.774
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NC_023695	Mycobacterium phage Violet, complete genome	50739-50769	7	0.774
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_CP041766	Tomitella sp. HY188 plasmid unnamed, complete sequence	6900-6930	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_LR594660	Variovorax sp. PBL-H6 plasmid 2	383454-383484	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_LR594667	Variovorax sp. SRS16 plasmid 2	416918-416948	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_LR594690	Variovorax sp. WDL1 plasmid 2	400823-400853	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_CP053710	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed2, complete sequence	349440-349470	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_LR594672	Variovorax sp. PBL-E5 plasmid 2	417052-417082	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KY555145	Caulobacter phage Ccr29, complete genome	38847-38877	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KY555143	Caulobacter phage Ccr2, complete genome	36680-36710	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NC_019407	Caulobacter phage CcrMagneto, complete genome	35469-35499	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KY555142	Caulobacter phage Ccr10, complete genome	36205-36235	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NC_019411	Caulobacter phage CcrSwift, complete genome	35434-35464	8	0.742
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	550932-550962	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KC139519	Salmonella phage FSL SP-030, complete genome	13840-13870	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KX765863	Salmonella phage ST-118, complete genome	12987-13017	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	MN871450	UNVERIFIED: Serratia phage KpYy_1_41, complete genome	41270-41300	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KC139514	Salmonella phage FSL SP-039, complete genome	13840-13870	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KX452700	UNVERIFIED: Enterobacter phage KPN7 genomic sequence	34693-34723	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	MK286578	Salmonella phage Season12, complete genome	13843-13873	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KR296689	Salmonella phage 35, complete genome	9911-9941	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	NC_048727	Salmonella phage Siskin, complete genome	13911-13941	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	KX452699	UNVERIFIED: Salmonella phage KPN6 genomic sequence	12780-12810	9	0.71
NZ_CP021400_3	3.4\|2741677\|31\|NZ_CP021400\|CRISPRCasFinder	2741677-2741707	31	GU169904	Staphylococcus phage SA1, complete genome	40485-40515	9	0.71

1. spacer 3.2|2741566|25|NZ_CP021400|CRISPRCasFinder matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 2, identity: 0.92

ccggcgctgccgcctgtttggggcg	CRISPR spacer
ccggcgccgccgcctgtttgggggg	Protospacer
*******.*************** *

2. spacer 3.2|2741566|25|NZ_CP021400|CRISPRCasFinder matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 4, identity: 0.84

ccggcgctgccgcctgtttggggcg	CRISPR spacer
gcggcgctgccgcctgttggggctg	Protospacer
 ***************** *** .*

3. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.774

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccgacggcgtagccgacgttcgtgcgcg	Protospacer
******** *********.*****. *   *

4. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to MH338238 (Mycobacterium phage Michley, complete genome) position: , mismatch: 7, identity: 0.774

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgacgaccgcgtagccggcgatcaccgcga	Protospacer
 ** ***************** ***  *.*.

5. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NC_023695 (Mycobacterium phage Violet, complete genome) position: , mismatch: 7, identity: 0.774

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgacgaccgcgtagccggcgatcaccgcga	Protospacer
 ** ***************** ***  *.*.

6. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_CP041766 (Tomitella sp. HY188 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
ccgccgaccgcgtagccggagctctgagcct	Protospacer
******************* *.** ..*.

7. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_LR594660 (Variovorax sp. PBL-H6 plasmid 2) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
accatgaccgggtagccgccgttcaaggcgt	Protospacer
 *  .***** ******* *********.*

8. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_LR594667 (Variovorax sp. SRS16 plasmid 2) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
accatgaccgggtagccgccgttcaaggcgt	Protospacer
 *  .***** ******* *********.*

9. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_LR594690 (Variovorax sp. WDL1 plasmid 2) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
accatgaccgggtagccgccgttcaaggcgt	Protospacer
 *  .***** ******* *********.*

10. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_CP053710 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gagccgagcgcgtagccggcgatcaccatgc	Protospacer
  ***** ************* ***  .**

11. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_LR594672 (Variovorax sp. PBL-E5 plasmid 2) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
accatgaccgggtagccgccgttcaaggcgt	Protospacer
 *  .***** ******* *********.*

12. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgagcgcgcagccggcgttcgggtcgc	Protospacer
 ****** ****.***********..* .*

13. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgagcgcgcagccggcgttcgggtcgc	Protospacer
 ****** ****.***********..* .*

14. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NC_019407 (Caulobacter phage CcrMagneto, complete genome) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgagcgcgcagccggcgttcgggtcgc	Protospacer
 ****** ****.***********..* .*

15. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgagcgcgcagccggcgttcgggtcgc	Protospacer
 ****** ****.***********..* .*

16. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 8, identity: 0.742

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgagcgcgcagccggcgttcgggtcgc	Protospacer
 ****** ****.***********..* .*

17. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
acgccgtccgcgaagccggcgttcttgtaca	Protospacer
 ***** ***** ***********  *   .

18. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KC139519 (Salmonella phage FSL SP-030, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

19. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KX765863 (Salmonella phage ST-118, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

20. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to MN871450 (UNVERIFIED: Serratia phage KpYy_1_41, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

21. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KC139514 (Salmonella phage FSL SP-039, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

22. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KX452700 (UNVERIFIED: Enterobacter phage KPN7 genomic sequence) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

23. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to MK286578 (Salmonella phage Season12, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

24. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KR296689 (Salmonella phage 35, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

25. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to NC_048727 (Salmonella phage Siskin, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

26. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to KX452699 (UNVERIFIED: Salmonella phage KPN6 genomic sequence) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

27. spacer 3.4|2741677|31|NZ_CP021400|CRISPRCasFinder matches to GU169904 (Staphylococcus phage SA1, complete genome) position: , mismatch: 9, identity: 0.71

ccgccgaccgcgtagccggcgttcaaggtgg	CRISPR spacer
gcgccgaacgcgtagccgtcgttctgtacga	Protospacer
 ****** ********** ***** . ..*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13239

Cedratvirus(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962253.1\|653_2033_-	hypothetical protein	NA	NA	NA	NA
WP_051594013.1\|2490_3480_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_029577415.1\|3840_4857_+	cyclase	NA	NA	NA	NA
WP_032962252.1\|4905_5877_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_051594014.1\|5908_6994_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_032962251.1\|6990_7854_-	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
WP_032962249.1\|7895_9059_-	thiolase	NA	NA	NA	NA
WP_032956188.1\|9055_9436_-	DNA-binding protein	NA	NA	NA	NA
WP_032962247.1\|9438_10221_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_032962472.1\|10239_11001_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_032962242.1\|11293_12448_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029577423.1\|12444_13239_+	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	6.8e-10	28.7

DBSCAN-SWA_2

51186 : 55041

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577452.1\|51186_51963_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.1e-15	32.4
WP_029577453.1\|51990_52848_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_029577454.1\|52862_53876_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_029577455.1\|54003_55041_-	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.0e-50	39.6

DBSCAN-SWA_3

60098 : 68671

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962213.1\|60098_61442_-	phosphoglucosamine mutase	A0A1X9I671	Streptococcus_phage	2.4e-07	27.1
WP_032962212.1\|61438_62281_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	6.5e-27	32.8
WP_029577461.1\|62311_64198_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	2.3e-112	42.3
WP_029577462.1\|64372_65044_-	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_029577463.1\|65062_65668_+	hypothetical protein	NA	NA	NA	NA
WP_029577464.1\|65910_66387_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_029577465.1\|66693_67173_-	helix-turn-helix transcriptional regulator	A0A1X9I5R1	Streptococcus_phage	2.1e-06	32.1
WP_029577466.1\|67354_68671_-	uracil transporter	Q9KX94	Enterobacteria_phage	4.4e-139	62.2

DBSCAN-SWA_4

72275 : 76642

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577470.1\|72275_73361_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-27	35.9
WP_029577471.1\|73374_74283_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032962209.1\|74275_74914_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_029577473.1\|74919_75678_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_029577474.1\|75745_76642_-	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	8.2e-36	37.2

DBSCAN-SWA_5

79956 : 84482

Halovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075210.1\|79956_81054_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.7e-49	32.5
WP_032962207.1\|81343_82297_+	transaldolase	H6WFR1	Cyanophage	1.8e-09	29.2
WP_032962205.1\|82310_82739_-	hypothetical protein	NA	NA	NA	NA
WP_029577478.1\|82872_83667_-	ABC transporter permease	NA	NA	NA	NA
WP_029577479.1\|83672_84482_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.3e-11	34.4

DBSCAN-SWA_6

87939 : 89907

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962203.1\|87939_89907_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	8.6e-46	37.4

DBSCAN-SWA_7

102717 : 106516

Brevibacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577492.1\|102717_103644_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.5e-24	28.8
WP_029577493.1\|103676_104588_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	9.2e-19	28.1
WP_029577494.1\|104806_106516_+	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	1.6e-27	23.8

DBSCAN-SWA_8

110173 : 110920

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075211.1\|110173_110920_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.6e-22	31.2

DBSCAN-SWA_9

114436 : 120199

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577503.1\|114436_115459_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	6.6e-66	39.8
WP_142177971.1\|115582_116611_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	3.3e-41	38.4
WP_029577505.1\|116603_117782_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_095075256.1\|117868_118342_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.1e-15	41.8
WP_029577507.1\|118503_119022_-	hypothetical protein	NA	NA	NA	NA
WP_029577509.1\|119317_120199_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	3.4e-50	36.1

DBSCAN-SWA_10

129199 : 130689

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577519.1\|129199_129910_-	phosphonate C-P lyase system protein PhnL	G9BWD6	Planktothrix_phage	1.2e-18	32.8
WP_029577520.1\|129912_130689_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	9.0e-15	24.4

DBSCAN-SWA_11

139098 : 141927

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962181.1\|139098_139917_-	phosphonate ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.6e-06	27.7
WP_029577531.1\|140419_140683_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_029577532.1\|140772_141063_+	hypothetical protein	NA	NA	NA	NA
WP_048940603.1\|141102_141927_-	M23 family metallopeptidase	I2E8W3	Clostridium_phage	1.4e-18	48.1

DBSCAN-SWA_12

147342 : 148281

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577542.1\|147342_148281_-	DnaJ domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	2.3e-12	25.1

DBSCAN-SWA_13

178984 : 185562

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579459.1\|178984_180121_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.3
WP_029579458.1\|180262_180604_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.6e-11	42.6
WP_029579457.1\|180666_182547_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_032961952.1\|182604_183540_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.0e-41	34.8
WP_029579455.1\|183592_184492_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_142178177.1\|184587_185562_+	D-2-hydroxyacid dehydrogenase family protein	A0A1B1IVB5	uncultured_Mediterranean_phage	6.4e-18	30.4

DBSCAN-SWA_14

190230 : 191253

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963031.1\|190230_191253_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.0

DBSCAN-SWA_15

206960 : 208747

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579432.1\|206960_207959_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.4e-06	39.4
WP_051594415.1\|207955_208747_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.2e-06	34.9

DBSCAN-SWA_16

221484 : 226268

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984591.1\|221484_223362_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.6e-15	33.5
WP_032963063.1\|223463_224579_+	AI-2E family transporter	NA	NA	NA	NA
WP_029579415.1\|224550_225312_-	ABC transporter permease	NA	NA	NA	NA
WP_051594418.1\|225308_226268_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-24	34.4

DBSCAN-SWA_17

233799 : 235068

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579403.1\|233799_235068_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	4.0e-12	27.7

DBSCAN-SWA_18

240047 : 240890

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579398.1\|240047_240890_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	9.4e-42	38.1

DBSCAN-SWA_19

256508 : 257195

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956276.1\|256508_257195_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.0e-09	29.4

DBSCAN-SWA_20

262700 : 266024

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956270.1\|262700_263225_-	superoxide dismutase family protein	Q9MC02	Salmonella_phage	1.2e-47	63.4
WP_029579377.1\|263341_264310_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_029579376.1\|264482_266024_-	malonyl-CoA synthase	A0A2H4PQM9	Staphylococcus_phage	1.8e-27	25.0

DBSCAN-SWA_21

274906 : 277990

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955816.1\|274906_277990_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.6e-25	24.8

DBSCAN-SWA_22

282198 : 283215

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979699.1\|282198_283215_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.6e-19	29.6

DBSCAN-SWA_23

305806 : 306187

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579338.1\|305806_306187_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.6e-15	46.4

DBSCAN-SWA_24

314826 : 317430

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963084.1\|314826_317430_-	ATP-dependent chaperone ClpB	A0A223W0B1	Agrobacterium_phage	9.4e-125	33.6

DBSCAN-SWA_25

322648 : 323152

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979689.1\|322648_323152_-	peroxiredoxin	M1I839	Pelagibacter_phage	5.1e-27	48.4

DBSCAN-SWA_26

345621 : 346140

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955607.1\|345621_346140_-	RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	1.1e-08	28.0

DBSCAN-SWA_27

357335 : 362167

Cedratvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579291.1\|357335_358160_+	urea ABC transporter ATP-binding protein UrtD	A0A1M7XV31	Cedratvirus	1.9e-07	23.9
WP_032978207.1\|358161_358860_+	urea ABC transporter ATP-binding subunit UrtE	A0A2K9L0W2	Tupanvirus	1.1e-06	24.0
WP_029579289.1\|358856_359339_-	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_032961035.1\|359947_360622_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	2.0e-10	34.5
WP_029579286.1\|360781_362167_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-06	30.4

DBSCAN-SWA_28

377008 : 378679

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032978214.1\|377008_378679_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-14	29.5

DBSCAN-SWA_29

385193 : 389685

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579261.1\|385193_387269_-	ATP-dependent helicase	A7KV33	Bacillus_phage	2.1e-63	28.5
WP_032979004.1\|387346_388246_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_029579259.1\|388242_389685_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.4e-16	28.8

DBSCAN-SWA_30

409530 : 411195

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961005.1\|409530_411195_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.8e-28	27.9

DBSCAN-SWA_31

423385 : 432060

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960992.1\|423385_425476_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	1.4e-107	54.3
WP_032960989.1\|425483_426866_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	1.6e-22	28.5
WP_029579228.1\|426985_427456_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_029579227.1\|427425_428430_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032960986.1\|428520_432060_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.2e-27	27.6

DBSCAN-SWA_32

436440 : 437898

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960980.1\|436440_437898_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	1.1e-37	31.1

DBSCAN-SWA_33

441152 : 442739

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960971.1\|441152_442739_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.6e-37	43.4

DBSCAN-SWA_34

454588 : 455410

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579204.1\|454588_455410_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-29	29.9

DBSCAN-SWA_35

458821 : 459370

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579198.1\|458821_459370_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	5.0e-12	29.5

DBSCAN-SWA_36

463108 : 465703

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960951.1\|463108_465703_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	7.2e-24	20.5

DBSCAN-SWA_37

470935 : 471778

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075259.1\|470935_471778_+	hypothetical protein	A0A1I9SA48	Rhodococcus_phage	4.4e-39	40.2

DBSCAN-SWA_38

485370 : 486492

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960928.1\|485370_486492_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.9e-28	32.4

DBSCAN-SWA_39

492574 : 493360

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579163.1\|492574_493360_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-34	41.5

DBSCAN-SWA_40

509953 : 510970

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960896.1\|509953_510970_+	XdhC family protein	A0A0P0IKN7	Acinetobacter_phage	5.5e-12	29.1

DBSCAN-SWA_41

519492 : 521148

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579140.1\|519492_521148_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.4e-25	39.1

DBSCAN-SWA_42

547460 : 549708

Escherichia_coli_O157_typing_phage(50.0%)

integrase

attL 544396:544413|attR 549908:549925

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
544396:544413	attL	NA	NA	NA	NA
WP_032960875.1\|547460_548207_-	hypothetical protein	A0A0F6TK45	Escherichia_coli_O157_typing_phage	1.6e-56	47.7
WP_032960872.1\|548409_549708_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0R6PH06	Moraxella_phage	3.2e-41	30.9
549908:549925	attR	NA	NA	NA	NA

DBSCAN-SWA_43

555872 : 558584

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960866.1\|555872_556631_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.2e-13	26.5
WP_032961055.1\|556627_557557_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_032960862.1\|557582_558584_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	2.0e-62	41.2

DBSCAN-SWA_44

577474 : 579190

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579086.1\|577474_579190_-	acetolactate synthase 3 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.5e-57	29.4

DBSCAN-SWA_45

594307 : 595306

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954879.1\|594307_595306_+	D-glycerate dehydrogenase	A0A2R8FCS0	Cedratvirus	2.5e-33	33.1

DBSCAN-SWA_46

603906 : 610511

Bacillus_virus(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142177975.1\|603906_604602_+	diguanylate cyclase	G3MA91	Bacillus_virus	6.0e-10	29.8
WP_095075213.1\|604609_604768_-	hypothetical protein	NA	NA	NA	NA
WP_032954875.1\|605095_605419_+	hypothetical protein	NA	NA	NA	NA
WP_080666543.1\|605609_605858_-	hypothetical protein	NA	NA	NA	NA
WP_029579059.1\|606103_607453_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.5e-89	49.0
WP_043224061.1\|607808_608144_+	hypothetical protein	NA	NA	NA	NA
WP_141984508.1\|608252_609167_+	hypothetical protein	NA	NA	NA	NA
WP_029579057.1\|609173_610511_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	6.0e-75	39.0

DBSCAN-SWA_47

615370 : 617346

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961451.1\|615370_616372_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.8e-07	23.8
WP_095075214.1\|616368_617346_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	4.8e-05	24.7

DBSCAN-SWA_48

620777 : 624136

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579046.1\|620777_623141_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	3.4e-81	48.0
WP_029579045.1\|623182_624136_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.1e-61	41.5

DBSCAN-SWA_49

629975 : 639465

Paramecium_bursaria_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961438.1\|629975_632105_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.0e-20	24.1
WP_032961435.1\|632117_632702_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_142177977.1\|632735_635459_+	DUF4118 domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	3.9e-12	24.6
WP_032954865.1\|635463_636156_+	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.8e-28	33.8
WP_032961429.1\|636268_637018_+	hypothetical protein	NA	NA	NA	NA
WP_126623669.1\|637115_637337_+	hypothetical protein	NA	NA	NA	NA
WP_029579033.1\|637346_638294_+	dihydrodipicolinate synthase	NA	NA	NA	NA
WP_029579032.1\|638208_639465_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.5e-11	63.0

DBSCAN-SWA_50

643619 : 649625

Acanthamoeba_polyphaga_mimivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961428.1\|643619_646376_+	insulinase family protein	A0A2L2DIR8	Acanthamoeba_polyphaga_mimivirus	2.5e-19	27.8
WP_029579023.1\|646457_647582_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	2.5e-21	28.4
WP_029579022.1\|647690_649625_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.8e-147	50.2

DBSCAN-SWA_51

691366 : 692806

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578977.1\|691366_692806_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.4e-50	34.1

DBSCAN-SWA_52

697752 : 703382

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578970.1\|697752_698592_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.3e-62	46.6
WP_032961293.1\|698605_699466_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_032961292.1\|699538_700660_-	porin	NA	NA	NA	NA
WP_032961289.1\|700646_703382_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	3.8e-44	25.8

DBSCAN-SWA_53

710346 : 711936

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578959.1\|710346_711936_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.0e-65	46.2

DBSCAN-SWA_54

715034 : 720245

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954839.1\|715034_716102_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	7.3e-07	29.2
WP_029578953.1\|716114_717935_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	2.1e-75	33.8
WP_032961281.1\|718045_719401_-	hypothetical protein	NA	NA	NA	NA
WP_029578951.1\|719543_720245_+	response regulator	W8CYM9	Bacillus_phage	2.1e-31	36.2

DBSCAN-SWA_55

724240 : 726001

Escherichia_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578947.1\|724240_726001_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	1.4e-164	51.0

DBSCAN-SWA_56

729293 : 734765

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578941.1\|729293_730967_-	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	3.4e-43	28.4
WP_032955022.1\|731234_732113_-	DMT family transporter	NA	NA	NA	NA
WP_029578939.1\|732264_732780_+	hypothetical protein	NA	NA	NA	NA
WP_029578938.1\|732798_733794_-	dipeptide ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.0e-16	30.9
WP_029578937.1\|733790_734765_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	2.3e-07	25.5

DBSCAN-SWA_57

741594 : 742923

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578930.1\|741594_742923_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	2.6e-22	24.5

DBSCAN-SWA_58

749043 : 749805

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578923.1\|749043_749805_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.5e-09	25.6

DBSCAN-SWA_59

756216 : 757377

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954831.1\|756216_757377_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-44	38.2

DBSCAN-SWA_60

762300 : 763248

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032954827.1\|762300_763248_-	2-hydroxyacid dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	4.5e-16	27.7

DBSCAN-SWA_61

773647 : 775590

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578466.1\|773647_774631_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.7e-06	30.4
WP_032954823.1\|774627_775590_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.7e-19	34.3

DBSCAN-SWA_62

787853 : 788933

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961205.1\|787853_788933_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-28	35.3

DBSCAN-SWA_63

793033 : 794626

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700167.1\|793033_794626_+	catalase	A0A2K9L0T1	Tupanvirus	1.7e-97	40.1

DBSCAN-SWA_64

814417 : 816983

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578438.1\|814417_815161_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.6e-15	31.3
WP_051594316.1\|815190_816141_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_029578436.1\|816218_816983_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.2e-12	31.0

DBSCAN-SWA_65

821109 : 828563

Brazilian_cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578431.1\|821109_821829_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.9e-15	28.4
WP_029578430.1\|821821_822829_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_032954808.1\|822825_823710_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_029578428.1\|823750_825481_-	acetolactate synthase catalytic subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.5e-33	28.5
WP_080666524.1\|825587_826319_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_029578426.1\|826483_827161_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_032961189.1\|827174_828563_-	ATP-dependent RNA helicase DbpA	A0A0N9Q9J4	Chrysochromulina_ericina_virus	3.9e-53	33.0

DBSCAN-SWA_66

839849 : 843945

Micromonas_sp._RCC1109_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032977878.1\|839849_840713_-	alpha/beta hydrolase	A0A068F2G2	Mycobacterium_phage	3.8e-06	26.4
WP_080700905.1\|840751_841669_-	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_032958866.1\|841953_842991_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	4.0e-42	31.9
WP_029578404.1\|843006_843945_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	9.8e-32	33.2

DBSCAN-SWA_67

850602 : 852573

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578395.1\|850602_852225_-	chaperonin GroEL	A0A240F779	uncultured_virus	4.6e-170	59.7
WP_029578394.1\|852255_852573_-	co-chaperone GroES	A0A221S322	uncultured_virus	6.0e-18	48.9

DBSCAN-SWA_68

860634 : 862597

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578378.1\|860634_860922_+	co-chaperone GroES	A0A221S4A8	uncultured_virus	9.0e-21	51.1
WP_029578377.1\|860956_862597_+	chaperonin GroEL	A0A219YK78	uncultured_virus	3.7e-167	60.0

DBSCAN-SWA_69

866325 : 870643

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955466.1\|866325_866883_-	CinA family protein	B5TK85	Pseudomonas_phage	9.9e-24	39.8
WP_032961480.1\|866879_867383_-	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_032955467.1\|867450_868419_-	thiamine-phosphate kinase	NA	NA	NA	NA
WP_032955468.1\|868426_868918_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_032955469.1\|868937_869459_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2I2L4Y7	Orpheovirus	5.3e-11	34.5
WP_029578367.1\|869455_870643_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	M4QPK3	Synechococcus_phage	2.4e-35	41.9

DBSCAN-SWA_70

876384 : 877837

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075263.1\|876384_877155_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	3.1e-15	27.8
WP_029578360.1\|877141_877837_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-09	25.2

DBSCAN-SWA_71

884569 : 885340

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578354.1\|884569_885340_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.3e-17	37.2

DBSCAN-SWA_72

890685 : 891523

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578348.1\|890685_891198_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.5e-29	43.9
WP_029578347.1\|891268_891523_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	3.3e-19	53.4

DBSCAN-SWA_73

896563 : 898642

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961137.1\|896563_898642_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	6.8e-09	30.9

DBSCAN-SWA_74

917629 : 918562

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075218.1\|917629_918562_-	ribose-phosphate pyrophosphokinase	A0A2K9L8D8	Tupanvirus	2.7e-42	36.0

DBSCAN-SWA_75

932784 : 934131

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955511.1\|932784_934131_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.4e-10	28.6

DBSCAN-SWA_76

937164 : 938550

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955515.1\|937164_938550_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.8e-53	32.4

DBSCAN-SWA_77

943518 : 948951

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961096.1\|943518_945429_-	asparagine synthase (glutamine-hydrolyzing)	A0A0N9QYX6	Chrysochromulina_ericina_virus	1.2e-20	24.3
WP_032955519.1\|945443_946568_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_029578298.1\|946568_947924_-	membrane protein	NA	NA	NA	NA
WP_029578297.1\|947925_948951_-	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	E3T4Y8	Cafeteria_roenbergensis_virus	1.4e-68	42.5

DBSCAN-SWA_78

953449 : 954909

Equid_gammaherpesvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578292.1\|953449_954421_+	thymidylate synthase	A0A0B4Q5G0	Equid_gammaherpesvirus	5.5e-54	38.3
WP_032954743.1\|954417_954909_+	dihydrofolate reductase	A0A0S2MU93	Bacillus_phage	2.9e-27	38.9

DBSCAN-SWA_79

964528 : 966181

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578283.1\|964528_966181_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.1e-06	31.8

DBSCAN-SWA_80

971467 : 974341

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963773.1\|971467_974341_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	3.7e-263	52.1

DBSCAN-SWA_81

980502 : 982284

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963766.1\|980502_982284_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	1.4e-10	30.3

DBSCAN-SWA_82

990463 : 991027

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578263.1\|990463_991027_-	dCTP deaminase	S5VM63	Pseudomonas_phage	4.4e-72	74.7

DBSCAN-SWA_83

998295 : 1000371

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963755.1\|998295_1000371_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	7.7e-29	23.4

DBSCAN-SWA_84

1006953 : 1010629

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963745.1\|1006953_1007877_-	arginase	A0A0N9R043	Chrysochromulina_ericina_virus	3.9e-25	37.0
WP_080700312.1\|1008088_1008514_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_029578249.1\|1008510_1009362_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_032958093.1\|1009573_1010629_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-28	34.1

DBSCAN-SWA_85

1023599 : 1025053

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963730.1\|1023599_1024343_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	2.9e-10	24.0
WP_029578233.1\|1024339_1025053_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.1e-06	23.4

DBSCAN-SWA_86

1029290 : 1030334

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578227.1\|1029290_1030334_+	ornithine cyclodeaminase	A0A1V0SL93	Klosneuvirus	8.5e-101	54.5

DBSCAN-SWA_87

1041192 : 1045720

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578216.1\|1041192_1041918_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-32	37.7
WP_029578215.1\|1042003_1042876_+	transcriptional regulator LrhA	NA	NA	NA	NA
WP_032963713.1\|1042912_1043722_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_051623340.1\|1043848_1045720_-	acyltransferase	B5WZU0	Pseudomonas_phage	4.3e-71	39.5

DBSCAN-SWA_88

1068690 : 1071181

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958170.1\|1068690_1069446_-	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	2.2e-21	33.5
WP_032958171.1\|1069623_1070583_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_032958173.1\|1070584_1071181_-	cupin domain-containing protein	Q786F1	Bacillus_phage	2.9e-05	41.9

DBSCAN-SWA_89

1111573 : 1114939

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984819.1\|1111573_1113589_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.3e-28	26.8
WP_024537140.1\|1114108_1114939_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	4.7e-46	71.3

DBSCAN-SWA_90

1139285 : 1149132

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984829.1\|1139285_1140992_-	site-specific DNA-methyltransferase	A0A220NUF4	Escherichia_phage	3.0e-95	46.2
WP_141984830.1\|1141002_1142799_-	AIPR family protein	D0UIM0	Aggregatibacter_phage	1.0e-45	30.1
WP_141984831.1\|1142798_1145168_-	S8 family serine peptidase	NA	NA	NA	NA
WP_141984832.1\|1145185_1146172_-	AAA family ATPase	Q677Q6	Lymphocystis_disease_virus	3.0e-15	29.3
WP_142177988.1\|1146252_1149132_-	DEAD/DEAH box helicase family protein	A0A2H4J643	uncultured_Caudovirales_phage	4.3e-211	42.1

DBSCAN-SWA_91

1173880 : 1174597

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142178024.1\|1173880_1174597_+	glutamine amidotransferase	A0A2K9L2L9	Tupanvirus	1.6e-05	32.7

DBSCAN-SWA_92

1196426 : 1202175

Pseudomonas_phage(50.0%)

integrase

attL 1191364:1191379|attR 1200100:1200115

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1191364:1191379	attL	NA	NA	NA	NA
WP_142178033.1\|1196426_1198352_-\|integrase	tyrosine-type recombinase/integrase	A0A0U1UNT3	Pseudomonas_phage	5.9e-100	48.3
WP_029578091.1\|1198760_1199720_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_051594432.1\|1199743_1201213_-	FAD-binding oxidoreductase	NA	NA	NA	NA
1200100:1200115	attR	NA	NA	NA	NA
WP_032963511.1\|1201209_1202175_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.4e-12	27.6

DBSCAN-SWA_93

1206093 : 1207116

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578084.1\|1206093_1207116_-	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	4.3e-25	26.5

DBSCAN-SWA_94

1212249 : 1215725

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578077.1\|1212249_1212696_+	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	3.0e-07	46.9
WP_032963499.1\|1212807_1213530_-	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_029578075.1\|1213526_1214420_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032963496.1\|1214642_1215725_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-31	36.8

DBSCAN-SWA_95

1221104 : 1223822

Sphingobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958372.1\|1221104_1221713_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.2e-06	29.1
WP_032963488.1\|1221727_1222348_+	glutathione S-transferase	NA	NA	NA	NA
WP_029578066.1\|1222387_1223095_-	ABC transporter ATP-binding protein	A0A2H4UU96	Bodo_saltans_virus	9.1e-06	25.7
WP_032963486.1\|1223099_1223822_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.1e-10	28.6

DBSCAN-SWA_96

1231669 : 1240072

Oenococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578056.1\|1231669_1232818_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.2e-58	37.2
WP_029578055.1\|1232844_1234146_+	MFS transporter	NA	NA	NA	NA
WP_032959715.1\|1234413_1236306_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	3.2e-122	38.5
WP_032958381.1\|1236498_1237890_+	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.5e-28	49.3
WP_141984543.1\|1238832_1240072_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.1e-131	78.8

DBSCAN-SWA_97

1243946 : 1244933

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964282.1\|1243946_1244933_+	D-2-hydroxyacid dehydrogenase	M1NSB9	Streptococcus_phage	1.7e-10	28.3

DBSCAN-SWA_98

1254121 : 1256713

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964274.1\|1254121_1256713_-	type II secretion system secretin GspD	G4WZN6	Enterobacteria_phage	9.9e-34	35.4

DBSCAN-SWA_99

1267265 : 1274363

Leptospira_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578011.1\|1267265_1268453_+	efflux RND transporter periplasmic adaptor subunit	S5VL44	Leptospira_phage	6.9e-06	22.9
WP_029578010.1\|1268478_1271664_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.8e-06	23.4
WP_032958410.1\|1271678_1273157_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_032958412.1\|1273208_1273739_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_029578007.1\|1273802_1274363_+	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	1.3e-15	32.2

DBSCAN-SWA_100

1279597 : 1282007

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578002.1\|1279597_1280140_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	3.9e-25	42.3
WP_029578001.1\|1280136_1281291_+	MFS transporter	NA	NA	NA	NA
WP_029578000.1\|1281287_1282007_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.3e-49	42.3

DBSCAN-SWA_101

1300691 : 1301768

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964197.1\|1300691_1301768_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	3.3e-07	40.7

DBSCAN-SWA_102

1307034 : 1309302

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594463.1\|1307034_1309302_+	hypothetical protein	A0A0S0N7S2	Pseudomonas_phage	5.2e-71	48.7

DBSCAN-SWA_103

1316762 : 1320814

Pandoravirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958446.1\|1316762_1317596_+	metallophosphoesterase	S4VP02	Pandoravirus	5.5e-18	27.1
WP_032964179.1\|1317592_1319071_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.0e-163	64.1
WP_029577971.1\|1319364_1320105_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.6e-15	24.8
WP_029577970.1\|1320106_1320814_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-16	25.5

DBSCAN-SWA_104

1340822 : 1345303

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594455.1\|1340822_1342682_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.7e-27	26.1
WP_032964167.1\|1342678_1345303_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	1.2e-82	31.1

DBSCAN-SWA_105

1354683 : 1355817

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032960412.1\|1354683_1355817_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	44.2

DBSCAN-SWA_106

1361846 : 1362830

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577932.1\|1361846_1362830_+	TerC family protein	K7QKE8	Escherichia_phage	1.9e-41	34.0

DBSCAN-SWA_107

1367351 : 1368803

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577927.1\|1367351_1368803_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-20	27.2

DBSCAN-SWA_108

1371828 : 1372086

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577923.1\|1371828_1372086_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	9.5e-14	46.2

DBSCAN-SWA_109

1405195 : 1406830

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594422.1\|1405195_1406830_+	FAD-binding protein	A0A1V0SI18	Klosneuvirus	2.4e-54	30.7

DBSCAN-SWA_110

1410813 : 1417761

Bacillus_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958499.1\|1410813_1411536_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-09	25.9
WP_029579777.1\|1411547_1412738_+	CoA transferase	NA	NA	NA	NA
WP_032958501.1\|1412748_1413672_+	hydroxymethylglutaryl-CoA lyase	E5EQ69	Micromonas_sp._RCC1109_virus	4.1e-06	35.7
WP_032958503.1\|1413774_1414362_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	8.9e-07	23.5
WP_032963181.1\|1414372_1414951_+	hypothetical protein	NA	NA	NA	NA
WP_029579781.1\|1414947_1415583_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_029579782.1\|1415589_1416216_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_029579783.1\|1416212_1417154_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-08	41.8
WP_029579784.1\|1417248_1417761_-	peptide deformylase	E3SLL2	Synechococcus_phage	6.5e-22	44.3

DBSCAN-SWA_111

1424427 : 1428044

Thermus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963205.1\|1424427_1425537_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.3e-27	41.3
WP_029579792.1\|1425613_1426522_+	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
WP_032963177.1\|1426553_1427024_+	membrane protein	NA	NA	NA	NA
WP_029579794.1\|1427027_1428044_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-74	43.2

DBSCAN-SWA_112

1437060 : 1445296

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958516.1\|1437060_1438983_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	4.5e-07	23.5
WP_029579805.1\|1439004_1439727_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.9e-15	27.1
WP_032963175.1\|1439757_1441476_-	acid phosphatase	NA	NA	NA	NA
WP_029579807.1\|1441660_1442359_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_029579808.1\|1442523_1444494_+	AMP-binding protein	A0A1V0SBX8	Catovirus	2.4e-35	23.1
WP_029579809.1\|1444495_1445296_+	ABC transporter ATP-binding protein	M1HRF1	Paramecium_bursaria_Chlorella_virus	1.9e-07	21.7

DBSCAN-SWA_113

1455749 : 1456940

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963202.1\|1455749_1456940_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	7.1e-104	59.5

DBSCAN-SWA_114

1461776 : 1462535

Feline_herpesvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579829.1\|1461776_1462535_+	uracil-DNA glycosylase	O37930	Feline_herpesvirus	1.0e-42	50.6

DBSCAN-SWA_115

1465744 : 1468950

Sinorhizobium_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579832.1\|1465744_1466836_-\|tRNA	tRNA CCA-pyrophosphorylase	A0A0F6YPT7	Sinorhizobium_phage	2.6e-52	48.7
WP_029579833.1\|1466832_1468950_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	3.2e-14	39.4

DBSCAN-SWA_116

1478201 : 1479623

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579845.1\|1478201_1479623_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	3.6e-38	28.8

DBSCAN-SWA_117

1486372 : 1492151

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579853.1\|1486372_1487536_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.3e-128	61.3
WP_029579854.1\|1487812_1488667_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_029579855.1\|1488663_1489557_+	lysophospholipid acyltransferase family protein	A0A1W6JP29	Morganella_phage	5.1e-30	29.6
WP_029579856.1\|1489581_1490478_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_029579857.1\|1490502_1491171_+	DUF484 family protein	NA	NA	NA	NA
WP_032979206.1\|1491179_1492151_+	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	4.4e-11	31.5

DBSCAN-SWA_118

1497641 : 1498391

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032959699.1\|1497641_1498391_-	metal ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-05	29.5

DBSCAN-SWA_119

1501842 : 1503177

Erwinia_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579868.1\|1501842_1503177_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	4.2e-44	29.0

DBSCAN-SWA_120

1507335 : 1511755

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579875.1\|1507335_1508607_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.2e-66	40.5
WP_029579876.1\|1508739_1509387_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_029579877.1\|1509419_1510010_-	hypothetical protein	NA	NA	NA	NA
WP_032979207.1\|1510014_1510941_-	MCE family protein	NA	NA	NA	NA
WP_032958605.1\|1510927_1511755_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.6e-22	32.9

DBSCAN-SWA_121

1517131 : 1520581

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579885.1\|1517131_1517704_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.4e-35	43.2
WP_029579886.1\|1517700_1518582_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	2.3e-99	63.0
WP_032979209.1\|1518578_1519478_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	8.0e-23	33.5
WP_032958609.1\|1519474_1520581_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.9e-85	46.1

DBSCAN-SWA_122

1527179 : 1533180

Catovirus(33.33%)

tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963148.1\|1527179_1528970_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	1.7e-08	23.6
WP_032958616.1\|1529010_1529646_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.3e-11	27.6
WP_029579897.1\|1529648_1529963_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_032958622.1\|1530135_1531416_-	membrane protein	NA	NA	NA	NA
WP_029579899.1\|1531557_1533180_-\|holin	choline dehydrogenase	A0A2I2L3D3	Orpheovirus	1.5e-24	26.8

DBSCAN-SWA_123

1540743 : 1542237

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963144.1\|1540743_1542237_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-14	27.9

DBSCAN-SWA_124

1551641 : 1552715

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579914.1\|1551641_1552715_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-25	31.0

DBSCAN-SWA_125

1558985 : 1565906

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963141.1\|1558985_1561724_-	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	8.5e-76	30.0
WP_029579920.1\|1562100_1563147_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_029579921.1\|1563155_1563725_+	N-acetyltransferase	NA	NA	NA	NA
WP_029579922.1\|1563732_1564827_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	1.9e-31	30.8
WP_029579923.1\|1564823_1565906_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	1.9e-47	34.4

DBSCAN-SWA_126

1569157 : 1582066

Moumouvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958639.1\|1569157_1571044_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	1.0e-24	27.2
WP_032963137.1\|1571054_1572275_-	glycosyltransferase	NA	NA	NA	NA
WP_029579928.1\|1572264_1573326_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_032963136.1\|1573419_1575297_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SHV8	Klosneuvirus	2.2e-22	28.7
WP_032963134.1\|1575902_1576841_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_032963132.1\|1576849_1577782_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	3.0e-17	26.4
WP_029579932.1\|1577796_1578852_+	NAD-dependent epimerase/dehydratase family protein	M1IDV7	Acanthocystis_turfacea_Chlorella_virus	2.7e-30	28.9
WP_029579933.1\|1578854_1579835_+	NAD-dependent epimerase/dehydratase family protein	M1NML0	Moumouvirus	8.6e-39	32.3
WP_032963130.1\|1579836_1580646_+	ABC transporter permease	NA	NA	NA	NA
WP_029579935.1\|1580623_1582066_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	7.0e-13	27.2

DBSCAN-SWA_127

1585610 : 1597206

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579938.1\|1585610_1587518_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SHV8	Klosneuvirus	1.2e-20	27.3
WP_032963128.1\|1587543_1589442_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	2.7e-28	26.7
WP_032963126.1\|1589525_1592147_+	glycosyltransferase	NA	NA	NA	NA
WP_032958648.1\|1592211_1592721_-	single-stranded DNA-binding protein	F8TUL2	EBPR_podovirus	5.3e-40	50.3
WP_032963124.1\|1592983_1594168_-	MFS transporter	NA	NA	NA	NA
WP_032963123.1\|1594347_1597206_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.7e-297	54.0

DBSCAN-SWA_128

1600398 : 1601481

Ostreococcus_mediterraneus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963121.1\|1600398_1601481_-	3-dehydroquinate synthase	A0A0P0C619	Ostreococcus_mediterraneus_virus	9.6e-23	35.5

DBSCAN-SWA_129

1625849 : 1626668

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594423.1\|1625849_1626668_-	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	S4VR59	Pandoravirus	1.0e-21	43.4

DBSCAN-SWA_130

1632869 : 1633601

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955620.1\|1632869_1633601_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-08	22.7

DBSCAN-SWA_131

1641228 : 1647748

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579994.1\|1641228_1642419_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	29.6
WP_029577155.1\|1642495_1644598_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	3.6e-58	26.1
WP_029577156.1\|1644616_1645087_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_005017264.1\|1645252_1645630_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_029577157.1\|1646060_1646774_-	response regulator transcription factor	NA	NA	NA	NA
WP_032957244.1\|1647049_1647748_+	response regulator transcription factor	A0A220YL79	Alteromonas_virus	5.8e-05	27.0

DBSCAN-SWA_132

1653120 : 1669758

Vibrio_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577162.1\|1653120_1657362_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	2.0e-68	24.9
WP_029577163.1\|1657361_1661474_-	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	7.4e-23	23.4
WP_029577164.1\|1661635_1662016_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_029577165.1\|1662100_1662625_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_029577166.1\|1662868_1663567_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_029577167.1\|1663569_1664001_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_029577168.1\|1664060_1664594_-	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	9.9e-13	31.2
WP_029577169.1\|1664602_1664983_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_029579994.1\|1665280_1666471_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	29.6
WP_029577879.1\|1666968_1667976_-	asparaginase	NA	NA	NA	NA
WP_029577880.1\|1667968_1668877_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	4.7e-15	36.5
WP_029577881.1\|1668963_1669758_-	ParA family protein	Q8JL10	Natrialba_phage	7.3e-20	34.3

DBSCAN-SWA_133

1673396 : 1673603

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577884.1\|1673396_1673603_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.2e-16	62.5

DBSCAN-SWA_134

1702635 : 1704647

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577184.1\|1702635_1703622_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.9e-07	30.1
WP_141984599.1\|1703621_1704647_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.1e-15	30.9

DBSCAN-SWA_135

1710648 : 1717205

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080666487.1\|1710648_1710936_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	3.7e-14	53.6
WP_032962136.1\|1710932_1711304_-	ribonuclease P protein component	NA	NA	NA	NA
WP_029577875.1\|1711426_1711561_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_029577874.1\|1712105_1713557_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_141984526.1\|1713553_1714669_+	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	2.3e-40	29.3
WP_029577872.1\|1714751_1717205_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	7.8e-113	34.8

DBSCAN-SWA_136

1726274 : 1728536

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577861.1\|1726274_1728536_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	3.9e-66	29.7

DBSCAN-SWA_137

1736508 : 1738038

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577852.1\|1736508_1738038_-	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	1.5e-05	26.3

DBSCAN-SWA_138

1742485 : 1743667

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577846.1\|1742485_1742980_+	nucleoside 2-deoxyribosyltransferase	A0A1G5S9Z4	Enterococcus_phage	3.7e-06	32.2
WP_029577845.1\|1742992_1743667_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.0e-34	41.5

DBSCAN-SWA_139

1747147 : 1748974

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962117.1\|1747147_1748974_+	biosynthetic-type acetolactate synthase large subunit	E4WLQ6	Ostreococcus_tauri_virus	9.4e-55	29.5

DBSCAN-SWA_140

1752953 : 1757510

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075158.1\|1752953_1753727_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	4.0e-15	29.0
WP_032978944.1\|1753723_1754770_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032978941.1\|1754888_1757510_-	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	8.0e-23	26.1

DBSCAN-SWA_141

1769958 : 1775132

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577825.1\|1769958_1771149_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.7e-18	25.3
WP_029577824.1\|1771205_1771451_+	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_032978919.1\|1771471_1773499_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_029577822.1\|1773524_1775132_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	2.1e-21	73.6

DBSCAN-SWA_142

1792378 : 1795402

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577805.1\|1792378_1793419_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-20	31.0
WP_029577804.1\|1793584_1794406_-	phosphodiesterase	NA	NA	NA	NA
WP_032978916.1\|1794415_1795402_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-23	32.1

DBSCAN-SWA_143

1808801 : 1816020

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577790.1\|1808801_1810409_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	1.2e-13	37.2
WP_032957635.1\|1810433_1811063_-	LysE family transporter	NA	NA	NA	NA
WP_126623693.1\|1811078_1812482_-	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	2.5e-39	29.3
WP_029577787.1\|1812797_1813403_+	LemA family protein	NA	NA	NA	NA
WP_032957640.1\|1813383_1814286_+	YgcG family protein	NA	NA	NA	NA
WP_032962854.1\|1814292_1816020_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.0e-10	28.7

DBSCAN-SWA_144

1819894 : 1821271

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962856.1\|1819894_1821271_-	GTPase/DUF3482 domain-containing protein	A0A0R6PFW5	Moraxella_phage	2.3e-53	35.7

DBSCAN-SWA_145

1826744 : 1827587

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962860.1\|1826744_1827587_-	hypothetical protein	S5M4R0	Bacillus_phage	1.0e-08	24.3

DBSCAN-SWA_146

1833428 : 1835378

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962862.1\|1833428_1834559_+\|protease	trypsin-like serine protease	A0A1B1IRD3	uncultured_Mediterranean_phage	5.2e-11	35.8
WP_095075159.1\|1834619_1835378_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.1e-28	33.7

DBSCAN-SWA_147

1845614 : 1850176

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962866.1\|1845614_1846424_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	7.2e-23	34.3
WP_029577749.1\|1846555_1847182_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029577748.1\|1847208_1847997_-	VacJ family lipoprotein	NA	NA	NA	NA
WP_029577747.1\|1848065_1848548_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_032962867.1\|1848560_1849343_-	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
WP_029577745.1\|1849339_1850176_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	3.3e-15	30.8

DBSCAN-SWA_148

1858846 : 1866998

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577740.1\|1858846_1859953_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	6.1e-33	28.5
WP_032962868.1\|1859963_1860803_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_032962869.1\|1860860_1861544_+	hypothetical protein	NA	NA	NA	NA
WP_029577737.1\|1861642_1862101_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_029577736.1\|1862230_1863118_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.1e-40	38.5
WP_032959877.1\|1863425_1864211_-	phosphodiesterase	NA	NA	NA	NA
WP_032962870.1\|1864430_1866998_+	cyclic nucleotide-binding domain-containing protein	A0A2H4J178	uncultured_Caudovirales_phage	6.2e-12	29.9

DBSCAN-SWA_149

1870467 : 1872069

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577730.1\|1870467_1872069_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	5.2e-09	39.1

DBSCAN-SWA_150

1879412 : 1889889

Saudi_moumouvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962875.1\|1879412_1880786_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A1S5V090	Saudi_moumouvirus	1.3e-27	34.6
WP_029577717.1\|1880782_1882177_+	MFS transporter	NA	NA	NA	NA
WP_032962876.1\|1882254_1883577_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.1e-76	38.3
WP_032957679.1\|1883573_1884629_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_032962877.1\|1884629_1885142_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_032962878.1\|1885287_1887120_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	4.5e-158	48.9
WP_032962879.1\|1887396_1889889_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-09	27.2

DBSCAN-SWA_151

1910037 : 1911538

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577691.1\|1910037_1910757_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.1e-09	26.6
WP_029577690.1\|1910743_1911538_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.9e-07	22.4

DBSCAN-SWA_152

1919261 : 1920678

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963036.1\|1919261_1919963_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-14	26.1
WP_032963037.1\|1919946_1920678_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	3.1e-09	23.6

DBSCAN-SWA_153

1942171 : 1944986

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_127814824.1\|1942171_1943155_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	7.6e-19	36.3
WP_029577658.1\|1943408_1943939_-	hypothetical protein	NA	NA	NA	NA
WP_029577657.1\|1943942_1944986_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.8e-17	52.7

DBSCAN-SWA_154

1955422 : 1956208

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963042.1\|1955422_1956208_-	heme ABC transporter ATP-binding protein	A0A2I4R674	Erysipelothrix_phage	2.2e-05	29.2

DBSCAN-SWA_155

1968595 : 1970026

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963048.1\|1968595_1970026_-	DUF1254 domain-containing protein	M1HIG9	Paramecium_bursaria_Chlorella_virus	2.2e-22	25.8

DBSCAN-SWA_156

1977344 : 1979273

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963050.1\|1977344_1979273_+	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	1.1e-16	30.3

DBSCAN-SWA_157

1984150 : 1989340

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957975.1\|1984150_1985185_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	2.5e-36	30.1
WP_029577620.1\|1985354_1986143_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-64	50.8
WP_029577619.1\|1986139_1987171_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.4e-71	42.9
WP_029577618.1\|1987187_1987751_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.8e-66	61.5
WP_029577617.1\|1987819_1989340_-	anthranilate synthase component I	S4VNU7	Pandoravirus	8.1e-44	33.3

DBSCAN-SWA_158

1995958 : 1996909

Escherichia_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957963.1\|1995958_1996909_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	8.2e-95	67.2

DBSCAN-SWA_159

2001103 : 2002597

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577604.1\|2001103_2002597_+	DUF1254 domain-containing protein	M1I2Z8	Paramecium_bursaria_Chlorella_virus	1.5e-42	30.1

DBSCAN-SWA_160

2015086 : 2020270

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963218.1\|2015086_2017147_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	7.5e-101	36.6
WP_029577591.1\|2017212_2018343_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_032963219.1\|2018351_2019257_-	hydrolase	NA	NA	NA	NA
WP_029577589.1\|2019259_2020270_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.4e-13	29.3

DBSCAN-SWA_161

2038825 : 2039347

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577572.1\|2038825_2039347_-	lipocalin family protein	A0A2K9L662	Tupanvirus	3.1e-19	33.8

DBSCAN-SWA_162

2052586 : 2053369

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963237.1\|2052586_2053369_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.4e-23	29.3

DBSCAN-SWA_163

2070606 : 2074983

Caulobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580011.1\|2070606_2071209_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	9.7e-17	35.4
WP_032957902.1\|2071234_2071672_-	YraN family protein	NA	NA	NA	NA
WP_029580012.1\|2071713_2072646_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_032957901.1\|2072642_2073200_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.3e-23	43.1
WP_032963248.1\|2073208_2074114_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	2.8e-15	46.1
WP_029580015.1\|2074110_2074983_-	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	1.7e-09	37.0

DBSCAN-SWA_164

2079404 : 2082082

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580021.1\|2079404_2080190_-	LPS export ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	8.8e-18	29.6
WP_029580022.1\|2080234_2080852_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_032963251.1\|2080848_2081472_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_029580024.1\|2081476_2082082_-	HAD hydrolase family protein	E3T535	Cafeteria_roenbergensis_virus	8.9e-10	26.8

DBSCAN-SWA_165

2088136 : 2092146

Organic_Lake_phycodnavirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580031.1\|2088136_2089879_+	thiol reductant ABC exporter subunit CydD	F2Y1V6	Organic_Lake_phycodnavirus	3.6e-11	30.4
WP_032958007.1\|2089875_2091531_+	thiol reductant ABC exporter subunit CydC	F2Y302	Organic_Lake_phycodnavirus	7.1e-17	26.6
WP_029580033.1\|2091597_2092146_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.4e-30	43.2

DBSCAN-SWA_166

2106580 : 2107780

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580046.1\|2106580_2107780_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.8e-92	43.8

DBSCAN-SWA_167

2113607 : 2115626

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957876.1\|2113607_2114915_-	phosphate regulon sensor histidine kinase PhoR	A0A1V0SGX0	Hokovirus	2.5e-17	25.5
WP_029580053.1\|2114927_2115626_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	1.0e-33	37.6

DBSCAN-SWA_168

2123782 : 2124502

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580063.1\|2123782_2124502_+	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	6.4e-07	28.9

DBSCAN-SWA_169

2131436 : 2147344

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963278.1\|2131436_2132588_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2K9L470	Tupanvirus	1.2e-79	43.2
WP_029580073.1\|2132667_2133309_+	hypothetical protein	NA	NA	NA	NA
WP_029580074.1\|2133305_2134859_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4QMK7	Micromonas_pusilla_virus	7.0e-35	32.4
WP_029580075.1\|2135042_2135930_+	ferritin	NA	NA	NA	NA
WP_029580076.1\|2135956_2136445_+	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	4.9e-19	38.1
WP_029580077.1\|2136457_2137789_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_029580078.1\|2137793_2138474_-	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.9e-14	34.7
WP_032963281.1\|2138550_2139393_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_029580080.1\|2139389_2140187_-	thiazole synthase	NA	NA	NA	NA
WP_095075232.1\|2140356_2141232_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029580082.1\|2141282_2143229_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	6.8e-11	35.4
WP_032957853.1\|2143567_2147344_+	methionine synthase	A0A140XBC7	Dickeya_phage	3.3e-09	49.2

DBSCAN-SWA_170

2162158 : 2167281

Pithovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580095.1\|2162158_2162830_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	2.1e-12	28.5
WP_029580096.1\|2163072_2164089_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.2e-72	42.7
WP_029580097.1\|2164195_2165386_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032957310.1\|2165387_2166488_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_029580099.1\|2166540_2167281_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-34	38.8

DBSCAN-SWA_171

2187193 : 2188153

Barns_Ness_breadcrumb_sponge_sobemo-like_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580116.1\|2187193_2188153_-	Nudix family hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	5.0e-07	38.2

DBSCAN-SWA_172

2196260 : 2197744

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979295.1\|2196260_2197046_+	ABC transporter ATP-binding protein	A0A2R8FFL6	Cedratvirus	5.7e-09	26.3
WP_032979296.1\|2197039_2197744_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-08	29.3

DBSCAN-SWA_173

2200987 : 2201800

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580130.1\|2200987_2201800_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.3e-19	35.8

DBSCAN-SWA_174

2235461 : 2243796

Pseudomonas_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580165.1\|2235461_2236589_+	cytochrome c552	A0A125RNP0	Pseudomonas_phage	2.3e-27	31.9
WP_032963327.1\|2236600_2238031_+	D-alanine--poly(phosphoribitol) ligase	A0A2K9L3I8	Tupanvirus	1.0e-27	28.1
WP_029580167.1\|2238073_2238628_-	YggT family protein	NA	NA	NA	NA
WP_032956587.1\|2238785_2239358_-	histone	NA	NA	NA	NA
WP_029580169.1\|2239653_2240847_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	1.9e-32	28.0
WP_032963329.1\|2240868_2243796_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	1.8e-172	44.2

DBSCAN-SWA_175

2254187 : 2255638

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963339.1\|2254187_2254892_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	24.5
WP_029580178.1\|2254888_2255638_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.0e-12	27.9

DBSCAN-SWA_176

2259558 : 2261115

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956575.1\|2259558_2261115_-	benzoate-CoA ligase family protein	A0A2H4PQU7	Staphylococcus_phage	4.9e-52	36.0

DBSCAN-SWA_177

2277555 : 2288444

Lake_Baikal_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580200.1\|2277555_2277927_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	5.6e-31	58.3
WP_029580201.1\|2277990_2279118_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_029580202.1\|2279125_2280541_-	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	2.3e-16	42.7
WP_029580203.1\|2280817_2282047_+\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_029580204.1\|2282085_2282742_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_032956558.1\|2282946_2284197_+	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	3.1e-97	52.3
WP_029580206.1\|2284456_2284942_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_032956557.1\|2284946_2285909_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_029580208.1\|2285908_2286469_-	isochorismatase family protein	NA	NA	NA	NA
WP_032956598.1\|2286666_2287782_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.4e-39	33.5
WP_029580210.1\|2287802_2288444_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.0e-27	37.6

DBSCAN-SWA_178

2297825 : 2300710

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580218.1\|2297825_2298722_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.8e-14	27.3
WP_029580219.1\|2299183_2300710_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	2.3e-54	31.2

DBSCAN-SWA_179

2316186 : 2317848

IC4_retrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940354.1\|2316186_2317848_-	bifunctional protein-serine/threonine kinase/phosphatase	Q67624	IC4_retrovirus	9.0e-12	32.6

DBSCAN-SWA_180

2327352 : 2327694

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051350509.1\|2327352_2327694_-	helix-turn-helix transcriptional regulator	H2BD63	Pseudomonas_phage	1.7e-05	40.0

DBSCAN-SWA_181

2333799 : 2346539

Bacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580253.1\|2333799_2335218_-	LysM peptidoglycan-binding domain-containing protein	A0A223LD43	Bacillus_phage	8.2e-06	27.5
WP_032963393.1\|2335225_2336035_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_032963396.1\|2336052_2336817_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_029580256.1\|2336886_2337348_+	ribonuclease HI	J9Q745	Salmonella_phage	7.6e-38	51.5
WP_032963398.1\|2337476_2338550_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_032963399.1\|2338565_2341631_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-76	23.2
WP_029580259.1\|2341638_2342373_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	4.5e-40	42.1
WP_032963400.1\|2342834_2343821_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_029580261.1\|2343824_2346539_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	8.6e-20	30.2

DBSCAN-SWA_182

2349949 : 2354747

Shigella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963404.1\|2349949_2350996_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.6e-59	40.4
WP_032963407.1\|2350992_2352582_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_080700437.1\|2352517_2353027_-	GtrA family protein	NA	NA	NA	NA
WP_051621623.1\|2352952_2353861_+	ChbG/HpnK family deacetylase	NA	NA	NA	NA
WP_032963409.1\|2353850_2354747_-	alpha/beta fold hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	2.4e-11	31.8

DBSCAN-SWA_183

2359154 : 2361269

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580275.1\|2359154_2361269_+	elongation factor G	E4ZFJ7	Streptococcus_phage	3.3e-59	27.4

DBSCAN-SWA_184

2369735 : 2371466

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032963420.1\|2369735_2371466_-\|tRNA	proline--tRNA ligase	A0A2K9L0T2	Tupanvirus	1.3e-10	31.7

DBSCAN-SWA_185

2401461 : 2403270

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964679.1\|2401461_2403270_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.6e-46	28.4

DBSCAN-SWA_186

2423146 : 2424127

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578507.1\|2423146_2424127_+	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	7.6e-27	35.6

DBSCAN-SWA_187

2437225 : 2438926

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979172.1\|2437225_2438926_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	1.1e-33	29.1

DBSCAN-SWA_188

2444422 : 2445511

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578525.1\|2444422_2445511_+	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	6.5e-11	25.9

DBSCAN-SWA_189

2456830 : 2464766

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700957.1\|2456830_2458051_+	FkbM family methyltransferase	A0A1V0SJF4	Klosneuvirus	7.8e-13	30.4
WP_142178055.1\|2458095_2460645_+	glycosyltransferase	NA	NA	NA	NA
WP_032979163.1\|2460716_2461838_+	GDP-mannose 4,6-dehydratase	M1HF79	Acanthocystis_turfacea_Chlorella_virus	3.5e-129	63.0
WP_080700955.1\|2461840_2462815_+	GDP-L-fucose synthase	M4R1H4	Synechococcus_phage	1.1e-89	52.7
WP_080700954.1\|2462835_2463297_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_080700953.1\|2463320_2464766_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.5e-42	27.7

DBSCAN-SWA_190

2469413 : 2471619

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979160.1\|2469413_2470265_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.1e-49	42.5
WP_032964603.1\|2470278_2471619_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	1.9e-44	31.1

DBSCAN-SWA_191

2488573 : 2490870

Pseudomonas_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984541.1\|2488573_2489104_+	hypothetical protein	A0A0S0N7I7	Pseudomonas_phage	7.4e-37	50.3
WP_141984542.1\|2489153_2489543_-	hypothetical protein	NA	NA	NA	NA
WP_141984543.1\|2489629_2490870_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.1e-131	78.8

DBSCAN-SWA_192

2495370 : 2496120

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581576.1\|2495370_2496120_+	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	8.4e-10	24.4

DBSCAN-SWA_193

2517809 : 2518952

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581555.1\|2517809_2518952_-	glycerate kinase	W6LM47	Streptococcus_phage	2.1e-36	38.0

DBSCAN-SWA_194

2524103 : 2524637

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581551.1\|2524103_2524637_-	peptide deformylase	E3SLL2	Synechococcus_phage	1.7e-12	34.8

DBSCAN-SWA_195

2543889 : 2550799

uncultured_Mediterranean_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581532.1\|2543889_2545242_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	8.9e-26	36.3
WP_032963912.1\|2545241_2545940_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_029581530.1\|2545936_2546632_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_032959520.1\|2546880_2547930_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	4.5e-70	45.4
WP_141984545.1\|2547980_2548931_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_032963916.1\|2548933_2550799_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.9e-83	34.5

DBSCAN-SWA_196

2562138 : 2563521

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581524.1\|2562138_2563521_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.5e-17	30.5

DBSCAN-SWA_197

2572363 : 2577276

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700550.1\|2572363_2576431_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	3.2e-10	35.8
WP_029581516.1\|2576427_2577276_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	3.9e-11	42.5

DBSCAN-SWA_198

2581874 : 2585020

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581510.1\|2581874_2583056_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	6.2e-15	56.6
WP_032963933.1\|2583052_2585020_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	5.8e-34	40.1

DBSCAN-SWA_199

2591361 : 2598261

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962896.1\|2591361_2592492_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	1.2e-36	40.0
WP_032962897.1\|2592498_2598261_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.4e-199	40.1

DBSCAN-SWA_200

2606275 : 2608678

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962901.1\|2606275_2607898_+	AMP-binding protein	A0A1V0SBX8	Catovirus	4.8e-18	22.6
WP_029581492.1\|2607919_2608678_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	6.7e-15	27.5

DBSCAN-SWA_201

2613855 : 2614362

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962903.1\|2613855_2614362_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.3e-32	49.0

DBSCAN-SWA_202

2628469 : 2629258

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581472.1\|2628469_2629258_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-13	24.7

DBSCAN-SWA_203

2644172 : 2652943

Leptospira_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581463.1\|2644172_2647268_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.0e-56	22.2
WP_029581462.1\|2647280_2648684_+	TolC family protein	NA	NA	NA	NA
WP_029581461.1\|2648699_2649359_+	transcriptional regulator	NA	NA	NA	NA
WP_029581460.1\|2649473_2650763_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	5.9e-19	28.4
WP_032979094.1\|2650774_2652943_-	cation-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.4e-51	26.9

DBSCAN-SWA_204

2680331 : 2684310

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979077.1\|2680331_2681090_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-14	28.9
WP_032962932.1\|2681079_2681808_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-09	24.5
WP_141984603.1\|2682095_2683451_-	NtaA/DmoA family FMN-dependent monooxygenase	NA	NA	NA	NA
WP_029581428.1\|2683461_2684310_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-27	33.3

DBSCAN-SWA_205

2698162 : 2702271

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962937.1\|2698162_2699539_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.0e-34	27.2
WP_029581413.1\|2699579_2700752_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_032962938.1\|2700765_2702271_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.9e-33	28.8

DBSCAN-SWA_206

2706293 : 2707756

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581407.1\|2706293_2707046_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.7e-05	29.1
WP_032955764.1\|2707042_2707756_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.1e-14	24.9

DBSCAN-SWA_207

2754037 : 2755042

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940294.1\|2754037_2755042_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.7e-16	28.0

DBSCAN-SWA_208

2773959 : 2775573

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700477.1\|2773959_2775573_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-08	28.2

DBSCAN-SWA_209

2778865 : 2780686

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700976.1\|2778865_2780686_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-27	27.9

DBSCAN-SWA_210

2804361 : 2806662

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955428.1\|2804361_2805636_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.3e-122	55.6
WP_029581319.1\|2805786_2806662_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.7e-09	26.1

DBSCAN-SWA_211

2824624 : 2825308

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581305.1\|2824624_2825308_+	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	2.7e-15	26.9

DBSCAN-SWA_212

2879867 : 2880410

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581256.1\|2879867_2880410_+	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	1.7e-12	32.5

DBSCAN-SWA_213

2905720 : 2907463

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964111.1\|2905720_2907463_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	6.1e-19	22.9

DBSCAN-SWA_214

2911855 : 2921942

Streptococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964105.1\|2911855_2913115_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.3e-95	45.9
WP_029578907.1\|2913144_2914185_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_032955283.1\|2914184_2914862_-	lipoprotein	NA	NA	NA	NA
WP_029578905.1\|2914873_2917531_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.9e-173	39.1
WP_029578904.1\|2917603_2918764_-	MFS transporter	NA	NA	NA	NA
WP_032955268.1\|2918796_2919309_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_029578902.1\|2919425_2919872_-	DNA-binding protein	NA	NA	NA	NA
WP_029578901.1\|2920172_2921942_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	5.1e-13	22.8

DBSCAN-SWA_215

2929173 : 2936715

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578894.1\|2929173_2930403_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-28	37.1
WP_029578893.1\|2930480_2930855_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_029578892.1\|2930903_2932085_+	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_032955272.1\|2932143_2932767_-	toxin	NA	NA	NA	NA
WP_029578890.1\|2932778_2933225_-	hypothetical protein	NA	NA	NA	NA
WP_029578889.1\|2933312_2933942_-	TIGR00730 family Rossman fold protein	A0A1D8KU27	Synechococcus_phage	2.3e-16	36.1
WP_032955274.1\|2933994_2936715_+	DNA polymerase I	A0A218MKQ4	uncultured_virus	1.6e-71	30.6

DBSCAN-SWA_216

2944794 : 2945466

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964097.1\|2944794_2945466_-	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	2.9e-09	29.8

DBSCAN-SWA_217

2957370 : 2962849

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578873.1\|2957370_2957697_-	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	3.6e-18	44.1
WP_048940262.1\|2957920_2959933_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.1e-93	35.8
WP_032964089.1\|2959932_2960520_+	YcxB family protein	NA	NA	NA	NA
WP_032964087.1\|2960533_2962849_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.1e-79	31.6

DBSCAN-SWA_218

2988880 : 2991502

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578845.1\|2988880_2991502_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.6e-84	39.2

DBSCAN-SWA_219

2994759 : 2998380

Klosneuvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955352.1\|2994759_2997639_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.1e-137	37.7
WP_029578838.1\|2997954_2998380_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	4.9e-23	43.6

DBSCAN-SWA_220

3012173 : 3019613

Pithovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075177.1\|3012173_3013481_+	adenylosuccinate synthase	W5S5V7	Pithovirus	8.8e-63	33.0
WP_029578824.1\|3013603_3014143_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_006218592.1\|3014432_3014645_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_032964067.1\|3014662_3016711_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.5e-66	42.9
WP_029578822.1\|3017348_3019613_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.4e-36	30.8

DBSCAN-SWA_221

3024067 : 3024832

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700562.1\|3024067_3024832_-	LexA family transcriptional regulator	A0A0U2QW76	Escherichia_phage	2.2e-05	40.0

DBSCAN-SWA_222

3030461 : 3043832

Yersinia_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940256.1\|3030461_3031373_-	prohibitin family protein	A0A2C9CWL5	Yersinia_phage	8.9e-46	54.7
WP_032955363.1\|3031753_3032380_-	LysE family translocator	NA	NA	NA	NA
WP_029578809.1\|3032449_3033682_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_029578808.1\|3034255_3035875_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-10	56.2
WP_029578807.1\|3035880_3036384_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_032964045.1\|3036380_3036593_+	hypothetical protein	NA	NA	NA	NA
WP_141984543.1\|3036623_3037863_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.1e-131	78.8
WP_080700563.1\|3037900_3038926_+	hypothetical protein	NA	NA	NA	NA
WP_029578805.1\|3038918_3039545_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_032964021.1\|3039541_3041770_+	hybrid sensor histidine kinase/response regulator	Q56AR1	Bacillus_thuringiensis_phage	3.2e-12	27.0
WP_032964020.1\|3041766_3042798_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_032964018.1\|3042809_3043832_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.0e-18	39.1

DBSCAN-SWA_223

3083323 : 3084058

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003813882.1\|3083323_3084058_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	1.3e-34	36.3

DBSCAN-SWA_224

3092560 : 3095425

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578756.1\|3092560_3094645_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.5e-152	45.4
WP_029578755.1\|3094654_3095425_-	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.9e-14	34.3

DBSCAN-SWA_225

3100903 : 3101581

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578747.1\|3100903_3101581_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-11	31.5

DBSCAN-SWA_226

3105354 : 3107190

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051621470.1\|3105354_3107190_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	2.0e-12	28.6

DBSCAN-SWA_227

3114610 : 3116091

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578735.1\|3114610_3115321_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.0e-05	26.3
WP_029578734.1\|3115317_3116091_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-14	23.3

DBSCAN-SWA_228

3120326 : 3121502

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957276.1\|3120326_3121502_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	9.4e-48	32.5

DBSCAN-SWA_229

3125726 : 3127040

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578723.1\|3125726_3127040_-	MFS transporter	Q6JIH2	Burkholderia_virus	6.5e-82	40.2

DBSCAN-SWA_230

3139210 : 3139990

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578712.1\|3139210_3139990_-	N-acetylmuramoyl-L-alanine amidase	A0A223VZK2	Agrobacterium_phage	4.2e-12	32.0

DBSCAN-SWA_231

3145544 : 3155843

Trichoplusia_ni_ascovirus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578704.1\|3145544_3146297_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.6e-16	34.0
WP_003813816.1\|3146513_3146753_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	5.4e-11	46.6
WP_029578703.1\|3146925_3148155_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_080666534.1\|3148157_3148586_+	hypothetical protein	NA	NA	NA	NA
WP_005012194.1\|3148582_3149182_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	2.6e-06	26.9
WP_029578702.1\|3149194_3149680_+	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_029578701.1\|3149679_3150711_+	siderophore-interacting protein	NA	NA	NA	NA
WP_032963963.1\|3150751_3152236_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.9e-21	29.6
WP_032963961.1\|3152380_3154174_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.7e-22	23.5
WP_029578698.1\|3154197_3155082_+	signal peptidase I	NA	NA	NA	NA
WP_095075180.1\|3155078_3155843_+	ribonuclease III	M4QNJ2	Ostreococcus_lucimarinus_virus	1.2e-19	33.5

DBSCAN-SWA_232

3158905 : 3160420

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957222.1\|3158905_3160420_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.5e-53	38.6

DBSCAN-SWA_233

3167219 : 3173865

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578684.1\|3167219_3167885_-	C40 family peptidase	A0A0A8WF62	Clostridium_phage	1.8e-16	35.3
WP_080700566.1\|3168092_3170018_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.2e-62	30.9
WP_029578682.1\|3170017_3170425_+	hypothetical protein	NA	NA	NA	NA
WP_032957228.1\|3170508_3171735_+	MFS transporter	NA	NA	NA	NA
WP_095075181.1\|3171822_3173865_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.4e-83	44.3

DBSCAN-SWA_234

3182930 : 3184817

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578670.1\|3182930_3184817_+	dipeptide ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.9e-06	39.1

DBSCAN-SWA_235

3190344 : 3201126

Acinetobacter_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578664.1\|3190344_3192141_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	3.8e-165	49.3
WP_029578663.1\|3192379_3194032_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.5e-157	53.5
WP_029578662.1\|3194191_3194476_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_029578661.1\|3194479_3195766_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.4e-150	63.8
WP_029578660.1\|3195840_3196212_+	cell division protein FtsB	NA	NA	NA	NA
WP_029578659.1\|3196223_3196880_-	hypothetical protein	NA	NA	NA	NA
WP_032957198.1\|3196934_3197855_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_029578657.1\|3197893_3198415_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_029578656.1\|3198438_3200103_-	AMP-binding protein	A0A2K9L3I8	Tupanvirus	5.4e-17	22.9
WP_032957195.1\|3200286_3201126_-	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	4.9e-67	47.7

DBSCAN-SWA_236

3211335 : 3213114

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578643.1\|3211335_3213114_+	succinate dehydrogenase flavoprotein subunit	A0A2P0ZL82	Lactobacillus_phage	2.3e-05	24.3

DBSCAN-SWA_237

3216580 : 3217657

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578638.1\|3216580_3217657_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.1e-30	35.8

DBSCAN-SWA_238

3224518 : 3225202

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578630.1\|3224518_3225202_-	Fe2+-dependent dioxygenase	A0A1D8KSK5	Synechococcus_phage	3.6e-15	41.0

DBSCAN-SWA_239

3239519 : 3240947

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578623.1\|3239519_3240947_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.9e-43	28.9

DBSCAN-SWA_240

3248465 : 3250511

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962568.1\|3248465_3250511_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	2.7e-74	29.6

DBSCAN-SWA_241

3268975 : 3277451

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029578595.1\|3268975_3269506_-	cytochrome b	A0A0U2QLA7	Escherichia_phage	1.8e-11	43.3
WP_032955825.1\|3269652_3272226_-	cyanophycin synthetase	S4VXG8	Pandoravirus	4.3e-05	26.6
WP_141984605.1\|3272296_3274945_-	cyanophycin synthetase	NA	NA	NA	NA
WP_029578592.1\|3275174_3277451_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-57	31.1

DBSCAN-SWA_242

3281683 : 3286148

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964328.1\|3281683_3282523_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.3e-55	43.3
WP_032955821.1\|3282903_3284466_+	diguanylate cyclase	NA	NA	NA	NA
WP_029578584.1\|3284537_3286148_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.9e-11	33.3

DBSCAN-SWA_243

3298027 : 3304025

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955098.1\|3298027_3300667_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	7.9e-103	32.6
WP_029577247.1\|3300674_3301805_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	5.4e-77	44.0
WP_032964336.1\|3301797_3302883_+	prephenate dehydratase	NA	NA	NA	NA
WP_032964338.1\|3302903_3304025_+	histidinol-phosphate transaminase	A0A0H3TLT9	Faustovirus	1.9e-13	24.6

DBSCAN-SWA_244

3310945 : 3316443

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051350494.1\|3310945_3311887_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	M4QF80	Synechococcus_phage	1.2e-13	30.2
WP_032964348.1\|3311883_3312873_+	ADP-glyceromanno-heptose 6-epimerase	E3SJ87	Synechococcus_phage	9.0e-28	31.1
WP_029577257.1\|3312988_3313342_+	hypothetical protein	NA	NA	NA	NA
WP_032955093.1\|3313403_3314315_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.9e-49	40.7
WP_032964356.1\|3314369_3315509_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_032955110.1\|3315528_3316443_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.5e-42	34.7

DBSCAN-SWA_245

3325733 : 3329763

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577269.1\|3325733_3326798_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.3e-27	32.2
WP_032964366.1\|3326794_3327523_+	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_029577271.1\|3327536_3328445_+	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
WP_029577272.1\|3328458_3329763_+	sulfate adenylyltransferase	A0A1V0SGC3	Hokovirus	6.1e-32	29.1

DBSCAN-SWA_246

3337271 : 3337817

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955086.1\|3337271_3337817_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	4.2e-27	38.4

DBSCAN-SWA_247

3344589 : 3345678

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964377.1\|3344589_3345678_+	phenylacetate-CoA oxygenase/reductase subunit PaaK	V5UTY8	Synechococcus_phage	9.0e-13	44.9

DBSCAN-SWA_248

3350457 : 3353161

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577297.1\|3350457_3351687_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	4.7e-135	58.4
WP_029577298.1\|3351710_3352403_-	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	2.3e-17	28.6
WP_029577299.1\|3352417_3353161_-	urea ABC transporter ATP-binding protein UrtD	A0A2H4PQG7	Staphylococcus_phage	3.5e-16	26.5

DBSCAN-SWA_249

3356723 : 3361002

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964381.1\|3356723_3360119_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-29	27.9
WP_029577304.1\|3360087_3361002_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-14	33.3

DBSCAN-SWA_250

3372492 : 3373620

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577316.1\|3372492_3373620_+	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.4e-24	35.7

DBSCAN-SWA_251

3383784 : 3392236

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955077.1\|3383784_3387675_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	9.6e-49	28.9
WP_029577329.1\|3387705_3388605_-	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	1.0e-33	36.3
WP_029577330.1\|3388744_3392236_+	DNA polymerase III subunit alpha	A0A1C9LWS4	Streptomyces_phage	2.9e-185	37.3

DBSCAN-SWA_252

3400058 : 3404928

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984560.1\|3400058_3401834_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	4.0e-50	29.3
WP_080700227.1\|3402134_3403892_+	hypothetical protein	NA	NA	NA	NA
WP_080700554.1\|3403725_3404928_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	2.3e-49	31.8

DBSCAN-SWA_253

3414162 : 3415182

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579745.1\|3414162_3415182_-	histone deacetylase family protein	A0A2K9L473	Tupanvirus	8.4e-29	35.9

DBSCAN-SWA_254

3418417 : 3419068

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964481.1\|3418417_3419068_+	HD domain-containing protein	S4W232	Pandoravirus	9.5e-10	32.1

DBSCAN-SWA_255

3432918 : 3434433

Klebsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964492.1\|3432918_3434433_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	1.6e-79	45.6

DBSCAN-SWA_256

3440836 : 3445173

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579720.1\|3440836_3441901_-	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	2.5e-44	36.8
WP_029579719.1\|3441921_3442212_-	cupin	NA	NA	NA	NA
WP_029579718.1\|3442230_3443523_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	6.9e-28	28.2
WP_032964498.1\|3443532_3445173_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-16	29.6

DBSCAN-SWA_257

3449059 : 3450604

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964500.1\|3449059_3450604_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.1e-14	25.7

DBSCAN-SWA_258

3462555 : 3465569

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579701.1\|3462555_3463122_-	HD domain-containing protein	A0A2K9L141	Tupanvirus	4.5e-16	32.1
WP_029579700.1\|3463272_3464424_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_029579699.1\|3464564_3465569_-	acyltransferase family protein	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	5.2e-15	24.9

DBSCAN-SWA_259

3474564 : 3479804

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579687.1\|3474564_3475938_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.1e-132	57.7
WP_029579686.1\|3475998_3476958_-	bile acid:sodium symporter	NA	NA	NA	NA
WP_029579685.1\|3477045_3478023_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_029579684.1\|3478151_3479804_-	PhoH family protein	A0A1L2CUJ9	Pectobacterium_phage	1.1e-70	33.9

DBSCAN-SWA_260

3485369 : 3489106

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579677.1\|3485369_3486389_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	2.5e-49	36.1
WP_029579676.1\|3486397_3489106_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	4.7e-18	24.1

DBSCAN-SWA_261

3492595 : 3493669

Edwardsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579672.1\|3492595_3493669_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	5.1e-77	47.3

DBSCAN-SWA_262

3504305 : 3509451

Burkholderia_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579662.1\|3504305_3505226_+	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	1.4e-27	31.2
WP_029579661.1\|3505234_3506347_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_029579660.1\|3506434_3507256_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_029579659.1\|3507320_3507929_-	glutathione S-transferase	NA	NA	NA	NA
WP_029579658.1\|3508074_3509451_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	9.4e-108	46.6

DBSCAN-SWA_263

3516689 : 3517847

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126623591.1\|3516689_3517847_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.9e-14	30.3

DBSCAN-SWA_264

3527515 : 3528799

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579639.1\|3527515_3528799_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	8.7e-156	68.8

DBSCAN-SWA_265

3531882 : 3537102

Lactococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126623590.1\|3531882_3534357_+	ribonuclease R	Q0GXV6	Lactococcus_phage	6.1e-65	32.4
WP_029579634.1\|3534466_3535207_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_029579633.1\|3535258_3536503_+	cystathionine gamma-synthase family protein	A0A0B5JD48	Pandoravirus	2.2e-10	28.0
WP_005012769.1\|3536829_3537102_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	4.2e-20	56.2

DBSCAN-SWA_266

3540565 : 3550082

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579628.1\|3540565_3541687_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.6e-15	28.9
WP_032959497.1\|3541706_3543551_+	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	2.6e-68	31.4
WP_029579626.1\|3543755_3544943_+	FkbM family methyltransferase	NA	NA	NA	NA
WP_029579625.1\|3545010_3546348_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	5.6e-57	83.3
WP_032956815.1\|3546445_3547387_-	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	9.9e-16	25.2
WP_029579623.1\|3547442_3548624_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.4e-22	28.0
WP_029579622.1\|3548782_3549073_+	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_029579621.1\|3549128_3550082_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	5.9e-16	26.6

DBSCAN-SWA_267

3569539 : 3570898

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579600.1\|3569539_3570898_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.9e-31	34.3

DBSCAN-SWA_268

3574496 : 3575862

Synechococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579596.1\|3574496_3574946_-	DUF192 domain-containing protein	A0A222YVT9	Synechococcus_phage	8.9e-15	45.6
WP_012249572.1\|3575079_3575325_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.9e-20	75.0
WP_029579595.1\|3575547_3575862_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	6.4e-12	45.1

DBSCAN-SWA_269

3583357 : 3585667

Agrobacterium_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579592.1\|3583357_3585667_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.0e-164	41.7

DBSCAN-SWA_270

3596767 : 3601603

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579584.1\|3596767_3597574_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-13	23.9
WP_029579583.1\|3597570_3598296_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_029579582.1\|3598292_3599588_-	MFS transporter	NA	NA	NA	NA
WP_029579581.1\|3599671_3600277_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_029579580.1\|3600364_3601603_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	3.4e-32	30.2

DBSCAN-SWA_271

3605457 : 3616725

Bodo_saltans_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579576.1\|3605457_3606480_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
WP_142178068.1\|3606492_3608910_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_029579574.1\|3608912_3609263_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.3e-13	43.3
WP_029579573.1\|3609320_3609719_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_080700993.1\|3609898_3611062_-	hypothetical protein	NA	NA	NA	NA
WP_095075187.1\|3611623_3611779_+	hypothetical protein	NA	NA	NA	NA
WP_029579571.1\|3612114_3612861_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	2.5e-22	33.7
WP_032979592.1\|3612929_3614891_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	8.1e-28	29.7
WP_029579569.1\|3615011_3615518_+	N-acetyltransferase	NA	NA	NA	NA
WP_029579568.1\|3615530_3615773_-	hypothetical protein	NA	NA	NA	NA
WP_029579567.1\|3615901_3616180_-	hypothetical protein	NA	NA	NA	NA
WP_029579566.1\|3616272_3616725_+	low affinity iron permease family protein	A0A1C9EHA1	Mycobacterium_phage	2.2e-05	39.5

DBSCAN-SWA_272

3622177 : 3628140

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979595.1\|3622177_3623977_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	7.4e-44	27.6
WP_080700994.1\|3624125_3624929_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	4.4e-65	47.4
WP_029579553.1\|3624932_3625919_+	aldo/keto reductase	NA	NA	NA	NA
WP_032961629.1\|3625940_3626135_-	hypothetical protein	NA	NA	NA	NA
WP_029579551.1\|3626131_3627307_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_095075188.1\|3627411_3628140_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-59	50.0

DBSCAN-SWA_273

3635039 : 3635501

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579544.1\|3635039_3635501_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.1e-17	44.1

DBSCAN-SWA_274

3657356 : 3663352

Bacillus_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579522.1\|3657356_3658106_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-30	33.5
WP_032979600.1\|3658120_3658993_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_032955635.1\|3659009_3659894_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_080700158.1\|3660094_3660868_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_032979601.1\|3661024_3663352_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.9e-125	43.4

DBSCAN-SWA_275

3667603 : 3669238

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979602.1\|3667603_3669238_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	6.4e-87	36.6

DBSCAN-SWA_276

3679187 : 3681050

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579504.1\|3679187_3681050_+	dipeptide ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.7e-07	23.1

DBSCAN-SWA_277

3696485 : 3697340

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955787.1\|3696485_3697340_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	4.4e-31	38.6

DBSCAN-SWA_278

3704579 : 3706346

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961671.1\|3704579_3706346_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.5e-38	25.2

DBSCAN-SWA_279

3715415 : 3724877

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029579476.1\|3715415_3715796_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.0e-08	31.9
WP_032961675.1\|3715849_3717904_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_029579474.1\|3717917_3718421_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_141984565.1\|3718475_3720152_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.1e-12	40.0
WP_095075189.1\|3720171_3721005_+	chemotaxis protein CheR	NA	NA	NA	NA
WP_029577896.1\|3721004_3722054_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_029577897.1\|3722096_3722486_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	7.0e-08	31.7
WP_029577898.1\|3722494_3723124_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_051594391.1\|3723314_3724877_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-09	32.6

DBSCAN-SWA_280

3738831 : 3739806

Sulfitobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962762.1\|3738831_3739806_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.2e-11	30.6

DBSCAN-SWA_281

3742870 : 3750747

uncultured_Caudovirales_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141984567.1\|3742870_3744700_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.9e-11	29.0
WP_141984568.1\|3744809_3746606_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.4e-12	31.8
WP_032964588.1\|3746677_3747112_+	hypothetical protein	NA	NA	NA	NA
WP_141984569.1\|3747229_3748963_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-14	40.6
WP_051594338.1\|3749112_3750747_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	4.6e-37	43.9

DBSCAN-SWA_282

3774681 : 3776202

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581212.1\|3774681_3776202_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.0e-96	43.9

DBSCAN-SWA_283

3784949 : 3785708

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581203.1\|3784949_3785708_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.1e-16	33.1

DBSCAN-SWA_284

3795968 : 3804403

Emiliania_huxleyi_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581193.1\|3795968_3796577_+	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	3.0e-26	41.5
WP_032956766.1\|3796573_3797353_+	RNA methyltransferase	NA	NA	NA	NA
WP_029581191.1\|3797424_3797820_+	hypothetical protein	NA	NA	NA	NA
WP_029581190.1\|3797830_3798658_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_029581189.1\|3798817_3801184_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	4.5e-166	36.1
WP_032961793.1\|3801350_3801782_+	NfeD-like family protein 1	NA	NA	NA	NA
WP_032961795.1\|3801815_3802745_+	paraslipin	NA	NA	NA	NA
WP_032956776.1\|3802801_3803932_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.0e-15	32.8
WP_029581185.1\|3803941_3804403_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.4e-28	47.9

DBSCAN-SWA_285

3811622 : 3812246

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581176.1\|3811622_3812246_+	dTMP kinase	A0A1L2BX49	Bacteriophage	3.8e-24	39.2

DBSCAN-SWA_286

3817285 : 3818050

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581169.1\|3817285_3818050_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-33	39.5

DBSCAN-SWA_287

3825501 : 3826098

Agrobacterium_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955126.1\|3825501_3826098_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.0e-54	52.0

DBSCAN-SWA_288

3830084 : 3830591

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961813.1\|3830084_3830591_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	1.8e-24	39.0

DBSCAN-SWA_289

3833902 : 3837403

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581148.1\|3833902_3835315_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	3.0e-40	27.5
WP_029581147.1\|3835538_3836993_+	carnitine dehydratase	NA	NA	NA	NA
WP_029581146.1\|3837043_3837403_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-29	58.0

DBSCAN-SWA_290

3844335 : 3845028

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955136.1\|3844335_3845028_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	3.7e-12	31.9

DBSCAN-SWA_291

3848455 : 3851185

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961829.1\|3848455_3851185_-	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	6.0e-21	29.6

DBSCAN-SWA_292

3856322 : 3860908

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940165.1\|3856322_3858509_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.9e-78	35.6
WP_032961837.1\|3858535_3860908_-	DNA ligase D	A0A068CDF3	Rhizobium_phage	2.7e-54	40.2

DBSCAN-SWA_293

3864272 : 3866516

Acidianus_spindle-shaped_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032961844.1\|3864272_3866516_+	ATP-dependent DNA helicase	D1GF97	Acidianus_spindle-shaped_virus	1.3e-05	25.6

DBSCAN-SWA_294

3871866 : 3872850

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581113.1\|3871866_3872850_-	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.1e-12	26.8

DBSCAN-SWA_295

3913928 : 3914669

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581066.1\|3913928_3914669_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.9e-07	24.5

DBSCAN-SWA_296

3925791 : 3926703

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029581051.1\|3925791_3926703_+	3-phosphoglycerate dehydrogenase	M1HBE3	Paramecium_bursaria_Chlorella_virus	1.7e-20	30.7

DBSCAN-SWA_297

3946010 : 3947081

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979268.1\|3946010_3947081_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	7.8e-25	32.7

DBSCAN-SWA_298

3955140 : 3955941

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956507.1\|3955140_3955941_+	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.7e-05	25.1

DBSCAN-SWA_299

3969513 : 3970890

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962087.1\|3969513_3970890_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.3e-29	67.4

DBSCAN-SWA_300

4005041 : 4006085

Niemeyer_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048940125.1\|4005041_4006085_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	2.9e-32	32.1

DBSCAN-SWA_301

4011272 : 4021552

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955922.1\|4011272_4012118_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.0e-64	49.6
WP_032955923.1\|4012268_4013252_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.7e-48	40.6
WP_051593974.1\|4013195_4013819_-	hypothetical protein	NA	NA	NA	NA
WP_080700966.1\|4013790_4014705_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_048940123.1\|4014697_4015402_-	PIG-L family deacetylase	NA	NA	NA	NA
WP_032955924.1\|4015525_4015792_+	hypothetical protein	NA	NA	NA	NA
WP_080700273.1\|4015797_4016877_-	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	2.1e-70	43.4
WP_032979353.1\|4016837_4017791_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_048940121.1\|4017780_4018836_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_032962598.1\|4018832_4019816_-	glycosyltransferase	NA	NA	NA	NA
WP_032955929.1\|4019812_4021552_-	carbamoyltransferase	A0A1B1IVF2	uncultured_Mediterranean_phage	6.4e-53	34.1

DBSCAN-SWA_302

4026702 : 4029405

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962603.1\|4026702_4029405_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	5.3e-46	31.6

DBSCAN-SWA_303

4043157 : 4049936

Cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051594382.1\|4043157_4044024_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	6.7e-11	26.6
WP_029580978.1\|4044007_4044745_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_032962623.1\|4044760_4046479_+	FAD-binding protein	M1HTN0	Paramecium_bursaria_Chlorella_virus	8.9e-23	27.7
WP_032955949.1\|4046475_4046832_+	hypothetical protein	NA	NA	NA	NA
WP_141984608.1\|4047418_4048378_-	ABC transporter permease	NA	NA	NA	NA
WP_032979565.1\|4048424_4049936_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-15	26.2

DBSCAN-SWA_304

4062021 : 4063680

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075197.1\|4062021_4063680_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	7.3e-06	24.4

DBSCAN-SWA_305

4082170 : 4086860

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962650.1\|4082170_4083691_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.3e-36	25.9
WP_029580942.1\|4083721_4084885_-	CoA transferase	NA	NA	NA	NA
WP_029580941.1\|4084968_4085637_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_029580940.1\|4085816_4086860_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.7e-21	26.9

DBSCAN-SWA_306

4095617 : 4099039

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956010.1\|4095617_4096346_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-07	22.3
WP_029580930.1\|4096338_4097859_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	4.2e-32	24.7
WP_029580929.1\|4097855_4098239_+	hypothetical protein	NA	NA	NA	NA
WP_032962664.1\|4098241_4099039_+	alpha/beta hydrolase	Q857G1	Mycobacterium_phage	5.6e-12	39.3

DBSCAN-SWA_307

4107177 : 4108639

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580920.1\|4107177_4107951_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.3e-12	30.2
WP_029580919.1\|4107940_4108639_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.5e-08	22.8

DBSCAN-SWA_308

4113213 : 4113429

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962674.1\|4113213_4113429_-	DUF3596 domain-containing protein	A0A1W6JTA0	Pseudomonas_phage	5.5e-07	54.7

DBSCAN-SWA_309

4121310 : 4122063

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043224140.1\|4121310_4122063_-	amino acid ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.1e-14	29.1

DBSCAN-SWA_310

4127588 : 4128350

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962750.1\|4127588_4128350_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.2e-13	28.6

DBSCAN-SWA_311

4138302 : 4139850

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580891.1\|4138302_4139850_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.0e-37	42.5

DBSCAN-SWA_312

4144271 : 4147937

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962696.1\|4144271_4147937_+	transporter substrate-binding domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	6.7e-36	31.1

DBSCAN-SWA_313

4158459 : 4160157

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956041.1\|4158459_4160157_+	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	4.7e-32	25.7

DBSCAN-SWA_314

4173838 : 4175308

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580860.1\|4173838_4174540_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-08	23.2
WP_032962723.1\|4174540_4175308_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-13	25.6

DBSCAN-SWA_315

4179033 : 4179564

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095075250.1\|4179033_4179564_-	queuosine precursor transporter	A0A2I7SAW6	Vibrio_phage	1.9e-16	35.8

DBSCAN-SWA_316

4184005 : 4185094

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580849.1\|4184005_4185094_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	3.0e-24	31.7

DBSCAN-SWA_317

4195508 : 4196846

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700989.1\|4195508_4196846_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.5e-14	33.1

DBSCAN-SWA_318

4201684 : 4204274

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580835.1\|4201684_4202185_-	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	2.4e-13	35.5
WP_032960163.1\|4202247_4202664_-	hypothetical protein	NA	NA	NA	NA
WP_032979549.1\|4202660_4204274_-	dehydrogenase	A0A1V0SI18	Klosneuvirus	2.0e-48	28.9

DBSCAN-SWA_319

4207623 : 4209460

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580829.1\|4207623_4208442_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-29	35.2
WP_029580828.1\|4208446_4209049_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_029580827.1\|4209082_4209460_-	RidA family protein	S4W0G3	Pandoravirus	1.1e-05	35.8

DBSCAN-SWA_320

4215204 : 4216164

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580821.1\|4215204_4216164_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.7e-13	26.1

DBSCAN-SWA_321

4224055 : 4224832

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979546.1\|4224055_4224832_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	6.0e-19	31.4

DBSCAN-SWA_322

4229815 : 4238161

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126623576.1\|4229815_4234243_+	response regulator	A0A1V0SGX0	Hokovirus	1.8e-75	27.0
WP_029580807.1\|4234297_4235449_+	two-component system response regulator	W8CYM9	Bacillus_phage	5.1e-14	41.9
WP_029580806.1\|4235585_4237097_-	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_029580805.1\|4237096_4238161_-	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-07	23.4

DBSCAN-SWA_323

4243563 : 4245225

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700987.1\|4243563_4245225_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-08	29.5

DBSCAN-SWA_324

4255684 : 4261145

Clostridium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080666610.1\|4255684_4256227_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	1.5e-21	39.8
WP_029580789.1\|4256245_4257016_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_029580788.1\|4257189_4257822_+	guanylate kinase	A0A223FN12	Murmansk_poxvirus	3.3e-15	33.3
WP_003811126.1\|4257861_4258065_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_029580787.1\|4258088_4260386_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9LAT2	Tupanvirus	8.9e-10	36.2
WP_029580786.1\|4260416_4261145_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	9.6e-35	42.3

DBSCAN-SWA_325

4278942 : 4304751

uncultured_Mediterranean_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126623574.1\|4278942_4286448_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	3.9e-22	30.2
WP_032955215.1\|4286799_4287744_+	DMT family transporter	NA	NA	NA	NA
WP_029580770.1\|4287755_4288436_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.8e-09	27.2
WP_032955214.1\|4288473_4289097_+	arylesterase	NA	NA	NA	NA
WP_029580768.1\|4289078_4291034_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_032962805.1\|4291297_4292047_+	glycerophosphodiester phosphodiesterase	A0A1J0F961	Only_Syngen_Nebraska_virus	1.2e-16	29.5
WP_029580766.1\|4292057_4292930_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_032962804.1\|4292940_4294353_-	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_029580764.1\|4294462_4295191_-	glutathione peroxidase	A0A1D8KSL1	Synechococcus_phage	1.9e-43	56.6
WP_029580763.1\|4295322_4295523_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_029580762.1\|4295674_4297948_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.0e-87	33.0
WP_029580761.1\|4297944_4298340_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_032979541.1\|4298336_4299731_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	5.7e-28	25.6
WP_032955234.1\|4299832_4300585_-	hypothetical protein	NA	NA	NA	NA
WP_029580758.1\|4300872_4301448_-	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_032979540.1\|4301565_4302345_-	3'-5' exonuclease	NA	NA	NA	NA
WP_029580756.1\|4302341_4303193_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	2.4e-13	45.0
WP_095075253.1\|4303210_4303849_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.3e-31	47.4
WP_029580754.1\|4303992_4304751_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.6e-69	52.5

DBSCAN-SWA_326

4309563 : 4322691

Moraxella_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580747.1\|4309563_4310601_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.2e-96	54.3
WP_029580746.1\|4310686_4311979_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.4e-67	36.5
WP_029580745.1\|4312161_4313178_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_029580744.1\|4313286_4313670_+	thiol reductase thioredoxin	V9SJ74	Achromobacter_phage	1.6e-09	26.8
WP_032955207.1\|4313673_4314279_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.0e-18	36.9
WP_032955206.1\|4314302_4315100_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_095075204.1\|4315104_4315893_-	ABC transporter permease	NA	NA	NA	NA
WP_142178084.1\|4315868_4316867_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032962829.1\|4316916_4317681_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-31	35.0
WP_032955203.1\|4317805_4318675_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032979539.1\|4318791_4319448_+	flavodoxin family protein	NA	NA	NA	NA
WP_095075254.1\|4319417_4321079_-	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	8.9e-52	28.5
WP_029580734.1\|4321246_4322218_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_032959135.1\|4322214_4322691_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	5.0e-08	31.5

DBSCAN-SWA_327

4341297 : 4342092

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580716.1\|4341297_4342092_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	9.8e-25	30.8

DBSCAN-SWA_328

4347188 : 4348127

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955688.1\|4347188_4348127_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-19	29.9

DBSCAN-SWA_329

4351255 : 4352023

Turkeypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955690.1\|4351255_4352023_+	NRDE family protein	A0A0M3ZEJ9	Turkeypox_virus	1.4e-23	31.2

DBSCAN-SWA_330

4356351 : 4357359

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955693.1\|4356351_4357359_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	1.3e-10	28.2

DBSCAN-SWA_331

4371097 : 4376259

Rhodococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962790.1\|4371097_4374259_+	error-prone DNA polymerase	M9MUV5	Rhodococcus_phage	6.8e-53	28.5
WP_032955699.1\|4374288_4374810_-	DNA-deoxyinosine glycosylase	NA	NA	NA	NA
WP_048940066.1\|4374799_4375624_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_029580682.1\|4375620_4376259_-	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	3.7e-06	26.0

DBSCAN-SWA_332

4381832 : 4392901

Streptococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580676.1\|4381832_4383296_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.7e-14	26.2
WP_029580675.1\|4383292_4383589_-	hypothetical protein	NA	NA	NA	NA
WP_029580674.1\|4383717_4385076_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-45	27.6
WP_080666605.1\|4385083_4385743_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	2.4e-37	52.0
WP_029580672.1\|4385586_4386390_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_141984581.1\|4386462_4387107_+	LysE family transporter	NA	NA	NA	NA
WP_029580670.1\|4387125_4387749_+	LysE family translocator	NA	NA	NA	NA
WP_029580669.1\|4387812_4388934_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B6VT43	Edwardsiella_phage	7.2e-82	47.6
WP_029580668.1\|4389004_4389349_+	lipoprotein	NA	NA	NA	NA
WP_029580667.1\|4389353_4390196_-	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	2.3e-16	29.9
WP_029580666.1\|4390215_4390827_-	peptidase S16	NA	NA	NA	NA
WP_029580665.1\|4391009_4391426_+	VOC family protein	NA	NA	NA	NA
WP_048940064.1\|4391464_4392901_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.7e-54	38.0

DBSCAN-SWA_333

4412984 : 4416548

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962778.1\|4412984_4413791_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.1e-31	34.4
WP_032962777.1\|4414463_4415651_-	MFS transporter	NA	NA	NA	NA
WP_051594394.1\|4415948_4416548_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	7.5e-70	68.8

DBSCAN-SWA_334

4429870 : 4432347

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580605.1\|4429870_4430587_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.8e-09	24.1
WP_032962771.1\|4430586_4432347_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FG22	Brazilian_cedratvirus	1.4e-10	29.0

DBSCAN-SWA_335

4437254 : 4439265

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962768.1\|4437254_4438715_+	DNA-3-methyladenine glycosylase 2 family protein	A0A291LAM3	Bordetella_phage	5.5e-05	33.3
WP_032962767.1\|4438725_4439265_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.6e-31	48.5

DBSCAN-SWA_336

4444465 : 4452467

Cronobacter_phage(20.0%)

integrase,transposase

attL 4434961:4434975|attR 4452942:4452956

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4434961:4434975	attL	NA	NA	NA	NA
WP_032964299.1\|4444465_4445290_-	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	1.2e-41	40.3
WP_142178088.1\|4445842_4446310_+	restriction endonuclease	NA	NA	NA	NA
WP_141984543.1\|4446306_4447547_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.1e-131	78.8
WP_032964455.1\|4447759_4449019_-\|integrase	site-specific integrase	A0A1X9TCT6	Enterobacter_phage	1.7e-116	52.9
WP_029580584.1\|4449319_4450912_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.3e-15	33.0
WP_032964452.1\|4451006_4452467_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.0e-95	41.1
4452942:4452956	attR	NA	NA	NA	NA

DBSCAN-SWA_337

4459307 : 4460306

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957507.1\|4459307_4460306_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.2e-12	23.3

DBSCAN-SWA_338

4468946 : 4472996

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964469.1\|4468946_4472996_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	8.8e-162	68.9

DBSCAN-SWA_339

4483979 : 4495737

Catovirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580552.1\|4483979_4484669_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	3.1e-35	40.3
WP_032957487.1\|4484661_4485942_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_032964430.1\|4486039_4486978_+	hypothetical protein	NA	NA	NA	NA
WP_029580549.1\|4486959_4488666_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	5.0e-50	28.9
WP_126623568.1\|4488743_4489847_+	peptide chain release factor 2	W8EDB3	Pseudomonas_phage	7.5e-07	38.0
WP_032964428.1\|4489897_4490647_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_032964426.1\|4490653_4492168_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	5.2e-83	36.8
WP_029580546.1\|4492180_4492468_+	hypothetical protein	NA	NA	NA	NA
WP_029580545.1\|4492472_4493090_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_032964423.1\|4493086_4494919_-	AMP-binding protein	A0A1V0SBX8	Catovirus	2.1e-54	25.4
WP_032964421.1\|4494927_4495737_-	ABC transporter ATP-binding protein	M1I0C3	Paramecium_bursaria_Chlorella_virus	1.0e-05	25.5

DBSCAN-SWA_340

4498870 : 4499683

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032957478.1\|4498870_4499683_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-11	30.2

DBSCAN-SWA_341

4502775 : 4505917

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032964416.1\|4502775_4504638_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.7e-99	41.0
WP_032964414.1\|4504677_4505184_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_029580532.1\|4505187_4505511_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	2.3e-25	54.2
WP_029580531.1\|4505512_4505917_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	4.8e-52	79.0

DBSCAN-SWA_342

4512140 : 4525055

Lake_Baikal_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580525.1\|4512140_4512794_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	1.9e-10	50.7
WP_029580524.1\|4512920_4515350_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.0e-222	52.4
WP_032964410.1\|4515515_4516814_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.1e-129	54.3
WP_029580522.1\|4516918_4517572_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.5e-55	56.4
WP_029580521.1\|4517574_4518885_-	trigger factor	NA	NA	NA	NA
WP_029580520.1\|4519090_4519630_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.1e-22	33.7
WP_029580519.1\|4519683_4519890_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-17	62.1
WP_032955668.1\|4520147_4520699_-	DUF924 family protein	NA	NA	NA	NA
WP_005014599.1\|4520821_4521025_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.6e-18	66.7
WP_029580517.1\|4521343_4521664_-	hypothetical protein	NA	NA	NA	NA
WP_126623567.1\|4522036_4523074_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_141984543.1\|4523814_4525055_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.1e-131	78.8

DBSCAN-SWA_343

4529471 : 4533860

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580506.1\|4529471_4531397_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	7.3e-66	32.3
WP_029580505.1\|4531586_4533860_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	3.1e-108	37.2

DBSCAN-SWA_344

4537259 : 4543576

Synechococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032955663.1\|4537259_4537928_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-25	35.7
WP_029580500.1\|4537976_4538942_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_032962460.1\|4538931_4541793_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	9.5e-70	25.2
WP_029580498.1\|4541795_4542311_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_029580497.1\|4542373_4543576_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	6.9e-38	30.6

DBSCAN-SWA_345

4548239 : 4550638

Xanthomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580490.1\|4548239_4548689_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	2.2e-45	61.5
WP_032962458.1\|4548704_4549814_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_029580488.1\|4549867_4550638_-	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-13	32.4

DBSCAN-SWA_346

4557198 : 4563392

Hokovirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580480.1\|4557198_4558893_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	6.3e-05	23.6
WP_029580479.1\|4559002_4559272_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_029580478.1\|4559333_4559732_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_029580477.1\|4559745_4560702_-	glutathione synthase	NA	NA	NA	NA
WP_080666590.1\|4560870_4561419_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.5e-13	29.9
WP_029580475.1\|4561439_4563392_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.7e-126	36.2

DBSCAN-SWA_347

4569563 : 4609132

Pseudomonas_phage(28.12%)

head,lysis,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580468.1\|4569563_4571219_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	5.7e-35	48.9
WP_029580467.1\|4571357_4571846_+	membrane protein	NA	NA	NA	NA
WP_051594370.1\|4572032_4572707_-	hypothetical protein	NA	NA	NA	NA
WP_142178090.1\|4573287_4573980_+	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	2.6e-37	39.7
WP_142178193.1\|4574216_4574438_+	hypothetical protein	NA	NA	NA	NA
WP_142178092.1\|4574536_4575586_+	(p)ppGpp synthetase	A0A1B0VBT5	Salmonella_phage	2.3e-29	33.0
WP_142178094.1\|4575624_4576236_-\|lysis	lysis protein	Q8HA85	Salmonella_phage	7.1e-07	34.0
WP_142178096.1\|4576139_4576631_-	hypothetical protein	I6NSS1	Burkholderia_phage	1.8e-45	60.5
WP_029580461.1\|4576636_4577077_-	hypothetical protein	A0A0U5LBV3	unidentified_phage	9.6e-14	34.8
WP_142178098.1\|4577179_4577779_-	hypothetical protein	A0A291LAV4	Bordetella_phage	5.0e-05	34.0
WP_029580459.1\|4577806_4579792_-	hypothetical protein	G9BWE7	Planktothrix_phage	2.4e-11	47.8
WP_142178100.1\|4579791_4580457_-	DUF2612 domain-containing protein	A0A0N9SSD8	Pseudomonas_phage	2.9e-30	35.1
WP_142178102.1\|4580456_4581908_-	hypothetical protein	A0A0N9SH53	Pseudomonas_phage	1.4e-77	36.4
WP_142178104.1\|4581931_4582300_-	hypothetical protein	E5AGC2	Erwinia_phage	1.8e-13	39.2
WP_142178106.1\|4582299_4582998_-	hypothetical protein	A0A2H4J8H6	uncultured_Caudovirales_phage	3.8e-12	30.7
WP_142178108.1\|4582994_4583915_-	hypothetical protein	E5AGC0	Erwinia_phage	1.3e-41	33.9
WP_142178110.1\|4583901_4584234_-	hypothetical protein	NA	NA	NA	NA
WP_142178112.1\|4584230_4584800_-	hypothetical protein	I3PGV3	Xanthomonas_phage	7.3e-06	27.8
WP_142178114.1\|4584813_4587255_-	tape measure protein	A0A2D0W9N5	Bordetella_phage	1.3e-22	29.7
WP_142178116.1\|4587403_4587889_-	hypothetical protein	NA	NA	NA	NA
WP_029580449.1\|4587888_4588317_-	DUF3277 family protein	A0A2K9V3K6	Faecalibacterium_phage	4.2e-22	40.9
WP_142178118.1\|4588329_4589688_-	DUF3383 family protein	A0A0N9SJA3	Pseudomonas_phage	1.1e-81	40.9
WP_142178120.1\|4589751_4590276_-	hypothetical protein	NA	NA	NA	NA
WP_142178122.1\|4590449_4590818_-	hypothetical protein	NA	NA	NA	NA
WP_142178124.1\|4590821_4591274_-	hypothetical protein	A0A2I7RVI7	Vibrio_phage	4.4e-06	30.9
WP_142178126.1\|4591263_4591638_-	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_142178128.1\|4591640_4592021_-	hypothetical protein	NA	NA	NA	NA
WP_142098711.1\|4592020_4592980_-	DUF2184 domain-containing protein	A0A0N9SG07	Pseudomonas_phage	4.3e-59	39.2
WP_029580441.1\|4593041_4593497_-	hypothetical protein	NA	NA	NA	NA
WP_142178130.1\|4593496_4594579_-	DUF2213 domain-containing protein	E5AGA6	Erwinia_phage	2.1e-54	40.4
WP_142178132.1\|4594589_4595429_-\|head	phage head morphogenesis protein	I3PGT9	Xanthomonas_phage	6.9e-37	38.5
WP_142178195.1\|4595370_4596651_-	DUF1073 domain-containing protein	A0A2H4N7B7	Pectobacterium_phage	6.4e-18	25.1
WP_142178197.1\|4596650_4598153_-\|terminase	phage terminase large subunit	A0A291LBL3	Klebsiella_phage	4.5e-111	47.7
WP_142178134.1\|4598184_4598661_-	DUF2280 domain-containing protein	A0A125RNL6	Pseudomonas_phage	4.1e-34	57.7
WP_142178136.1\|4598683_4599292_-	hypothetical protein	A0A1B0VRJ1	Pseudomonas_phage	1.8e-66	66.5
WP_029580433.1\|4599301_4600093_-	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	2.0e-126	79.0
WP_142178138.1\|4600243_4600879_+	hypothetical protein	NA	NA	NA	NA
WP_142178140.1\|4600941_4601568_-	hypothetical protein	NA	NA	NA	NA
WP_142178142.1\|4601560_4602055_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	1.4e-29	52.1
WP_142178144.1\|4602051_4602276_-	hypothetical protein	NA	NA	NA	NA
WP_142178146.1\|4602272_4603421_-	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	5.9e-39	58.2
WP_142178148.1\|4603493_4603679_+	hypothetical protein	NA	NA	NA	NA
WP_142178149.1\|4603688_4604297_-	hypothetical protein	A0A218M303	Acidovorax_phage	4.0e-34	38.7
WP_029580426.1\|4604377_4604629_+	hypothetical protein	NA	NA	NA	NA
WP_142178151.1\|4604658_4606587_-	DNA cytosine methyltransferase	Q9ZXI4	Pseudomonas_virus	9.3e-154	50.3
WP_142178153.1\|4606583_4607183_-	hypothetical protein	A0A0S2SYA8	Pseudomonas_phage	5.1e-42	50.0
WP_142098760.1\|4607241_4607436_+	hypothetical protein	NA	NA	NA	NA
WP_142098765.1\|4608084_4608330_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_142098768.1\|4608415_4609132_+	LexA family transcriptional regulator	Q8W6P8	Burkholderia_virus	4.4e-24	56.4

DBSCAN-SWA_348

4612186 : 4620583

Pseudomonas_phage(71.43%)

integrase

attL 4618410:4618424|attR 4622815:4622829

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_142178199.1\|4612186_4612987_+	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	3.7e-56	48.5
WP_142178159.1\|4612989_4613217_+	hypothetical protein	J7I4L3	Pseudomonas_phage	6.7e-11	50.8
WP_142178161.1\|4613218_4614472_+	hypothetical protein	J7HXB6	Pseudomonas_phage	3.3e-67	57.1
WP_142178163.1\|4614529_4615216_+	cell division protein FtsK	NA	NA	NA	NA
WP_142178165.1\|4615219_4617004_+	AAA family ATPase	J7HXJ7	Pseudomonas_phage	1.2e-78	36.0
WP_029580412.1\|4617022_4617376_+	hypothetical protein	NA	NA	NA	NA
WP_142178167.1\|4617372_4618038_+	hypothetical protein	F8TVI9	EBPR_siphovirus	7.0e-08	51.5
4618410:4618424	attL	NA	NA	NA	NA
WP_142178201.1\|4618474_4618852_+	HNH endonuclease	Q3HQV7	Burkholderia_phage	4.3e-39	61.5
WP_142178169.1\|4618848_4619046_+	hypothetical protein	NA	NA	NA	NA
WP_142178171.1\|4619042_4619312_+	transcriptional regulator	NA	NA	NA	NA
WP_142178173.1\|4619326_4620583_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	2.1e-61	36.1
4622815:4622829	attR	NA	NA	NA	NA

DBSCAN-SWA_349

4633514 : 4634573

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580392.1\|4633514_4634573_-	chorismate synthase	A0A291AU41	Pandoravirus	8.3e-80	43.4

DBSCAN-SWA_350

4639833 : 4641306

Microcystis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580388.1\|4639833_4641306_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	6.4e-46	30.5

DBSCAN-SWA_351

4656003 : 4658343

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580371.1\|4656003_4658343_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.4e-151	41.0

DBSCAN-SWA_352

4662666 : 4663359

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580365.1\|4662666_4663359_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.9e-12	25.4

DBSCAN-SWA_353

4666702 : 4668837

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032958067.1\|4666702_4667458_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-18	30.9
WP_029580359.1\|4667471_4668299_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_029580358.1\|4668303_4668837_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.8e-51	55.5

DBSCAN-SWA_354

4673500 : 4676242

Pseudomonas_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029580352.1\|4673500_4674223_-	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	1.7e-44	48.2
WP_029580351.1\|4674366_4675065_-	TerC family protein	W8EBD0	Pseudomonas_phage	1.3e-17	29.6
WP_029580350.1\|4675360_4676242_-	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	2.3e-19	31.6

DBSCAN-SWA_355

4682149 : 4690576

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032956477.1\|4682149_4683211_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.6e-113	64.3
WP_032962333.1\|4683539_4684235_+	response regulator transcription factor	NA	NA	NA	NA
WP_029580342.1\|4684350_4685730_+	sensor histidine kinase	W8CYF6	Bacillus_phage	2.0e-20	26.8
WP_029580341.1\|4685913_4687590_+	MHS family MFS transporter	NA	NA	NA	NA
WP_029580340.1\|4687946_4688165_-	hypothetical protein	NA	NA	NA	NA
WP_029580339.1\|4688316_4689216_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	1.4e-43	32.6
WP_029580338.1\|4689283_4690576_-	aspartate carbamoyltransferase	Q84489	Paramecium_bursaria_Chlorella_virus	1.1e-41	36.6

DBSCAN-SWA_356

4695151 : 4696066

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080700357.1\|4695151_4696066_-	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.2e-63	47.7

DBSCAN-SWA_357

4745716 : 4747375

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962294.1\|4745716_4747375_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	6.6e-07	23.3

DBSCAN-SWA_358

4752785 : 4753829

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032962286.1\|4752785_4753829_-	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	5.4e-31	38.5

DBSCAN-SWA_359

4765628 : 4766960

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577378.1\|4765628_4766960_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.1e-20	23.9

DBSCAN-SWA_360

4771162 : 4776114

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032979393.1\|4771162_4771957_-	SDR family oxidoreductase	A0A0G2Y601	Acanthamoeba_polyphaga_mimivirus	2.6e-09	33.1
WP_029577383.1\|4772049_4772970_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_032979394.1\|4773025_4773475_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_032979395.1\|4773557_4774700_-	cell division protein FtsQ	NA	NA	NA	NA
WP_029577386.1\|4774704_4776114_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	2.9e-64	36.7

DBSCAN-SWA_361

4789619 : 4793618

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577394.1\|4789619_4790399_-	cellulose synthase operon protein YhjQ	A0A142F1W4	Mycobacterium_phage	2.2e-08	31.6
WP_029577395.1\|4790395_4791064_-	hypothetical protein	NA	NA	NA	NA
WP_048940486.1\|4791114_4791510_-	cellulose synthase	NA	NA	NA	NA
WP_032979762.1\|4792199_4793618_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.1e-45	27.9

DBSCAN-SWA_362

4802941 : 4804006

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029577406.1\|4802941_4804006_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	2.4e-18	26.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021400

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection