CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP033608	Weissella hellenica strain 0916-4-2 chromosome, complete genome	3 crisprs	csa3,DEDDh,DinG,cas3	4
NZ_CP033610	Weissella hellenica strain 0916-4-2 plasmid pWHSP020, complete sequence	0 crisprs	csa3	3
NZ_CP033609	Weissella hellenica strain 0916-4-2 plasmid pWHSP041, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP033608_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033608_1

101210-101312

Orphan

Consensus_repeat	Method
CCGAATTAGCTCAGTTGGTAGAGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033608_1

>merge|NZ_CP033608|1|101210-101312|CRISPRCasFinder
CCGAATTAGCTCAGTTGGTAGAGCACACGACTGTTAATCGTGCTGTCGTCGGTTCGAGCCCGACATTCGGAGTAATTGCCGACTTAGCTCAGTTGGTAGAGCA

>NZ_CP033608|1|1|101210-101312|CRISPRCasFinder
CCGAATTAGCTCAGTTGGTAGAGCA	CACGACTGTTAATCGTGCTGTCGTCGGTTCGAGCCCGACATTCGGAGTAATTG
CCGACTTAGCTCAGTTGGTAGAGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033608.1\|WP_141926437.1\|90180_90777_+\|hypoxanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|223707
NZ_CP033608.1\|WP_141926439.1\|102631_104104_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225420
NZ_CP033608.1\|WP_141926436.1\|88628_89000_+\|septum-formation-initiator-family-protein	unknown	unknown	gnl\|CDD\|225471
NZ_CP033608.1\|WP_141926444.1\|109411_109645_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033608.1\|WP_042494590.1\|89110_90085_+\|tRNA-lysidine(34)-synthetase-TilS	unknown	unknown	gnl\|CDD\|238950
NZ_CP033608.1\|WP_042493177.1\|107563_107938_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP033608.1\|WP_137600910.1\|90834_92877_+\|ATP-dependent-metallopeptidase-FtsH/Yme1/Tma-family-protein	unknown	unknown	gnl\|CDD\|273520
NZ_CP033608.1\|WP_141926443.1\|109067_109409_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033608.1\|WP_042494583.1\|82541_83108_+\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|235457
NZ_CP033608.1\|WP_137600909.1\|93988_95473_+\|lysine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234778
NZ_CP033608.1\|WP_141926441.1\|105424_106933_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274774
NZ_CP033608.1\|WP_141926442.1\|108313_109063_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|377029
NZ_CP033608.1\|WP_141926440.1\|104661_105345_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033608.1\|WP_141926438.1\|101434_102526_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP033608.1\|WP_042494586.1\|88219_88498_+\|RNA-binding-S4-domain-containing-protein	unknown	unknown	gnl\|CDD\|224109
NZ_CP033608.1\|WP_141926435.1\|83125_86626_+\|transcription-repair-coupling-factor	unknown	unknown	gnl\|CDD\|224118
NZ_CP033608.1\|WP_052348422.1\|107160_107559_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033608.1\|WP_042494594.1\|92983_93877_+\|Hsp33-family-molecular-chaperone-HslO	unknown	unknown	gnl\|CDD\|234643
NZ_CP033608.1\|WP_052348421.1\|108072_108264_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP033608.1\|WP_042494585.1\|86630_88220_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529

Protein	Function_ID	Function_description	E-value
NZ_CP033608.1\|WP_141926437.1\|90180_90777_+\|hypoxanthine-phosphoribosyltransferase	gnl\|CDD\|223707	COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism].	2.13915e-74
NZ_CP033608.1\|WP_141926439.1\|102631_104104_-\|transcriptional-regulator	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	4.38363e-77
NZ_CP033608.1\|WP_141926436.1\|88628_89000_+\|septum-formation-initiator-family-protein	gnl\|CDD\|225471	COG2919, COG2919, Septum formation initiator [Cell division and chromosome partitioning].	4.53136e-06
NZ_CP033608.1\|WP_042494590.1\|89110_90085_+\|tRNA-lysidine(34)-synthetase-TilS	gnl\|CDD\|238950	cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This domain has a strongly conserved motif SGGXD at the N terminus.	4.01297e-56
NZ_CP033608.1\|WP_042493177.1\|107563_107938_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	7.93198e-05
NZ_CP033608.1\|WP_137600910.1\|90834_92877_+\|ATP-dependent-metallopeptidase-FtsH/Yme1/Tma-family-protein	gnl\|CDD\|273520	TIGR01241, ATP-dependent_zinc_metalloprotease_FtsH, ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_CP033608.1\|WP_042494583.1\|82541_83108_+\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|235457	PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisional.	1.80784e-96
NZ_CP033608.1\|WP_137600909.1\|93988_95473_+\|lysine--tRNA-ligase	gnl\|CDD\|234778	PRK00484, lysS, lysyl-tRNA synthetase; Reviewed.	0
NZ_CP033608.1\|WP_052348421.1\|108072_108264_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.22095e-12
NZ_CP033608.1\|WP_141926441.1\|105424_106933_-\|hypothetical-protein	gnl\|CDD\|274774	TIGR03766, hypothetical_protein_lp_2141, conserved hypothetical integral membrane protein. Models TIGR03110, TIGR03111, and TIGR03112 describe a three-gene system found in several Gram-positive bacteria, where TIGR03110 (XrtG) is distantly related to a putative transpeptidase, exosortase (TIGR02602). This model describes a small clade that correlates by both gene clustering and phyletic pattern, although imperfectly, to the three gene system. Both this narrow clade, and the larger set of full-length homologous integral membrane proteins, have an especially well-conserved region near the C-terminus with an invariant tyrosine. The function is unknown.	1.09074e-92
NZ_CP033608.1\|WP_141926438.1\|101434_102526_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.25044e-44
NZ_CP033608.1\|WP_042494586.1\|88219_88498_+\|RNA-binding-S4-domain-containing-protein	gnl\|CDD\|224109	COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis].	7.59581e-29
NZ_CP033608.1\|WP_141926435.1\|83125_86626_+\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
NZ_CP033608.1\|WP_141926442.1\|108313_109063_+\|oxidoreductase	gnl\|CDD\|377029	pfam03374, ANT, Phage antirepressor protein KilAC domain. This domain was called the KilAC domain by Iyer and colleagues.	2.88501e-40
NZ_CP033608.1\|WP_042494594.1\|92983_93877_+\|Hsp33-family-molecular-chaperone-HslO	gnl\|CDD\|234643	PRK00114, hslO, Hsp33 family molecular chaperone HslO.	1.4116e-104
NZ_CP033608.1\|WP_042494585.1\|86630_88220_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.72657e-117

>NZ_CP033608.1|WP_137600909.1|93988_95473_+|lysine--tRNA-ligase
MADQQVSLNDQMIKRREKMTELREAGIDPFGHRFDRTHMASELHALYDDVSGEDLEAQANEVTIAGRMMTKRRSGKISFADIKDRSGRIQVFVQKPIVGEEVYDWFKKSDLGDWLGFKGTMIKTRAGELSLSVTEIVHLSKALRPLPDKFHGLTDVETKYRQRYLDLIANDDSFERFQKRSKIISAIRAYMDGDGFTEVETPMLQNAAGGAAARPFITHHNALNIDLYMRIALELHLKRLIVGGMERVYEIGRVFRNEGMDPKHNPEFTVMESYAAFWDLGDVMTETENIFKAAAKVVADDMMITYQGTNIDLAKPFARKHMVDLIKEKTGVDFWQDYSLEQARAIADEKGVKYEQYWGVGHIINEFFEDFVEETLIDPTFVYGHPVEVSPLAKKSDDDKRFAQRFELFISGGEYANAFTELNDPIDQRERFEAQAAERDAGNDEAEGIDEDFIESLEYGMPPTGGLGIGIDRLVMLLTDADSIRDVLLFPTMR
>NZ_CP033608.1|WP_042494594.1|92983_93877_+|Hsp33-family-molecular-chaperone-HslO
MADKLVRAITTDGKFRAIAIDATEMIKEVATFHDATQLGTTILGRALIGSLMMSNAILKGEERLAVSIDGQGPAGKIVVESSAQGEVRGYVTNPQVTLPLNVKQQPDVATAVGVDGFLTVTKDYGTNEPFTGKVALATGEIGDDLTYYMAKSEQIPSAVAVSVLVDPDGSVVTAGGFMVSTLPDATNEDIEQLETRLANFPAISTQMMEGYTPSDLLQNLFGAEELQVLTTTEVSLYPAITRHEYARMLATLPLSELQAILAEDHGVEIVDRFTGKVINFDETQLQAIIASKDASGL
>NZ_CP033608.1|WP_137600910.1|90834_92877_+|ATP-dependent-metallopeptidase-FtsH/Yme1/Tma-family-protein
MKNQRNGNFVRNSLFYVIVVLGIMGLIYWVAGPTQTSNTKTISTSTFMTELRDKKIDKVTIQPGDGVYDIKGEYKKAQSDKDANNDAFTSLLGGSSKKANSFETKLVGSDNIVADVQKAADASKTDVTTKPQPSNFWGTLAVTMLPLLLMVGLFYLMMGGMNQGGQGGRGNMMGMGKSKAKAADPSENKKRFGDVAGAEEEKQELVEVVEFLKDPKKFLKLGARIPSGVLLEGPPGTGKTLLAKAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFENAKKSAPSIIFIDEIDAVGRQRGNGMGGGHDEREQTLNQMLVEMDGFEGNEGVIVMAATNRSDVLDPALLRPGRFDRKILVGRPDVKGREAILKVHAKNKPLDSSVDLKEIAKQTPGFVGADLENLLNESALLAARRNSNTITAKDLDEAEDRVIAGPAKKDRVISAKERNTVAYHEAGHAIVGLVLNEARVVHKVTIVPRGRAGGYAIMLPREDQMLMSKTDAMDQVAGLMGGRAAEVLLFNQQSSGASNDFEQATGIARAMVTQYGMSDKLGMVQLEKDNGPQYGQPLYSDTTSRLIDEEVRHITTQGYETACDIILRYKDRHEAIAQALLEYETLDEKQILSLFNTGKMPENENEAKKNDGTPMSYEQAKQAANDKLTEDEAAASSEETTTSDDDDKA
>NZ_CP033608.1|WP_141926437.1|90180_90777_+|hypoxanthine-phosphoribosyltransferase
MNQPDMNNDIERVLYSEAEIAKAAKQVGEQLAADYEGQTPIILSVLKGAVLWTVDVMRHMQYAEVEFIDVSSYNGGIASSGSVDLVTDLQTDIAGRDIIIMEDIVDTGRSLKFMVELLKDRGAKSVKTASLLDKKDGRVVEATVDYVGFDVPKAFVVGYGLDYKQLYRNLPYVGVLKREVYDPQHADMVDTVDITPNH
>NZ_CP033608.1|WP_042494590.1|89110_90085_+|tRNA-lysidine(34)-synthetase-TilS
MKPKVLRANLIRKIREQQLFNANDHVLVAVSGGQDSLRLLRWLTEGDLPQDIQPKVSAIYINHQLRQDAMQEETFVRRVLSNTPNLVVRAIERINWDEVPTISVEEQARDRRYQTMFTVANKIKANMIVTAHHRDDQAETILYKLARGSRLDQLTGMPAKQTLTNHLQLVRPFLDLSKVELQGLVKEPVQEWIDDYTNDDQKYARNRLRHAIIPDLQQINQQAMPHIIDFAEELAALQALAAPQITQYVADLEQGHLDWELPTSQLVLVLQKWLQKYQILDVKNRQLEQAVQLMKNKNIATGTVHLQGNNLLVRSHENLQLLKG
>NZ_CP033608.1|WP_141926436.1|88628_89000_+|septum-formation-initiator-family-protein
MRKVRKQSNIEPLNTAGKQHMHFQMRQEQYSRRIHWRRRGIAVIAMLIITVLAMINLYGQQTKYTNASAGLQQTNKALINAKQNNADLKQEVQDLHDDSYLQKLIREKYMYTKDNEIVFNMPN
>NZ_CP033608.1|WP_042494586.1|88219_88498_+|RNA-binding-S4-domain-containing-protein
MRLDKYLKVARLIKRRSVAKDIADQGRIDINGKTAKSSSDVKSGDELTIRFGNKTTTIEIERIVETTKKDEAEHMYRIVSETYAQDFSNNSK
>NZ_CP033608.1|WP_042494585.1|86630_88220_+|polysaccharide-biosynthesis-protein
MRKSGQNLMVGAGILTLAGMSAKLLSAVYRIPFQNLVGNTGFYVYQQVYPIYGIGVVLALSGWPVFISKIITEQPDEAHQQLVARRLFWWLLFISCGLFILVYGGAPILALGMGGNLKLTPVVKAVAWMFWFMPFLAVGRGFAQGQLNMMPTAISQIIEQIARVAIIIAIAWYGVSAKWSVYTIGTWAMAAAAVAAAAATLYMTNIVKSIWRTPITKSVKKDKSIGWFRIFRRLWNEGNLLAMLAGLLVLLQLVDSFSTKGLLEIHGLSTQAAEYAKGVYDRGQPLVQLGMVLATAISTSLLPVLRNHVVHHEQKEFVNDFQMMFRLSLILSGVATCGLMAVMPVVNQVLFSTREGSHALIVFVLTVIPATLILIGTSVLQSLNKTRGISWLIILTMVIKYGLNIWLVPKYGIIGASWATMLSLLPMLYIVMHRLPKTVWQQWHAPYWWLKFMITLLGVLVSAGGWCKISDIFIGSSRLASLIILIIAILIGIIVFIIMLWRLRLLSVAEWYALPKGYKIYNFLERRNK
>NZ_CP033608.1|WP_141926435.1|83125_86626_+|transcription-repair-coupling-factor
MELTEFLQQDKDLQQLATGLKHGGRHLMTGISGTARTVYLAALQKKTQQPMVIVSDSQFHADQLTEDLQALLGDEHVRSFPAEESIAAELSVTSLDTRLARVQAMQLLLTDPQAVVVTGIAGAQRYLPTVDAFKKAQITIDFDHEYELNQLEMQLHQMGYHRNSTVEQPGEFAIRGSIIDVYPLDVGNPIRLDFFDTQLDSMRSFDAETQRSIDNLDSLTILPATDLIIDDEERGQAKTRLELAMTKYRDSLEGADKRHLTEAMTPLLTTLADGQLLPDIRAYLHFLYPDAVSLFDYLPENGVAVFDDYPRAVENAAQMRLDDTNWWADKLSKQQALPVDDFGWTLTDQARDIQQTSLVLSPLQRGIGQLRQTSLTNVTVRPTQQFFGQMPLLKGEVDRWQKQNMTIVFLTNSTERQVKLVQTLNDFGVKINQVAVDGLTDGRTQLTTLPLSAGFELPMQKLVVLTEKELFQQVRKRAPKRQTLSNAERIKSYNELKPGDYVVHVNHGIGIYEGMQTIENRGVKQDYITIGYQKDAKLFIPVTQLDLVQKYVGAAEKAPKINKMGGPEWQRAKAKVAKKVEDIADDLLALYAEREIKKGYAFAPDDDAMHNFEEAFPYPETPDQIRSIKEIKADMEKVRPMDRLLVGDVGFGKTEVAMRAAFKAAHEGKQVAMLVPTTILAQQHYESFINRFEGTDLKIAGMSRFQTPKQKKEIKAGLKNHTIDIVIGTHSLLAKDVVFGDLGLLIIDEEQRFGVKHKERLKSLQTNVDVLTLTATPIPRTLNMAMVGVRDLSVIETPPANRYPIQTYVMEQNGRVIANAVEREMARGGQTFYLHNRVADIEKVAGMIQSLVPEARVAYIHGQMTEAQMEGILVDFINGEYDVLVTTTIIETGVDIPNANTLFVENADYMGLSQLYQLRGRVGRSHNVAYAYFTYPGTRSLNEESEKRLTAIRDFTELGSGFKIAMRDLSIRGAGDLLGQSQHGFINTVGYDLYTQMLQEAVAAKQGKQVKQVDSELDLQVEAYLPSSYVADGPQKIDLYQRIRKANKAEQFAEITDDLVDRFGDIPAAASRLLEVSKLKALADQLGIKQIKRTINQPELVMINFSQEATVTAQQVKQASALTKTRGQIKVNEPVLFAMAIQPKQTDDDWLENLMQFLTALLPKKD
>NZ_CP033608.1|WP_042494583.1|82541_83108_+|aminoacyl-tRNA-hydrolase
MKMIVGLGNIGKEYDKTRHNIGFMTVDVLADKYQATFKQDGQHHAFVADVRINNEKVLLVKPTTYMNDSGDAVRPLVDYYKLDLADLLVVQDDMDMDLGRLRLRQKGSAGGHNGIKSIANQLGTQKFNRLKFGIGHPAHVHQAVVDYVLGHFGQDEQPDLLSGLDQAVEIFEGFAAGKEMPILMNQFN
>NZ_CP033608.1|WP_141926438.1|101434_102526_-|tyrosine-type-recombinase/integrase
MASIYKRGKTWTANVFVLKDGERRRKTKSGFRTKSEAQGWANEVEVAKQKHALTFNTKTPFPVYFDKWFEIYKKPFVTYSTIKWYELTSKHLHNAFENVTIENMTRARFQKFLNEMGKKYAIETTKKIKMHVHQMVNSAIAEDVIIKDFTKGTNTTGLDGKDRNLKFLEADTMKSLVTNLVSRPVGERPVTDMMILTGLHTGCRYSEIAALEWSDINFNNSIISINKTWDSPRKLFKPTKTKTSTRKVDVPDVLIKDLTEWYNLHQNTIFVFTGSNNYPPTNEAANKQLTRNLKEINSDKMITFHGLRHTHASWLLSQGVDVKYVSERLGHSSIDITLSVYTHLLQTQRNDQTNKSMALLNNL
>NZ_CP033608.1|WP_141926439.1|102631_104104_-|transcriptional-regulator
MKPNNDIQFILELINKPETEIIEYKVGNWEPERIAKYISALSNSAAVKQQKYAFLIWGVNDDTKSLEGSTFYPYSLKKGNENFVAWLEHVIKPKIDFVFKDIEFEDKHFVLLTIPAAKLKPVSFKNERYIRSGSSLKSLSEFPNKEKILWDSFNDTSFEKQIALQNVSFEQVIRLLSVETYFKETNIPIPNSNNQIAEFLIASNIIYSENNDLYSITNLGALTLARNMNFFPKLKRHSLRVIKYNGKNKLDAESDYTGMKGYAVGFQGLLNYVTSKIPKHELYTDGSNLSGGKRQVSSDYPSIALRELIANALVHQDFMIPGVSPTVEIYTNRIEITNPGRPLIDINRLLDYPPRSRNDELATLFRRMNFIEERGSGIDKTVNSLEIQELPAPRMIESGDFFQVTLFSKRQFNQLTTDDKTRATYLHASLKRMEEDYLTNASLRKRFGLKNTDSPKISKLIAATLEAGWIEKFDNNASPKQMKYIPFWAK
>NZ_CP033608.1|WP_141926440.1|104661_105345_-|hypothetical-protein
MTFFMILWLTTGITFWVTLIIWGINRVKKRESKITGKIPLILLAVSVLSLIICASLTPSYNDDKQADVSSSTSKKSVSKTSSKAASSKAASESEAKESSERATSASIAHDPATYQTGITYDQVARTPDEYDMKKVQFTGRVLQVMEDKTETQIRLGVGGSYDNVILVSIDKSDLNGSRILEDDLVTVSGVSSNTVSYESTLGGNITIPSMIGLIVDDQGPASDDYGY
>NZ_CP033608.1|WP_141926441.1|105424_106933_-|hypothetical-protein
MEKNKIKVSTFNFLKKAINIVFLVWMILIFIGSIRSTHSNIAEVSPELFTLISLFAICIVIYFASNNIKSFIKNKVTPLVLGYKLTLLSIWSLLLIIGQIIFIAQTTTTIGFDVGGVVGQVIYGTSMPNYFSYNPNNLPLLFLENFWGNHFGANWVSFNIMSLLSTDLGFIITILTARYINKNSMYTTWLLSLLLLGCFPYIIVPYTDVLVLPLVSLAFLGYLIAKKNNNLYIKLLGSLLIGIFGTLSFLLKPSSVIFIIAIILVEIFYLLFKSKKVKVFYIISILLVSFGSAFGVKQIYNSYLHDQQYIKVNPSMKKPPELFLAMGMVGNGGYNTMLTNTVNSLKTQHEKKTFAVKQIKDTLHRYGIFGYLQFLLKKNTNNTSNGAFGWLQEGNFILAPATNRLQQLVYPNGSHLLDYFFISQIVWIILLVILTLGYKSPQKLESIIMILKLSIIGSLMYLLLFEGGRSRYLIQFLPQIILLSGIYLNVYFTDNMFVKNND
>NZ_CP033608.1|WP_052348422.1|107160_107559_-|hypothetical-protein
MHEELLRQLLAMAEKSGIVITDILGGPNDPDVAFCNDRIININRNYNSRISVAFRLAHEISHIEFSNPSFLYRFSPYIKNKEERETNERAIRIIARLVYIDTPNEYRNWSDFMTEFNLPSWFEPLVKDLIYE
>NZ_CP033608.1|WP_042493177.1|107563_107938_-|helix-turn-helix-transcriptional-regulator
MADNKSKQIFANNLRYYMNKNGKNGTNIIDDLNIKNSTFYNWLSAETYPRIDKIELLADYFGITKADLVEDKTETNKKSTSDEPVDLDKALSEEGMAMFDGQPLSEEYKRALLAMLNTMKDNGK
>NZ_CP033608.1|WP_052348421.1|108072_108264_+|helix-turn-helix-transcriptional-regulator
MSGKYTLAQLRAGKNWSQANTASALGVSTNSWFKWENGISFPTQPNVDKILRVFNVKYDDVIF
>NZ_CP033608.1|WP_141926442.1|108313_109063_+|oxidoreductase
MENELIKVHENEQGEQLVSARELYKGLGIKERFSLWFERYEDMYVAGVDFEGVGLPTPYRKGSDKVQIIQDYKLMVDMAKHIAMMTKTDKGNQIRDYFIAVEKEHKALMADPRMQMAMGLKSAQMMLDHKDKIIEEMKPKALFADAVNTSKQSILVGDLAKLISQNGVKVGQNRLFAYLRDNGYLHKAGSQYNRPTQRYIDQGLFEVKESSHTNPDGSIRLTFTTKVTGKGQQYFVNKFLGESQIALGV
>NZ_CP033608.1|WP_141926443.1|109067_109409_+|hypothetical-protein
MAEGATIQLPIEMLTHLSESVVEQAVALAEQNILHHDEFVQLNRTNKTPKGKRTLEDYLGGMSLNDFNLYWRRRVEAEPGLTIPKGERQLLYHGRKVQQYIAEHAAEVTNKRG
>NZ_CP033608.1|WP_141926444.1|109411_109645_+|hypothetical-protein
MSFNDISLVLQAVWLIIKYMVLPVLVVSGAIWLAIEYWLVIKYWLQVASRTISWVFLKLAWAIIYLIDGKEAAEKRF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033608_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033608_2

1053165-1053256

Orphan

Consensus_repeat	Method
AAAAATAAATGTCAATCGTTTGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033608_2

>merge|NZ_CP033608|2|1053165-1053256|CRISPRCasFinder
AAAAATAAATGTCAATCGTTTGACATTCTTATATTGCTATTAAATAAGCCATTTAAATAATTTTGAAAAAATTAATGTCAATCGTTTGACAT

>NZ_CP033608|2|2|1053165-1053256|CRISPRCasFinder
AAAAATAAATGTCAATCGTTTGACAT	TCTTATATTGCTATTAAATAAGCCATTTAAATAATTTTGA
AAAAATTAATGTCAATCGTTTGACAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033608.1\|WP_141926817.1\|1063704_1064790_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133022
NZ_CP033608.1\|WP_042492616.1\|1043456_1043840_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|213772
NZ_CP033608.1\|WP_042492602.1\|1050579_1051563_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NZ_CP033608.1\|WP_042492604.1\|1049561_1050269_-\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP033608.1\|WP_137600775.1\|1051624_1053097_-\|sucrose-6-phosphate-hydrolase	unknown	unknown	gnl\|CDD\|273554
NZ_CP033608.1\|WP_052348386.1\|1059878_1061750_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033608.1\|WP_042492608.1\|1047523_1049038_-\|PTS-transporter-subunit-EIIC	unknown	unknown	gnl\|CDD\|273919
NZ_CP033608.1\|WP_042492614.1\|1043991_1044309_-\|membrane-protein	unknown	unknown	unknown
NZ_CP033608.1\|WP_137600774.1\|1059185_1059875_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225110
NZ_CP033608.1\|WP_141926815.1\|1057327_1057963_-\|proton-conducting-membrane-transporter	unknown	unknown	gnl\|CDD\|187579
NZ_CP033608.1\|WP_042492584.1\|1065331_1066963_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP033608.1\|WP_042492606.1\|1049055_1049544_-\|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376324
NZ_CP033608.1\|WP_042492612.1\|1044514_1045186_-\|beta-phosphoglucomutase	unknown	unknown	gnl\|CDD\|213672
NZ_CP033608.1\|WP_042492588.1\|1058016_1059177_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP033608.1\|WP_137600776.1\|1045192_1047499_-\|glycoside-hydrolase-family-65-protein	unknown	unknown	gnl\|CDD\|224471
NZ_CP033608.1\|WP_141926816.1\|1061753_1063715_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|274400
NZ_CP033608.1\|WP_042492594.1\|1055355_1056372_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176196
NZ_CP033608.1\|WP_042492596.1\|1053331_1055245_+\|PTS-beta-glucoside-transporter-subunit-IIBCA	unknown	unknown	gnl\|CDD\|131051
NZ_CP033608.1\|WP_042492592.1\|1056504_1057308_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP033608.1\|WP_141926814.1\|1042802_1043369_-\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|224527

Protein	Function_ID	Function_description	E-value
NZ_CP033608.1\|WP_141926817.1\|1063704_1064790_-\|glycosyltransferase	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	5.54905e-37
NZ_CP033608.1\|WP_042492616.1\|1043456_1043840_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|213772	TIGR03081, Methylmalonyl-CoA_epimerase_mitochondrial, methylmalonyl-CoA epimerase. Members of this protein family are the enzyme methylmalonyl-CoA epimerase (EC 5.1.99.1), also called methylmalonyl-CoA racemase. This enzyme converts (2R)-methylmalonyl-CoA to (2S)-methylmalonyl-CoA, which is then a substrate for methylmalonyl-CoA mutase (TIGR00642). It is known in bacteria, archaea, and as a mitochondrial protein in animals. It is closely related to lactoylglutathione lyase (TIGR00068), which is also called glyoxylase I, and is also a homodimer.	8.27018e-10
NZ_CP033608.1\|WP_042492602.1\|1050579_1051563_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	1.27465e-101
NZ_CP033608.1\|WP_042492604.1\|1049561_1050269_-\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	3.91757e-80
NZ_CP033608.1\|WP_137600775.1\|1051624_1053097_-\|sucrose-6-phosphate-hydrolase	gnl\|CDD\|273554	TIGR01322, Sucrose-6-phosphate_hydrolase, sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	2.10851e-172
NZ_CP033608.1\|WP_042492608.1\|1047523_1049038_-\|PTS-transporter-subunit-EIIC	gnl\|CDD\|273919	TIGR01995, beta-glucosides_PTS_EIIBCA, PTS system, beta-glucoside-specific IIABC component. This model represents a family of PTS enzyme II proteins in which all three domains are found in the same polypeptide chain and which appear to have a broad specificity for beta-glucosides including salicin (beta-D-glucose-1-salicylate) and arbutin (Hydroquinone-O-beta-D-glucopyranoside). These are distinct from the closely related sucrose-specific and trehalose-specific PTS transporters.	1.38732e-144
NZ_CP033608.1\|WP_137600774.1\|1059185_1059875_-\|EAL-domain-containing-protein	gnl\|CDD\|225110	COG2200, Rtn, c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms].	4.59595e-20
NZ_CP033608.1\|WP_141926815.1\|1057327_1057963_-\|proton-conducting-membrane-transporter	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.18997e-07
NZ_CP033608.1\|WP_042492584.1\|1065331_1066963_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP033608.1\|WP_042492606.1\|1049055_1049544_-\|PTS-glucose-transporter-subunit-IIA	gnl\|CDD\|376324	pfam00358, PTS_EIIA_1, phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1.	9.04345e-51
NZ_CP033608.1\|WP_042492612.1\|1044514_1045186_-\|beta-phosphoglucomutase	gnl\|CDD\|213672	TIGR01990, bPGM, beta-phosphoglucomutase. This model represents the beta-phosphoglucomutase enzyme which catalyzes the interconverison of beta-D-glucose-1-phosphate and beta-D-glucose-6-phosphate. The 6-phosphate is capable of non-enzymatic anomerization (alpha <-> beta) while the 1-phosphate is not. A separate enzyme is responsible for the isomerization of the alpha anomers. Beta-D-glucose-1-phosphate results from the phosphorylysis of maltose (2.4.1.8), trehalose (2.4.1.64) or trehalose-6-phosphate (2.4.1.216). Alternatively, these reactions can be run in the synthetic direction to create the disaccharides. All sequenced genomes which contain a member of this family also appear to contain at least one putative maltose or trehalose phosphorylase. Three species, Lactococcus, Enterococcus and Neisseria appear to contain a pair of paralogous beta-PGM's. Beta-phosphoglucomutase is a member of the haloacid dehalogenase superfamily of hydrolase enzymes. These enzymes are characterized by a series of three catalytic motifs positioned within an alpha-beta (Rossman) fold. beta-PGM contains an inserted alpha helical domain in between the first and second conserved motifs and thus is a member of subfamily IA of the superfamily. The third catalytic motif comes in three variants, the third of which, containing a conserved DD or ED, is the only one found here as well as in several other related enzymes (TIGR01509). The enzyme from L. lactis has been extensively characterized including a remarkable crystal structure which traps the pentacoordinate transition state. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	8.60265e-84
NZ_CP033608.1\|WP_042492588.1\|1058016_1059177_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	4.88459e-39
NZ_CP033608.1\|WP_137600776.1\|1045192_1047499_-\|glycoside-hydrolase-family-65-protein	gnl\|CDD\|224471	COG1554, ATH1, Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism].	0
NZ_CP033608.1\|WP_141926816.1\|1061753_1063715_-\|glycosyltransferase	gnl\|CDD\|274400	TIGR03030, Cellulose_synthase_UDP-forming, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.	2.51644e-75
NZ_CP033608.1\|WP_042492594.1\|1055355_1056372_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176196	cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.	6.75967e-174
NZ_CP033608.1\|WP_042492596.1\|1053331_1055245_+\|PTS-beta-glucoside-transporter-subunit-IIBCA	gnl\|CDD\|131051	TIGR01996, Includes:_Phosphotransferase_enzyme_IIB_component, PTS system, sucrose-specific IIBC component. This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).	0
NZ_CP033608.1\|WP_042492592.1\|1056504_1057308_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	2.98741e-110
NZ_CP033608.1\|WP_141926814.1\|1042802_1043369_-\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|224527	COG1611, COG1611, Predicted Rossmann fold nucleotide-binding protein [General function prediction only].	3.49784e-46

>NZ_CP033608.1|WP_137600775.1|1051624_1053097_-|sucrose-6-phosphate-hydrolase
MAWTREQRYQDYSNYSETLIDGLEKQADTSRYKPKFHISPKSGLLNDPNGFSFFDGQWHVFYQAFPFGPVHGLKSWVHCTSDDLVHWHNLGVALPAGDRYDLHGAYSGSAQVIGDRLFLMYTGNVRTQDWQRKSYQNGAWMDKDNQVTKVTKPLIEQPAYVTDHFRDPQLLKVNHEYYALIGAQDKQTLQGEMSLFQSSDLKTWHDRGYVKHNLNNLGYMVECPNLIDVDNKKVLIFCPQGLPQNELATANIYPNVYAISDHFDFEQNIFQADSNKMVQLDDGFDVYASQAFNAPDGSAYLISWIGLPEITYPTDQENWAHCLSLVKQLKIIDGKLYQKPVAAMAKLRDNEQILPKKERVLVENAGQQYELKLTLGANQIGNLLLASDGTTEHALQLKFDTTEGYLLVDRANVGEKFATEFGEQRQIGLTPNKSLTLDIFVDHSVCEIFVNGGQKVMTLRYFAENTHTTIAFSNEEIRDYSGQYFTLQDM
>NZ_CP033608.1|WP_042492602.1|1050579_1051563_-|LacI-family-transcriptional-regulator
MKPKLSDVAKEAGVSPTTVSRVINNHGYLSAQTKQNVFDAMEKLHYQPNSLARSLKGKKTRIIGLIFPGITNPFFSELIEKLEKSLFLQGYKVILCNSADDIEKERDYLKMLLANQVDGIITGAHNLGIMEYQNTNLPIISFDRRYADKMPTISSDNLQGGILATQTLYDAGARHIYFMGNPDQKGNPTDKRLQGYYQQMDFLGLDRHVFPIYFDDTPMIKQTSIKRLLEQGQADGIVCSDDLTAILVLQVAAMLKIKVPDKLKVIGYDGTDFMRTYFPDLTTIVQPLDDIVMMLVKMLIRRIDNGNQPIDEGDFVLPVSLYRGTTI
>NZ_CP033608.1|WP_042492604.1|1049561_1050269_-|trehalose-operon-repressor
MEKYQKIYQDLLKDLHNQVYLPGDFLPSDGKLVMRYKVSRETVRKAVKSLANDGYVQRLPGKGSVVLDRKHFVFPVSTLESYREMVSQANLNASNDVISIEPDVEIPENLTLSESSILATLVERRRRVDGEATVLDYDYVNQETVATVPYDAAQNSLFDYFENQLGLQIDYAIKRMTVEKSNLRDRQLLQVDEKMAMVVIRSETRLADNRILSYTESRHRADRFTSVEFARRRKV
>NZ_CP033608.1|WP_042492606.1|1049055_1049544_-|PTS-glucose-transporter-subunit-IIA
MFGFGKKKVVENDVNLYAPVTGELINLENVSDPVFAGKMMGDGFAVEPNSGNVVSPVAGEVTLQQGHAVGIKRVDGLEILVHIGIDTVSLNGAPFAPQVKVGDIVSGGDTLSVVDWQSIETAQLPKTTMVLITNSADKLDNLTTNVGSVTAGEQVGQAIAIN
>NZ_CP033608.1|WP_042492608.1|1047523_1049038_-|PTS-transporter-subunit-EIIC
MAKQDYDALAKDIITNVGGKENVDKVIHCITRLRFYLKDEKKADSAAISDLDGVAGAVYNSQLGQYQVVIGQAVEDVYDKVIDQLGDDVVDAEATEAAVEATGGATGGSNKPKGFFGTIKYGFQLLIGTITGSMMPVIGLLAASGILKGFLTLFTFNLGWIDESSTTYQIINTMGDSTFYFLPILVGYTAAKQLKSDPIIVAAIAGVLVHPTMVDLGAKTSKNFTEFLGVTMNATFLGLPIHIPSYTYSIFPIIFAAWLARPVGNWFKKVLPLSLRSIFQPLFTLFIVSMVVLVVVGPVITLISSGLAAFINWIVTLNQAIAGLLIGGLYQVLVIFGLHWMIVPLISNDIAQTGHSVLNGLINFTMIAQGAGALAVWAKSKITNIKSLALAGALSGFAGVTEPAMYGINLKYGRVFWMANIGGAVGGLIAGLFKVDMFGFTGSWIGFPSFFSKTNPNNIWYFVIAGVVTTVVSFIAVYFWGFKDSDVKAAKEAEQKNVFKDAVQ
>NZ_CP033608.1|WP_137600776.1|1045192_1047499_-|glycoside-hydrolase-family-65-protein
MSQNNWQLVYDNLTDGVRSYGEESLLTLGNGYLGWRGAPVMTSYSDDHYPGLYVAGIFNQTTTPVAGRDVVNEDLVNLPNPQLINLFVDDELVSFEPTARESILHFDTGLLSEKFTLPTAKGDLILETQKVVNPYKMHQLALNISISGDFNADVTVQAVIDGTVENKNVKRYRDFESREFDVTDMTDSVLTAQTKQSKIILAVGAKTTSGDAEFVSTQADNQIVTQAQFKLTPDSVINIDRIIGVATSYEEDNPVEVVTQQLTDTFADIKADVQKYWQGVWQDNDIVLDSDDADLQRMIRMNIFHMHQSAQHNANQYLDASVGSRGLTGEGYRGHIFWDEIFVVPYLAANDPAAAKDILKYRLTRLHGAQLNAQSEGEVGAMYPWQSGMTGDEQAQIIHLNTVNNKWDADNSRLQRHVSLAIVYNLWIYVQMTGDESILREGGLDVVVETSKFWLNKAQLEEDNRYHIAGVMGPDEFHEAYPNSETGGIKDNAYTNLMLTWALNWLQELGANQQLPDIDPSLLAEAEDVANKLALEINEDGVIAQYAGYFDLKPVDFDAYRAKYTDIHRIDRLMKAEGLSPDDYQVAKQTDLLMTIYNLGHQHMLQLIEQLGYSVPENWLQVNKDYYLARTVHGSTTSRPVFAGIDITLDNKEEALEFLTTAIGSDYYDIQGGTTAEGIHIGVMGETLAVVQNEFGGVNLRDGVVVINPNLPVGWRHLSFKQRFHGNLIAIDIVPGQVTVVADHDMAVTVYKQNVYLSANEPKLIEEV
>NZ_CP033608.1|WP_042492612.1|1044514_1045186_-|beta-phosphoglucomutase
MTNFTTIKGFAFDMDGVLADTAKFHTVAWHQIADEIGTTWTPELAESLKGIDRMGSLALIMAAGGVAEQYDQAEREKLAVKKNTHYRELISTLTPDDILPGMKSFLDELKAAGYQMSVASASKNAPFIIERLGLAHYFQAVVDPASVTAGKPDPAIFSAAADVLQLQPAEVIGIEDSSAGIQSINAAGETSVGIGDKNVLQEADINFATTADVTLTAIKSGWH
>NZ_CP033608.1|WP_042492614.1|1043991_1044309_-|membrane-protein
MNSETDKSSDRRRFIDSNRREKVVKVISELATIMCVLMYVSYIAEIKSNLAGNPVPLSQPLTMMLDAILWTGYGWLKQYRDWPLVISNVPGILFGIVTILTIYVH
>NZ_CP033608.1|WP_042492616.1|1043456_1043840_-|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MALTDYFSGLQHVGIPASSLTEAETFWTKLGFKKIGDFPVGNVIFMQRQNLVIEAWTGDDIVGKPGAINHISLDVTDAEAALVEAKKEGFNLIDHDIQHLPFWDKGIKFFNVQGPDGVIVEFCEIVK
>NZ_CP033608.1|WP_141926814.1|1042802_1043369_-|TIGR00730-family-Rossman-fold-protein
MKRIAVYCGATMGNDNAYQQATKQLADYLVEHNLELVYGGGGVGLMGMLANEVLTNGGKVHGIITEQLVQREVAFNKLTDLKVVESMSVRKDMMLKLSDACIALPGGPGTLEEIIEAFSWARLGNNPNPCVFFNVNGYYSPLEDMFDNMVITGFLTVADRQKLLFSDSLDEIFNFMAHYEPPQIRTYN
>NZ_CP033608.1|WP_042492596.1|1053331_1055245_+|PTS-beta-glucoside-transporter-subunit-IIBCA
MDHKKVANEIVDAVGKDNFAAAAHCATRLRLVIKDEGKIKQDALDNNDDVKGTFKTNGQYQIIIGPGDVNNVYDELIKIANVSPVSTEELKDLAQGNKKFNPIMAFIKLLSDIFVPIIPALVAGGLLMALNNFLTSEGLFGPKALVETLPAIQGLSAMIQLMSAAPFIFMPILVGISAAKRFGANQYLGAALAMIMVSPDLVANHNWDIFGLAVSQNNYYYQVIPVLAAVYILSIVEKFLHKKLPSAVDFTFTPLISLMVTGFLTFVVVGPVMRLLSDGITDGIVFIYGALGFVGTGIFGLLYSPIVLTGLHQSFPAIETQLISAFTQNHTGYGDFIFVVASMANVAQGAATFGVFALTKNKKMKGLSSSATVSALLGITEPALFGVNLKYKFPFFCALIGSGVAAALAGFMHVIAVSLGSAGFLGFLSINATSIPAYLLCEVVSFAVAFSLTYLYGKKNSAKMAVIDGVSAPVSDDIAPTTIVNDGDEIVAAPVSGVATDLSDVNDAVFSSKLMGDGGAIVPTENNIYAPITGTLTVVYETNHAYGIKGDNGIEVLIHLGIDTVNLKGQFFETNVTQGQHINVGDQLGSFDINKVAAADYDTTVITAITNTTDFNNVARLGNGDIEHGEQFVIVTP
>NZ_CP033608.1|WP_042492594.1|1055355_1056372_-|zinc-dependent-alcohol-dehydrogenase-family-protein
MEALVLTDIKKLEVEEIDRPNVLPDEVLIHTAFAGICGTDHALYAGLPGSTDAVPPIILGHENSGVVAEVGDAVTNVKVGDRVTVDPNIYCGQCKFCRTGRPELCENLSAVGVTRDGGFADYFTAPASVVYQIPDNVSLKSASVVEPISCAVHGIKLLKVSPYQKALVIGDGFMGELFVQLLQAYGIHQVDLAGIVDEKLAMNKEKFGVTNTFNTNTGDVIPAESYDIVIEAVGMPQTQEEAIAAAARGAQVLMFGVGGPEAKFEMNTYEIFQKQLTIQGSFINPNSFEDSLALLSSGKLNVEPLMSHELDYKTVDDFVNGKLGVVSKAVVKVNGEEA
>NZ_CP033608.1|WP_042492592.1|1056504_1057308_-|type-I-methionyl-aminopeptidase
MITLKSNREISGMAHSGQILAGAHLALRDKIHVGMDTWEIEEIVNQYILDHDATPSEKGFEGYKYATCISINNEVAHATPRKGLKLKNHDIVTVDFCVNWHGYESDSAWTYVVGESTPEIDHLMDVTLKALYLGIDQAQVGNRLGDIGFAIQDFVENKNHMGDVRDLIGHGIGPTMHEEPNVFHYGVPHKGLRLKAGMVITIEPMVNAGGDWEIRTEVVPETGWEYYVSADDSLSAQYEHTLAITNDGPKILTSQDPIMDAKYLWQD
>NZ_CP033608.1|WP_141926815.1|1057327_1057963_-|proton-conducting-membrane-transporter
MKITIMGGTGYLGQGILAGFVNSKYNHELISLSRSGMGNKQNLVMPVSYLAVDFSHDGNWQSVVTTSDIVIDCVGILIPSKRKQTSYEKNSIEPAKKVIDQLQVKTDKTKFIFIAANNAPRLLDDYLKAKQEVIDYGQKKLDNRFIAVYPGMVYDLQRLGNFIPGILLNIAINGFKIPFLKKYRPAKRSVFSQEIVKIAAGQSSPLTKIIR
>NZ_CP033608.1|WP_042492588.1|1058016_1059177_-|GGDEF-domain-containing-protein
MTDIFDVLITQCNALFIILATVAIDFILRPWFATSKYSRFLMKTVMAFRILNPCLAMLIVTVTFLQRDTIFDKLTSISVGVAMFFYFSSLLRKKWFINLNNLLVMLIFLSCVYGNIPTASNGHEQFLLLISILGTYTLLIINYFRFDYEIMVVKWQLTSFKFIIIYSMGWWSIFLVDTNLTLKMYIGQVLLSIVYIIVIIFMDKGINKQLQIKLREIAQDFLTGIGDRTIFERELTKLFNNNDKTNNHLVLFDIDRFKQINDEYGHSMGDSALRIVSQTVIDELDVLQLDENFFRVGGEEFALLFSGLNKQKVIHTVSKIRDSINQLDLINTNDKPIKITLSIGIAKCSQTDQDKQTLYKRVDSYLYIAKNTDKNLINYEGENINE
>NZ_CP033608.1|WP_137600774.1|1059185_1059875_-|EAL-domain-containing-protein
MGDFYFVGQQIIDAKSREVREVELLLRATNKVGFPEQEFHNLLNSSLKQYQAYLKDLNNELMYLWDKYPTCQFSLNFTQQELEFPVLLTYLKSINTNMRARMMIEITEQAPNKKYTEYSDNINVSMFKKIHDLGYKIALDDIMQGNNSLGNFMLVRPYISRIKWSFTNGGHYLNQQQIYWIIKLLRSLTCEKGISLVVEGVEEEMISYWLLTMNVHQQQGFLFAKPAKL
>NZ_CP033608.1|WP_052348386.1|1059878_1061750_-|hypothetical-protein
MIVLASLFFCLATGGYRQLAMFLGSNRYLSWLLAIIIQSMMVYLAALIGQLKFGIWLTFLLGMLLFLSTFIKNVCSRETTIKLHVFDAWFIIFGFLMIIALYHSSLIHYDNFSHWATIVKYLTFVGQLPDAHQNLVTFTDYPPATAMFLTYITSIVGYHEGILLIGQFMMIWASAYALFGGLRDPKRAVITASLLTIISLLNIFNIAIRMNNLLVDFLLALLAATGMVAVYCEKKKPKLQSMSVILIVNFLLLTKSSAIYFGILILVYFAITRFKEMSLKVNKIKTIFTVICHIIVTILLSFLGWMYWRLHVAHVFTAASKHALNLQAYENQVSHESQNTKLLIIKKIVAYLFNVDTLFFKGFLLINVALLVTWGIIRFLLHKKSFSFKMLFITNGIILLYIIGVLVMFLVSMPYNEAITLAGIDRYLSTIIVFSITTAGLVILNDCDLASFQPDILLRDAKNFASLRTKQLYQETTFILILIASVLMLSEINGINFNARESRQALPVKLHEMLPNQIKFNHKKILLVDVNASDVANSYTQFVGRYYMFNDQVIGREAFDMSTSKFKDLVSQYDYIVIPEKHQTFSLLAKRAYHQKIGAGIYKSNPDNLQIVSAKKYMNEVNE
>NZ_CP033608.1|WP_141926816.1|1061753_1063715_-|glycosyltransferase
MQLKLYKKVLSILAVVLTIIYLIWRIFFTIPSYQHHEFAFVFAIALLVSEIISNFTAFILIFLRLRFNKKHNNELALPEISQYTKWPDIDVIIVTHDEEISLLQKTVNAANMTPGYEQKVNIVIADDGNRLAVEKLAMDYHVKYIDMPEKNNAAKAGNINHALQQLSAPLVAVFDADMIPFKTFLLHSIPYFIKNDYEQQEDENIKKLGFLQTPQSFYNADIFQYNLFSEKTATNEQDFFSRDINVLNGSNGAAIFTGSNAVFSRDAINDAGGFPEKTLTEDFELGVRINMANYTSMATEIPESSGITPMDVKSVIKQRIRWARGVTQSARNIHIFFNRKLPFINRMILTNVYLYWWSFMRRLLFILAPILFAIWHVQVVDANFWVLLLFWAPGYFLLHYVMGMSNTNIRGERWGEIQETFFAPYLWLPVLLETFGIKQTKFKVTDKNNGQSTRALLYGVPYLILWLLDVWALIVFNYGKWGSEIMYGAVISFWLLTHLVNLTFSLYLAWGRQINRKFERFAREIHGIIINNDQVESVIETIDVSDRGLSFKSPGPLLLRIGDHVMGTLYYNDESIQFTGIIRVTYSNNKYGLSIENMTDENQNKFYSLIYDGQNMSLPWKQDAWMTIYDALLINMIYHLKNSWHRISTKRNG
>NZ_CP033608.1|WP_141926817.1|1063704_1064790_-|glycosyltransferase
MNNKLCDIAILIPAFNPDEKLLKLLFEIHQQKGFNQDIIIINDGSEDDLIFSKIQQNYSKVKILTHEKNRGKGQTLKTGFNFILTNKTNIKGVATIDSDGQHKVVDLKKLEHHFMKHMNDLIIGSRNFGKDVPLRSKVGNIVTNQLVNLLTGIKVSDTQTGLRIVPIKYIKQLITFSSNRYEFEFDMLLATKKAGINIREVPIQTVYLDNNATSHFRVIADSLSIYSRFFKFAFSGMGSFLIDIVCFYIFIYLMVGKSGNAILLATIIARLCSAIFNYIMNKKFVFSTSNSQPLIKYVVLMLSQMLISGLLTTLLTHLARQMYETGWITLIKIIVDSFLFLISYQIQKHIVFKKVVRSNAA
>NZ_CP033608.1|WP_042492584.1|1065331_1066963_-|peptide-ABC-transporter-substrate-binding-protein
MRNIGKITALAASVTMIGSVALPAITASAATTGKTINWSEVAALPTMDPAKSTDTVSADAIGATGLPLVQFGKGNKLENEAAKSYEKSSDGLTYTFHLRSGLKWENGEALTAKDFVYGWQRSIDPKTASEYAYLLDSVKNAQAIQDGDKQPTDLGIEAVDDHTLKVTLESPSSYFLQEITMPVFFPQNEKFVKEQGSKYGTSAKTYLSAGPYKLKGWSGSNNKYSYVKNDKYFDAKKVKTNKIAVQTIKDQNTGYNLYQGKKLDFTPLSPDQVKASKNKSGYKEIKTGATQALQMNQEKVPEFKNTKIRQAISYAINRQTLSDKIVTGSAIPATTYTPKGLVKNPNNNKDFATDAEVKGAIKFDKKKAANLFKEGLKEEGKSDLSVQLLTDDDDTSKRVAQFLQEQLEQNLKGMDVSIKTVPKKQRLKLSTDGDFQMLNFGWLADYPDASSFLDLYKSDASYNYGKWQNADYDATLENAEGKNANDKKAQYDDFKKAEQILEKEAGVAPLYYRSTASLLNPKVKGVIANPTGAPFNFKYAVKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033608_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033608_3

1670564-1670725

Orphan

Consensus_repeat	Method
AAGACGTCGCGTTCTCAGCGCGGAATCCAGGGTTCGACTCCCTGTTGGGCTAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033608_3

>merge|NZ_CP033608|3|1670564-1670725|CRISPRCasFinder
AAGACGTCGCGTTCTCAGCGCGGAATCCAGGGTTCGACTCCCTGTTGGGCTATTTCTAAATAGCTTCGGCTAACAAATATTATCATCATGGCCCAATGGTCAAGTGGTCAAGACGTCGCGTTCTCAGCGCGGAATCCAGGGTTCGACTCCCTGTTGGGCTAT

>NZ_CP033608|3|3|1670564-1670725|CRISPRCasFinder
AAGACGTCGCGTTCTCAGCGCGGAATCCAGGGTTCGACTCCCTGTTGGGCTAT	TTCTAAATAGCTTCGGCTAACAAATATTATCATCATGGCCCAATGGTCAAGTGGTC
AAGACGTCGCGTTCTCAGCGCGGAATCCAGGGTTCGACTCCCTGTTGGGCTAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033608.1\|WP_042491991.1\|1663752_1665204_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|181973
NZ_CP033608.1\|WP_042492013.1\|1680105_1680831_-\|DUF4811-domain-containing-protein	unknown	unknown	gnl\|CDD\|374344
NZ_CP033608.1\|WP_042492000.1\|1667493_1668183_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP033608.1\|WP_042492015.1\|1680953_1683413_-\|phosphoketolase-family-protein	unknown	unknown	gnl\|CDD\|235379
NZ_CP033608.1\|WP_042492018.1\|1683559_1684291_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP033608.1\|WP_141926931.1\|1669685_1670357_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP033608.1\|WP_042492010.1\|1677366_1677807_-\|CopY/TcrY-family-copper-transport-repressor	unknown	unknown	gnl\|CDD\|131745
NZ_CP033608.1\|WP_042492001.1\|1668391_1669678_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP033608.1\|WP_042491983.1\|1660736_1661831_-\|DUF871-domain-containing-protein	unknown	unknown	gnl\|CDD\|377567
NZ_CP033608.1\|WP_042491986.1\|1661932_1662250_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP033608.1\|WP_141926930.1\|1665208_1665535_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|376749
NZ_CP033608.1\|WP_141926932.1\|1674756_1676676_-\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP033608.1\|WP_137600378.1\|1671784_1674481_-\|bifunctional-acetaldehyde-CoA/alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|237515
NZ_CP033608.1\|WP_042492012.1\|1678061_1679957_-\|endopeptidase	unknown	unknown	gnl\|CDD\|226118
NZ_CP033608.1\|WP_042492007.1\|1676684_1676954_-\|copper-binding-protein	unknown	unknown	gnl\|CDD\|226980
NZ_CP033608.1\|WP_042491996.1\|1665559_1665877_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP033608.1\|WP_042492004.1\|1670854_1671685_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197321
NZ_CP033608.1\|WP_042492009.1\|1676982_1677354_-\|copper-binding-protein	unknown	unknown	gnl\|CDD\|226980
NZ_CP033608.1\|WP_042491998.1\|1665897_1667355_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|181973
NZ_CP033608.1\|WP_042491988.1\|1662413_1663706_-\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372

Protein	Function_ID	Function_description	E-value
NZ_CP033608.1\|WP_042491991.1\|1663752_1665204_-\|6-phospho-beta-glucosidase	gnl\|CDD\|181973	PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed.	0
NZ_CP033608.1\|WP_042492013.1\|1680105_1680831_-\|DUF4811-domain-containing-protein	gnl\|CDD\|374344	pfam16069, DUF4811, Domain of unknown function (DUF4811). This family of proteins is found in bacteria. Proteins in this family are typically between 188 and 241 amino acids in length. There is a single completely conserved residue Y that may be functionally important.	1.46168e-07
NZ_CP033608.1\|WP_042492000.1\|1667493_1668183_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.6137e-50
NZ_CP033608.1\|WP_042492015.1\|1680953_1683413_-\|phosphoketolase-family-protein	gnl\|CDD\|235379	PRK05261, PRK05261, phosphoketolase.	0
NZ_CP033608.1\|WP_042492018.1\|1683559_1684291_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.89697e-55
NZ_CP033608.1\|WP_141926931.1\|1669685_1670357_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	3.99753e-44
NZ_CP033608.1\|WP_042492010.1\|1677366_1677807_-\|CopY/TcrY-family-copper-transport-repressor	gnl\|CDD\|131745	TIGR02698, Uncharacterized_16.5_kDa_protein_in_ptsI_3'region, copper transport repressor, CopY/TcrY family. This family includes metal-fist type transcriptional repressors of copper transport systems such as copYZAB of Enterococcus hirae and tcrYAZB (transferble copper resistance) of an Enterocuccus faecium plasmid. High levels of copper can displace zinc and prevent binding by the repressor, activating efflux by copper resistance transporters. The most closely related proteins excluded by this model are antibiotic resistance regulators including the methicillin resistance regulatory protein MecI. [Transport and binding proteins, Cations and iron carrying compounds, Regulatory functions, DNA interactions].	3.27838e-49
NZ_CP033608.1\|WP_042492001.1\|1668391_1669678_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	1.08649e-154
NZ_CP033608.1\|WP_042491983.1\|1660736_1661831_-\|DUF871-domain-containing-protein	gnl\|CDD\|377567	pfam05913, DUF871, Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.	8.15991e-179
NZ_CP033608.1\|WP_042491986.1\|1661932_1662250_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.08839e-39
NZ_CP033608.1\|WP_141926930.1\|1665208_1665535_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|376749	pfam02255, PTS_IIA, PTS system, Lactose/Cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The lactose/cellobiose-specific family are one of four structurally and functionally distinct group IIA PTS system enzymes. This family of proteins normally function as a homotrimer, stabilized by a centrally located metal ion. Separation into subunits is thought to occur after phosphorylation.	2.78164e-36
NZ_CP033608.1\|WP_141926932.1\|1674756_1676676_-\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP033608.1\|WP_137600378.1\|1671784_1674481_-\|bifunctional-acetaldehyde-CoA/alcohol-dehydrogenase	gnl\|CDD\|237515	PRK13805, PRK13805, bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional.	0
NZ_CP033608.1\|WP_042492012.1\|1678061_1679957_-\|endopeptidase	gnl\|CDD\|226118	COG3590, PepO, Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP033608.1\|WP_042492007.1\|1676684_1676954_-\|copper-binding-protein	gnl\|CDD\|226980	COG4633, COG4633, Plastocyanin domain containing protein [General function prediction only].	1.11613e-16
NZ_CP033608.1\|WP_042491996.1\|1665559_1665877_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	1.21976e-40
NZ_CP033608.1\|WP_042492004.1\|1670854_1671685_-\|exodeoxyribonuclease-III	gnl\|CDD\|197321	cd09087, Ape1-like_AP-endo, Human Ape1-like subfamily of the ExoIII family apurinic/apyrimidinic (AP) endonucleases. This subfamily includes human Ape1 (also known as Apex, Hap1, or Ref-1) and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and they belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER, the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Ape1 and Ape2 in humans. Ape1 is found in this subfamily, it exhibits strong AP-endonuclease activity but shows weak 3'-5' exonuclease and 3'-phosphodiesterase activities. Class II AP endonucleases have been classified into two families, designated ExoIII and EndoIV, based on their homology to the Escherichia coli enzymes exonuclease III (ExoIII) and endonuclease IV (EndoIV). This subfamily belongs to the ExoIII family; the EndoIV family belongs to a different superfamily.	2.87957e-123
NZ_CP033608.1\|WP_042492009.1\|1676982_1677354_-\|copper-binding-protein	gnl\|CDD\|226980	COG4633, COG4633, Plastocyanin domain containing protein [General function prediction only].	1.79303e-36
NZ_CP033608.1\|WP_042491998.1\|1665897_1667355_-\|6-phospho-beta-glucosidase	gnl\|CDD\|181973	PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed.	0
NZ_CP033608.1\|WP_042491988.1\|1662413_1663706_-\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	2.61497e-150

>NZ_CP033608.1|WP_141926931.1|1669685_1670357_-|histidine-phosphatase-family-protein
MSFNLYFVRHGQTIFNHYERMQGWSNAPLTDKGISDGYAAGDRLETIRFDGAYSSDLQRAIQTAEFVLSRNKQSGDLKEPEQLQQFREQFFGFFEGLPSKKSSQLVAEKNGFQNMDTYGDLMANLSQDEVMDAMHAADPTGDAEDAQMFWVRVEKGLEQLRRNTRDGQNVLIVSHGTLIRNLVAKYASHEQAAEKPENGSITIFEVSDEGMKLKTYNDTTTKW
>NZ_CP033608.1|WP_042492001.1|1668391_1669678_-|GTPase-HflX
MIENEQHPKRQVILAGLDQQNENFDYEMTELANLAAANNMIVVGQLIQKLERPNASTYFGKGKVTELKEALEYYGAEMVVTNDELSPSQIRNLEAGTQADIMDRTALILDIFASRAKTKIAKLQVAIAQLKYQLPRLRTSMNVRLDQQTGGGGGSFTSRGAGETKLEMNRRHIQHQISLMQAELTNIEADDETRRAYRAKQSIRNVALVGYTNAGKSTIMNALVKRFGDNKEKTVFQADMLFATLETSVRKIQLPDNQNFLLSDTVGFVSKLPHGLVAAFRATLAEAADADLLIQVVDYADPHYQEMMATTAKTLKEIGVGDIPMVTVYNKADQIPEQAYPDRTGDTLILSALDSKSQDALVDVVKEHIFADYITTTLHIPFSDGQLVSELNEQATVHELDYDESGTVMKVTLTPIQVARFEKYQVNE
>NZ_CP033608.1|WP_042492000.1|1667493_1668183_+|GntR-family-transcriptional-regulator
MLKYQKIAEQLFSFIKSNHLKQGDPLPSLTKLIQEYGASKTTVLKALDQLERDGFIYQVQGSGTFVRDIPDEHFINFNVSHGWTTDFTKTKLDNSDVTVEKTYPTRSVASHLQCAIDTPIFKVQRLKTQDGKIFCFETSNYNTNFVPFLNKEIAKASIFHHISDAYQINVGFSDKYFKVRQLTAFESDKLNLPQGSFGLAVQETFYTTSGEIFDFSENVYHYENATFYI
>NZ_CP033608.1|WP_042491998.1|1665897_1667355_-|6-phospho-beta-glucosidase
MGLKLADNFLWGGAIAAHQAEGAWNKDGKGVSIADILTAGANNKPREITDGVIAGNNYPNHHGIYFYDTYKEDLALMAEMGFKAFRTSIAWTRIFPNGDDAEPNEAGLKFYDDMFDEMNRLGIEPVITLNHFEMPYHLVKEYGGWSNRKVIDFFVKYATTVFTRYNGKVKYWMTHNEISNQANLDDDMMSEFMIWTNSGLQFKKDATATEKLAGMVQAAHYELVASAKAVQIGHAINPEFVIGGMLNVAPLYPASPKPADMLATQKARQLHDWFSDVHIRGTYPAEFEAFAARTGYRSDITQADREVLKAGKVDYLAISYYNSTVIKAKSDADTDFEDVQGYEVVQNPEVPVSDWGWAIDPQGLRYTLNELNDQYPGLPIMIVENGFGAYDDVIDGKVHDQYRIDYLKAHIAEVEKAVVKDGIPVIGYLSWGPIDIVSAGTGEMSKRYGYIYVDLDDMGEGSGKRLRKDSFDWYKQVIASHGTDL
>NZ_CP033608.1|WP_042491996.1|1665559_1665877_-|PTS-sugar-transporter-subunit-IIB
MADKKIMLACAAGMSTSLLVTKMQEAAKAGGKDYEIFAKSTADIDNELSSSDKPDVLLLGPQVSFMKKEVKAKTDAAGIPMDVINMMDYGMMKGDKVLATAEALL
>NZ_CP033608.1|WP_141926930.1|1665208_1665535_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MDDARMEVVMGLIMHGGNAKGQAYQAIQLAKDGKFDEADEAIAAASQELKAAHDVQTDMLTKEAQGEHTEIDLYMVHGQDHLMNAITFKDMAVELIALMKRVSELEDK
>NZ_CP033608.1|WP_042491991.1|1663752_1665204_-|6-phospho-beta-glucosidase
MSSGYKMPDGFLWGSAVAAHQLEGAWDVDGKGVSIADVMLAGNKDTPRVVTDTVEPGGNYPNHRGIDFYHTYPQDFKMMKELGLKAFRTSIAWTRIFPNGDEAEPNEAGLQFYDNMIDEMLANDIEPVITLSHFEIPYHLVTEYGGFSNRKVIDFFVKFSDTVIRRYGDRVKYWMTFNEITNQTAWMDPHPMLQNSGLKDYKEDEAQELMYQASHYELVASALVTKHAHEIAAELHADIQVGCMLSMNPVYPASTKPEDILMAQRAMQTRYYWGDVHANGHYPNWLKNFWQHKGFHLDITKEDETILAENTVDYVAFSYYMSWTVSDTGDEWLEYNEDENHGDNPFLEKSDWGWQIDPVGIRWAMNWMWDRWHKPMFIVENGFGAYDKLTEDNQIHDDYRISYFQRHIKAMEQAVALDGIPLYGYLPWSGIDVVSASTGEMLKRYGFIYVDLDDMGEGTGKRYYKDSFKWYQKVISSNGADLG
>NZ_CP033608.1|WP_042491988.1|1662413_1663706_-|PTS-cellobiose-transporter-subunit-IIC
MAGSSSVLNEKIIPFFQKISGSRHLVALRDGMTAAVPMIIIGSVFMIIAQFPIQGYQDFMAHTFGANWATVVQYPTNASFHLMGLVAVAGISYNLAKSYRVEAFSSMIVAIGAFILTIPLKTDKAGDMWIPLKQLDSSGLFIAILVGLFVTDLYVWLVHKNLTIKMPSSVPPAVSNSFASLFPGALVLMVVWVIRMIVEATPMESIPNIITFVLQDPLSHLNNSLPGAIVVELIICLLWFFGIHGSNTVSGVMMPIWLGAMSQNAAAVQAGKEIPNIVTQQFYDNFIHMGGSGATLGLAFMIAFLSKSKELKTLGKLVVGPAMFNVNEPIIFGMPIVMNYKMVLPFILAPMANVITTYTAMSTGLVAKTMGIMVPWTTPPIISGYLATGHISGAVMQIINIVLDGAIYYIFFKSIDKDRLKEEIQTNEAA
>NZ_CP033608.1|WP_042491986.1|1661932_1662250_-|PTS-sugar-transporter-subunit-IIB
MADKKIMLACAAGMSTSLLVTKMKEAAKAGGKDYEIFAKSTADIDNELSSSEKPDVLLLGPQVSFMKKEVKAKTDAAGIPMDVINMMDYGMMKGDKVLAAAEALL
>NZ_CP033608.1|WP_042491983.1|1660736_1661831_-|DUF871-domain-containing-protein
MTKRQLGLSIYPDHSDFEEDKAYLILGHQYGFTRIFMSMLEVSGSAAETKLKYQRIVDFGNELGYETIIDVSPRIFDQLHISYDDLSFFNDLHVAGIRLDQSFDGATEALLSFNPYNLIIELNASNDVDYLNNIISHQANEPFIYGCHNFYPQVGTGLPYDYFIACSKRFKKYGIHTAAFVASQVGTIGPWNVNDGLPTLEMDRHLPIDVQAKHLFSTGLIDDVIIGNAYASEKELASLSRLNRYQLTLPVIFNDDVNDIEKTIALESQHFRRGDINETVIRSTMPRVTYQAVANQPHDNSQQFERGDVLIGNDDFGVYKNELQIVLEPHREPRKNKIGHISDDEIFLLDFIKPWIKFQLTAAD
>NZ_CP033608.1|WP_042492004.1|1670854_1671685_-|exodeoxyribonuclease-III
MKFISWNIDSINAAVEHKSARGEMTWQVLQDIAAQQPDVLAIQETKLKATGLTKKQATALDELFPGYHRYLRMSTGRSGYSGTMMLSRQEPISVTLPEIGAPGEMDIEGRVITLEFENTYVSTVYTPNSGSSLARLDDRQAWDDAYRAYIQQLDAQKPVIFSGDFNVAHQEIDLKNPKSNHKKAGFTDEEREHFGRLLDAGFTDTFRYLHPEESGVYTWWAQISKTSKINNSGWRIDYYLTSNRLANQLSELSVIDTGARQDHAPIMLTMTDDFKI
>NZ_CP033608.1|WP_137600378.1|1671784_1674481_-|bifunctional-acetaldehyde-CoA/alcohol-dehydrogenase
MMTTMNKKKKVLTPDEKAAHYAAAEEMTNKLVDQAAIALQKFATYTQEQVDKIVAAMALAGSENALLLAHEAYEETGRGVIEDKDTKNRFASESVYNAIKNDKTVGVISEDKIAGKVELAAPLGILAGIVPTTNPTSTAIFKSMLTAKTRNVIVFAFHPQAQKSSSHAAKIVYDAAVAAGAPKHFIQWIETPSIDATNTLIKNPKIASILATGGPSMVNAALHSGNPSMGVGAGNGAVYIDKTANVDRAVSDLLLSKRFDNGMICASENSVVIDVSIYDEMLQKLQEQGAYLTPKQDYQKISDFVFKPSADGYGVTGPVAGRSGRWIAEQAGLKLPVDKDVLLFELDKKHIGEPLSSEKLSPLLSIYKAQDRDEAVEIVRALLNYQGAGHNAAIQIGAQDDPFVKEYADRVEASRILVNQPDSIGGVGDIYTDALRPSLTLGTGTWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRLPKDIYYETNAITYLQELPDVDRAFIVADPGMVKLGFVDKILDQFALREDQVKTSFYGSVSPDPTISQAIDIARQMADFKPDTVVLLGGGSALDAGKIARFLYEYSATKPGILYDDDGLKSLFQQLAQKFMDIRKRIVKFEHQRLTQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLADYELTPQVAIVDPEFVMTVPSKTVAYSGMDALSHALESYVSVMSSEFTRPWALQAIKLIFDYLEASYHYDATQPTKEGELARTKMHYASTLAGMSFGNAFLGLNHAIAHKTGGAFGLPHGLAISIAMTNVIKFNGVTGNVKRTPFPRYETYTAQKDYADIARHIGLTGQDDAELVTALINKIKELAGHLDMDLTLSGNGVKKEDFDRELSGLMDLIYNDQTTPGNPRQPKLSEIKQLLNEQF
>NZ_CP033608.1|WP_141926932.1|1674756_1676676_-|copper-translocating-P-type-ATPase
MNITTRFWVSLILSLPMLLEMILMPFTHWMLPGGQMTMLILTTIVMLISARPFLSSAWASFQKHHSNMDTLIAVGTGTAYLYSIYAMFTGRAVFFESAAFVITFVLLGQVFEEKMRHNASSAIERLMDLQAKDALVKRNGEFVRLPLAEIVTGDLISVKPGQKIAVDGEIVAGSSTIDEAMVTGESMPVSKRVGDDVIGSTMNMSGNFVFKAKKVGNDTMLAQIVTLVKKAQSSQAPIQQLTDRVSDVFVPIVLVVAVLTFLIWYVFIGHDVANSLIFAVSVVVIACPCALGLATPTALMVGTGRGAKMGILIKDGEVLERANDIDTVVFDKTGTITVGQPKVTDIIGENQQVLMVAARLEAGSEHPLALAILDEAERQNFAVTSVENFEALSGKGVQALVDGQRAFVGNERLLTDFEVTDDLKRKMAQLQDEAKTVVLVGLQQKIIGLIAIQDTPKETSETAMSLLKDRGLRTVMLTGDNEHVARAIANEVGIDEVIANVLPAEKADQIKALQVDHTVAFVGDGINDAPALTTADVGIAMGAGTDIAIDAGGIVLVKNDLRDVNTALALSEKTFNRIKLNLFWAFVYNVLGIPVAAGVFYSFGFILSPEIAGVAMALSSLSVVISSVLLGKTKIVNNY
>NZ_CP033608.1|WP_042492007.1|1676684_1676954_-|copper-binding-protein
MSDVQNINVTVAGGYEPSVINLKQGVPAQITFTRTSTQGCLDVVHSNALNFETALPIDEPKTVMIPTKQAGEFNFSCGMDMFHGTIHIK
>NZ_CP033608.1|WP_042492009.1|1676982_1677354_-|copper-binding-protein
MIRIIVLIIGLILIGFIVWWFFGKHETQTESAAITNDQQDINVLVKGGYSPEQVVLKQGVPAQLHFKRTDPSSCLDHVVFPDFGINQALPENETQTIQIDTSEAGEYEWACGMNMFHGKVIIK
>NZ_CP033608.1|WP_042492010.1|1677366_1677807_-|CopY/TcrY-family-copper-transport-repressor
MQASDMSNAEWQLMRVIWTVKEATSSEIITAIRQKKDWSESTIKTLLRRLVQKEMLTTKKAGRRFIYRPLIAEDAAMIQMTSEVFERLCSMKKGHTLAELLTDMTLSKSDIMLLQKVLEQKIETAPASVACDCLGPNSCEQCTETV
>NZ_CP033608.1|WP_042492012.1|1678061_1679957_-|endopeptidase
MGTRQQDDFYEAVNEDWIAQAVIPNDKSRTGGFIDLADEIEELMLATTDKWLAGEDVPDDKVLSNFIKYHHLASDWETRNELGTQPVKPLIARYQNYDSFAEFANDITSLEKAGLPNALPLGIAPDFKDAQTYVLWADAMSTILPDTTYYEPGHPQGADLLKTWRSSQEALLAKFDFNTDEIKDLLDKAIAFDARVAKVVLSQEESAEYVKLYKPYKWADFTALAPELPLNEVVTAMIGEEPDMVVVPEERFWHAADQFFSEEAWPLLKATLIISIVNAYTGYLSDDVRVLGGAYGRALSGTPEAKSQKKSAYYLAEGPFNQALGLWYAHKMFSSEAKADVEDKVTKMINVYKERLQNTTWLQPATRDQAVVKLNAIKPHIGYPEKLPDYYEDKIVDEGASLLEAAQKFGRQGVAREWAKWHQTVDRDEWHMPAHMVNAYYDPQQNQIVFPAAILQAPFYSLDQSDSANYGGIGAVIAHEISHAFDTNGASFDEHGSLNNWWTDEDYAAFKERTQKVIEQFDGLDSYGAKVNGKLTVSENVADLGGLAAALAAAQREESFSAKEFFKNWATIWRMKARPELMKFFAAVDVHAPNKARTNVIVSNFSEFYETFDVQPGDNMYREPADRTMIW
>NZ_CP033608.1|WP_042492013.1|1680105_1680831_-|DUF4811-domain-containing-protein
MIVLLVLGIVLLAYAAIQGVVHHQVRWVPIVVGLLLTISMGFGVRHAQGQHFLMSEVPLTKTQKIQPAVTVNGFHLITTEQGAENRLRYTYKTNDKTYQTLTQQAKAEVVAGKKASLKTTVMTYQANSTWRRFLLLGQDTLEKGTTTYKLTLPEGWYVVPANKVDDLQKMVQDNENQLANQVRDEINKEVTAKVKADKDFIDDKAGQDKLKNNVVKKVTADSNKQLKVDMINQIAQWQKNN
>NZ_CP033608.1|WP_042492015.1|1680953_1683413_-|phosphoketolase-family-protein
MAVDFDSKAYLEKVDAWWRATNYLSAGMIFLKSNPLFSVTNTPIQADDVKVKPIGHWGTISGQTFLYAHANRLINKFDLDMFYIGGPGHGGQVMVTNSYLDGTYTESYPEITQDVDGMARLFKRFSFPGGIGSHMTAQTPGSLHEGGELGYSLSHATGAILDNPNQIAFTVIGDGEVETGPAMTAWHSIKFINPKNDGAVLPILDLNGFKISNPTIFSRMSDEEITKFFEGLGYSPRFIENDDIHDYMAYHELAAKVFDDAISDIQAIQKAAREDGRYADGEIAAWPVIIARLPKGWGGPTHNAAGEPIEDSFRAHQVPLPLAQGKMETLPEFEEWLNSYKPTELFNADGSLKEEIAAMAPKGDKRMAANYAANGGRRRGDAPTDLTLPNWKDFANEITAETRGTELADGSKNMDMNVLSNYFAEVSKLNPTSFRIFGPDETMSNRLWGMFEVTNRQWMEQVKEPNDQHQAPEGRILDSQLSEHQAEGWLEAYTLTGRVGVFASYESFLRVVDSMITQHFKWLRHASEQPWRNDYPSLNLISTSTAFQQDHNGYTHQDPGMLTHLAEKKADFIRQYLPADGNTLLAVFGRAFTERHKVNHVVASKQPRQQWFSVDEAEELATEGIKAIDWASTVAEGEDADIVFASAGVEPTIEALAALHLINEAFPAVKLRYVNVVELHRLLNKNGKMNHERALSDEKFNALFGESGTPVMFAFHGFEDLIESIFYERQHLGAHVHGYREDGDITTTYDMRVYSELDRFHQAKEAAQVLAAKGVIAADEAEAFDNKIDAILAKHFEVTRNEGHDIEEFTDWKWTALNK
>NZ_CP033608.1|WP_042492018.1|1683559_1684291_-|GntR-family-transcriptional-regulator
MAQEVLYMKVLNDLNRRINAQEFPDLKLPDERSLATSYGVSRSSIKRALNVLVRQGIIFKKRGSGTFVNPLYLKNQGMFHAVGHNLGVSDAFRFNGETPAIKLLVFEKDAANEEDKEALFLNASDEVYRIKRLRTLQNEAFMIENAVIPAKLLPALTAEDMTHSMFQYAEQTTKRAVTKSFMTITAEPSQDEDQKYLQLNANEPVGIMSGVFFLDDGTPFEVGQMRVHYKYMRYNSFVSLDGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

107563 : 121608

Lactobacillus_phage(25.0%)

terminase,portal

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042493177.1\|107563_107938_-	helix-turn-helix transcriptional regulator	A0A1P8BKQ2	Lactococcus_phage	1.6e-17	43.0
WP_052348421.1\|108072_108264_+	helix-turn-helix transcriptional regulator	Q4ZB05	Staphylococcus_virus	1.9e-06	43.1
WP_141926442.1\|108313_109063_+	oxidoreductase	E3W8C2	Leuconostoc_phage	9.4e-78	61.6
WP_141926443.1\|109067_109409_+	hypothetical protein	NA	NA	NA	NA
WP_141926444.1\|109411_109645_+	hypothetical protein	NA	NA	NA	NA
WP_141926445.1\|109750_110287_+	hypothetical protein	NA	NA	NA	NA
WP_141926446.1\|110273_110489_+	hypothetical protein	NA	NA	NA	NA
WP_141926447.1\|110726_111623_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	2.4e-11	26.0
WP_141926448.1\|111634_112603_+	hypothetical protein	NA	NA	NA	NA
WP_141926449.1\|112616_113327_+	hypothetical protein	D7RWH3	Brochothrix_phage	1.7e-36	36.1
WP_141926450.1\|113304_113625_+	hypothetical protein	A0A2H4JAS0	uncultured_Caudovirales_phage	2.8e-07	35.5
WP_141926451.1\|113802_114327_+	hypothetical protein	NA	NA	NA	NA
WP_141926452.1\|114327_114702_+	dTDP-glucose pyrophosphorylase	NA	NA	NA	NA
WP_141926453.1\|114776_114983_+	hypothetical protein	NA	NA	NA	NA
WP_092463971.1\|115149_115572_+	hypothetical protein	A0A0A7RUP7	Clostridium_phage	2.1e-10	34.0
WP_092463974.1\|115856_116288_+	hypothetical protein	A0A0M7RDP0	Lactobacillus_phage	3.2e-14	35.3
WP_141926967.1\|116466_117165_+	site-specific DNA-methyltransferase	A0A2P0ZL38	Lactobacillus_phage	9.4e-64	56.2
WP_141926454.1\|117225_117855_+	hypothetical protein	NA	NA	NA	NA
WP_141926455.1\|118062_118977_+\|terminase	terminase	V5URT8	Oenococcus_phage	2.4e-43	41.3
WP_141926968.1\|118954_120193_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.3e-124	54.7
WP_141926456.1\|120192_121608_+\|portal	phage portal protein	D7RWC6	Brochothrix_phage	6.1e-70	37.1

DBSCAN-SWA_2

520462 : 558475

Leuconostoc_phage(52.94%)

capsid,holin,head,tail,terminase,integrase,portal

attL 502695:502709|attR 538456:538470

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
502695:502709	attL	NA	NA	NA	NA
WP_141926551.1\|520462_521548_-\|integrase	tyrosine-type recombinase/integrase	E3W8I1	Leuconostoc_phage	6.2e-54	37.0
WP_141926552.1\|521709_522363_-	immunity protein	A0A0A1ERB0	Lactobacillus_phage	6.9e-08	64.6
WP_141926553.1\|522464_523076_+	hypothetical protein	NA	NA	NA	NA
WP_141926554.1\|523072_523261_-	hypothetical protein	NA	NA	NA	NA
WP_141926555.1\|523302_523659_-	helix-turn-helix domain-containing protein	E3W8B9	Leuconostoc_phage	1.2e-14	38.3
WP_141926556.1\|523936_524155_+	hypothetical protein	NA	NA	NA	NA
WP_141926557.1\|524167_524374_+	hypothetical protein	NA	NA	NA	NA
WP_141926558.1\|524350_524554_-	hypothetical protein	NA	NA	NA	NA
WP_141926559.1\|524634_525360_+	phage regulatory protein	D2IYT0	Enterococcus_phage	3.1e-41	41.7
WP_141926560.1\|525454_525745_+	hypothetical protein	NA	NA	NA	NA
WP_141926561.1\|525719_526073_-	hypothetical protein	NA	NA	NA	NA
WP_042492683.1\|526307_526508_+	hypothetical protein	NA	NA	NA	NA
WP_141926562.1\|526521_526755_+	hypothetical protein	NA	NA	NA	NA
WP_141926563.1\|526757_526964_+	hypothetical protein	NA	NA	NA	NA
WP_141926564.1\|527254_527467_+	helix-turn-helix domain-containing protein	A0A0A7RUJ5	Clostridium_phage	1.5e-09	45.6
WP_141926565.1\|527531_527720_+	hypothetical protein	NA	NA	NA	NA
WP_141926566.1\|527712_528132_+	hypothetical protein	NA	NA	NA	NA
WP_141926567.1\|528147_528783_+	hypothetical protein	NA	NA	NA	NA
WP_141926568.1\|528782_529493_+	hypothetical protein	A0A2D1GP81	Lactobacillus_phage	3.9e-33	36.6
WP_141926569.1\|529455_529977_+	single-stranded DNA-binding protein	A0A1B1SDU6	Weissella_phage	5.2e-35	65.5
WP_141926570.1\|530805_531546_+	ATP-binding protein	D2KRE5	Lactobacillus_phage	1.7e-26	36.7
WP_052348391.1\|531706_532165_+	hypothetical protein	A0A0P0IJF8	Lactobacillus_phage	3.6e-11	37.6
WP_141926571.1\|532248_532533_+	hypothetical protein	NA	NA	NA	NA
WP_141926572.1\|532718_533399_+	DUF1642 domain-containing protein	A0A1B1SDU5	Weissella_phage	9.3e-16	35.9
WP_141926971.1\|533398_533872_+	SAM-dependent methyltransferase	D2IZK8	Enterococcus_phage	2.1e-54	61.1
WP_141926573.1\|533876_534572_+	nicotinamide riboside transporter PnuC	A0A0A7NTY4	Lactobacillus_phage	1.5e-24	30.8
WP_141926574.1\|534643_534853_+	hypothetical protein	NA	NA	NA	NA
WP_141926575.1\|534990_535299_+	hypothetical protein	NA	NA	NA	NA
WP_141926576.1\|535348_535750_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_141926577.1\|535808_536420_+	hypothetical protein	NA	NA	NA	NA
WP_141926578.1\|536440_536881_+	DUF722 domain-containing protein	A0A097BYG4	Leuconostoc_phage	2.3e-15	38.2
WP_141926579.1\|537215_537764_+	hypothetical protein	NA	NA	NA	NA
WP_141926580.1\|537839_538139_+	hypothetical protein	A0A2I7RDL3	Vibrio_phage	2.5e-05	39.0
WP_141926581.1\|538438_538945_+\|terminase	terminase small subunit	A0A059NT97	Lactococcus_phage	4.0e-40	60.4
538456:538470	attR	NA	NA	NA	NA
WP_141926582.1\|538937_540227_+\|terminase	PBSX family phage terminase large subunit	Q597V9	Lactobacillus_virus	3.7e-183	70.8
WP_141926583.1\|540237_541731_+\|portal	phage portal protein	A0A097BYI8	Leuconostoc_phage	5.8e-244	84.7
WP_141926584.1\|541720_542677_+\|head	phage head morphogenesis protein	A0A097BYH6	Leuconostoc_phage	2.5e-123	69.2
WP_141926585.1\|542687_542930_+	hypothetical protein	A6MA87	Lactococcus_virus	1.0e-25	66.2
WP_141926586.1\|543098_543692_+	DUF4355 domain-containing protein	A0A097BYH4	Leuconostoc_phage	2.7e-35	49.7
WP_141926587.1\|543697_544528_+\|capsid	N4-gp56 family major capsid protein	A0A097BYD3	Leuconostoc_phage	3.1e-130	91.5
WP_141926588.1\|544508_544781_+	hypothetical protein	G8FUY7	Pediococcus_virus	5.2e-10	58.3
WP_141926589.1\|544830_545169_+\|head,tail	phage head-tail connector protein	A0A097BY74	Leuconostoc_phage	3.4e-43	80.4
WP_141926590.1\|545178_545493_+	hypothetical protein	A0A097BYD2	Leuconostoc_phage	3.3e-40	75.7
WP_141926591.1\|545482_545839_+\|tail	phage tail protein	A0A097BYB8	Leuconostoc_phage	5.9e-38	70.7
WP_141926592.1\|545835_546231_+	DUF3168 domain-containing protein	A0A097BYB7	Leuconostoc_phage	1.7e-54	79.2
WP_141926593.1\|546244_546808_+\|tail	phage major tail protein, TP901-1 family	A0A097BY79	Leuconostoc_phage	1.3e-55	63.6
WP_141926594.1\|546931_547270_+	hypothetical protein	A0A097BY80	Leuconostoc_phage	1.3e-47	88.4
WP_141926595.1\|547380_547695_+	hypothetical protein	A0A097BYD7	Leuconostoc_phage	1.6e-34	72.8
WP_141926596.1\|547695_551193_+\|tail	phage tail tape measure protein	A0A097BYC3	Leuconostoc_phage	1.3e-28	93.0
WP_141926597.1\|551211_552018_+\|tail	phage tail protein	A0A097BYC1	Leuconostoc_phage	4.8e-112	78.4
WP_141926598.1\|552014_555881_+	hypothetical protein	A0A097BY84	Leuconostoc_phage	1.3e-199	39.1
WP_141926599.1\|555895_556306_+	hypothetical protein	NA	NA	NA	NA
WP_141926600.1\|556308_556584_+	hypothetical protein	NA	NA	NA	NA
WP_141926601.1\|556583_557066_+	hypothetical protein	A0A2K9V3M2	Faecalibacterium_phage	3.9e-08	45.2
WP_141926602.1\|556995_557379_+\|holin	phage holin	NA	NA	NA	NA
WP_141926603.1\|557371_558475_+	hypothetical protein	A0A097BY89	Leuconostoc_phage	1.6e-33	54.1

DBSCAN-SWA_3

1151562 : 1266781

105

Lactococcus_phage(23.53%)

tail,tRNA,capsid,head,transposase,terminase,integrase,portal,protease

attL 1168356:1168372|attR 1229880:1229896

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042494491.1\|1151562_1154211_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.5e-61	34.2
WP_141926834.1\|1154536_1155895_-	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	2.9e-40	31.2
WP_042494495.1\|1155894_1156845_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_042494496.1\|1156951_1158067_-	DNA polymerase IV	D0R0A3	Streptococcus_phage	6.6e-11	26.2
WP_042494498.1\|1158185_1158545_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_042494500.1\|1158584_1159730_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	8.2e-81	44.3
WP_042494681.1\|1165364_1166411_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_042494680.1\|1166429_1167440_-	Holliday junction branch migration DNA helicase RuvB	A0A1V0DYC6	Dinoroseobacter_phage	9.9e-06	28.0
WP_042494679.1\|1167454_1168045_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
1168356:1168372	attL	NA	NA	NA	NA
WP_042494678.1\|1168451_1169681_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_137600615.1\|1169744_1170368_-	DUF1361 domain-containing protein	NA	NA	NA	NA
WP_141926835.1\|1170441_1171143_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.6e-41	46.2
WP_042494675.1\|1171233_1172544_-	GTPase ObgE	NA	NA	NA	NA
WP_042494674.1\|1172635_1174429_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_042494673.1\|1174798_1176046_-	ABC transporter permease	NA	NA	NA	NA
WP_042494671.1\|1176032_1176935_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.3e-20	28.2
WP_141926836.1\|1177074_1179906_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	4.1e-81	47.6
WP_042494668.1\|1179949_1180465_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_042494666.1\|1180583_1181735_-	AI-2E family transporter	NA	NA	NA	NA
WP_042493503.1\|1181831_1182860_-	lactonase family protein	NA	NA	NA	NA
WP_042493501.1\|1183131_1185216_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_042493498.1\|1185217_1186144_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_042493496.1\|1186440_1187232_-	DNA repair protein RecO	NA	NA	NA	NA
WP_042493495.1\|1187277_1188186_-	GTPase Era	NA	NA	NA	NA
WP_052348430.1\|1188211_1188643_-	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_042493490.1\|1188620_1189103_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_042493489.1\|1189105_1190092_-	PhoH family protein	L7TP00	Rhizobium_phage	3.0e-47	45.9
WP_042493488.1\|1190183_1190624_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.2e-13	36.3
WP_042493485.1\|1190700_1190886_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_042493483.1\|1191007_1191889_-	YitT family protein	NA	NA	NA	NA
WP_042493481.1\|1192034_1193840_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_042493478.1\|1193842_1195153_-\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	3.4e-22	25.6
WP_042493477.1\|1195449_1196337_-	N-acetylmuramoyl-L-alanine amidase	M1HNA7	Bacillus_virus	9.9e-18	37.1
WP_042493476.1\|1196458_1196899_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	4.9e-26	38.9
WP_137600616.1\|1197021_1198188_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_137600617.1\|1198207_1199407_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.9e-48	34.9
WP_141926837.1\|1200438_1201539_-	1,4-beta-N-acetylmuramidase	A0A1B1SDV2	Weissella_phage	1.3e-38	46.6
WP_141926838.1\|1201540_1201861_-	hypothetical protein	NA	NA	NA	NA
WP_071708168.1\|1201847_1202078_-	hypothetical protein	NA	NA	NA	NA
WP_141926839.1\|1202125_1202263_-	XkdX family protein	NA	NA	NA	NA
WP_141926840.1\|1202510_1202789_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	4.8e-11	52.2
WP_141926841.1\|1202845_1204033_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_141926842.1\|1204025_1205981_-	ATP-dependent helicase	NA	NA	NA	NA
WP_141926979.1\|1205970_1208622_-	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	9.0e-115	33.8
WP_141926843.1\|1208877_1209237_+	hypothetical protein	NA	NA	NA	NA
WP_141926844.1\|1209249_1209435_+	hypothetical protein	A0A1X9I6F6	Streptococcus_phage	5.6e-08	50.9
WP_141926845.1\|1209474_1209813_+\|transposase	transposase	A0A1X9I6F6	Streptococcus_phage	5.3e-12	43.6
WP_141926846.1\|1210178_1210973_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	1.9e-28	34.5
WP_141926847.1\|1211308_1211644_-\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	1.7e-26	52.3
WP_141926848.1\|1211643_1211937_-\|head,tail	phage gp6-like head-tail connector protein	Q9AZM1	Lactococcus_phage	1.8e-16	51.7
WP_141926849.1\|1212071_1213328_-\|capsid	phage major capsid protein	Q9AZY5	Lactococcus_phage	2.2e-55	39.2
WP_141926850.1\|1213362_1213950_-\|head,protease	HK97 family phage prohead protease	Q9AZE1	Lactococcus_phage	1.4e-47	53.2
WP_141926851.1\|1213949_1215056_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	3.1e-93	49.7
WP_141926852.1\|1215052_1215235_-	hypothetical protein	NA	NA	NA	NA
WP_141926853.1\|1215393_1217244_-\|terminase	terminase large subunit	Q9AZM6	Lactococcus_phage	2.1e-163	47.7
WP_141926854.1\|1217247_1217724_-\|terminase	phage terminase small subunit P27 family	Q94MB4	Lactococcus_phage	6.3e-11	29.8
WP_141926855.1\|1218297_1218744_-	HNH endonuclease	Q9AZM8	Lactococcus_phage	4.5e-19	38.1
WP_141926856.1\|1218976_1219276_-	hypothetical protein	NA	NA	NA	NA
WP_141926857.1\|1219810_1220647_-	hypothetical protein	NA	NA	NA	NA
WP_141926858.1\|1220661_1220982_-	hypothetical protein	NA	NA	NA	NA
WP_141926859.1\|1221143_1221968_-	HNH endonuclease	NA	NA	NA	NA
WP_141926860.1\|1222249_1223857_-	AAA family ATPase	NA	NA	NA	NA
WP_141926861.1\|1224916_1225129_-	hypothetical protein	NA	NA	NA	NA
WP_141926862.1\|1225233_1225530_-	hypothetical protein	NA	NA	NA	NA
WP_141926863.1\|1226426_1227089_-	hypothetical protein	NA	NA	NA	NA
WP_141926864.1\|1228351_1229545_-\|integrase	tyrosine-type recombinase/integrase	A0A2P0ZL94	Lactobacillus_phage	4.9e-28	27.7
WP_141926865.1\|1229991_1232667_-	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
1229880:1229896	attR	NA	NA	NA	NA
WP_141926866.1\|1233389_1233698_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_042493445.1\|1233715_1234279_-	membrane protein	NA	NA	NA	NA
WP_042493442.1\|1234387_1235224_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_137600638.1\|1235388_1235994_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_042493439.1\|1236044_1237091_-	Zn-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_137600639.1\|1237264_1237663_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_042493436.1\|1237761_1238631_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.8e-40	35.2
WP_137600641.1\|1238657_1239338_-	deaminase	A0A1B0RXM8	Streptococcus_phage	1.1e-05	25.4
WP_042493434.1\|1239357_1239768_-	cupin domain-containing protein	NA	NA	NA	NA
WP_042493432.1\|1239800_1240118_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_042493430.1\|1240263_1240698_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_042493428.1\|1240815_1242135_+	ABC transporter permease	NA	NA	NA	NA
WP_081839317.1\|1242144_1242732_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_141926867.1\|1242813_1244154_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_137600643.1\|1244189_1245662_-	amino acid permease	NA	NA	NA	NA
WP_042493422.1\|1246014_1247019_-	catabolite control protein A	C6ZCU4	Enterobacteria_phage	3.6e-24	27.7
WP_042493420.1\|1247278_1248379_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_042493419.1\|1248447_1249008_-	hypothetical protein	NA	NA	NA	NA
WP_042493417.1\|1249032_1249431_-	DUF948 domain-containing protein	NA	NA	NA	NA
WP_137600644.1\|1249548_1251366_-	oligoendopeptidase F	NA	NA	NA	NA
WP_052348426.1\|1251421_1252459_-	hypothetical protein	NA	NA	NA	NA
WP_141926868.1\|1252636_1253359_-	competence protein	NA	NA	NA	NA
WP_042493413.1\|1253519_1253918_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_137600647.1\|1254053_1255061_-	hypothetical protein	NA	NA	NA	NA
WP_042493410.1\|1255092_1255596_-	phosphate starvation protein	NA	NA	NA	NA
WP_042493408.1\|1255800_1256307_-	hypothetical protein	NA	NA	NA	NA
WP_042493407.1\|1256371_1257100_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_042493406.1\|1257086_1257293_-	hypothetical protein	NA	NA	NA	NA
WP_042493405.1\|1257297_1258134_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_042493403.1\|1258299_1258689_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_042493402.1\|1258890_1259526_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	3.1e-45	44.1
WP_141926869.1\|1259595_1261011_-	LysM peptidoglycan-binding domain-containing protein	A0A1J0GW44	Streptomyces_phage	3.5e-09	37.6
WP_042493399.1\|1261237_1262749_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_042493397.1\|1262863_1263049_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_141926870.1\|1263059_1264031_-	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_042493395.1\|1264198_1265485_-	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_042493393.1\|1265575_1265929_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_042493391.1\|1266037_1266781_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA

DBSCAN-SWA_4

1786379 : 1795406

Streptococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042492178.1\|1786379_1787819_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	9.6e-79	34.9
WP_141926952.1\|1787849_1788524_-	GTP pyrophosphokinase family protein	F8K9M7	Nitrososphaera_phage	1.7e-09	27.3
WP_042492182.1\|1788705_1789785_-	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	6.3e-59	37.8
WP_042492184.1\|1790083_1791637_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.1e-14	26.5
WP_042492186.1\|1792174_1792840_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_042492414.1\|1793335_1794583_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	7.7e-109	52.6
WP_042492187.1\|1794563_1795406_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-43	39.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP033610

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7128

Erysipelothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_137601004.1\|955_1603_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_004909438.1\|1761_3093_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	3.2e-20	24.7
WP_141926985.1\|3767_4151_-	VOC family protein	NA	NA	NA	NA
WP_141926986.1\|4197_4926_-	fructose permease	NA	NA	NA	NA
WP_137601000.1\|4929_5946_-	zinc-dependent alcohol dehydrogenase family protein	E3SJ82	Synechococcus_phage	1.0e-05	22.8
WP_137600999.1\|6309_7128_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	9.4e-31	34.6

DBSCAN-SWA_2

13043 : 15592

Macacine_betaherpesvirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_137600995.1\|13043_13262_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	4.0e-13	53.0
WP_141926988.1\|13324_15592_-	ATP-binding cassette domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-125	30.8

DBSCAN-SWA_3

19763 : 20078

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_111303645.1\|19763_20078_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.0e-13	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP033608

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP033610

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection