CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041666	Bacillaceae bacterium TKL69 chromosome, complete genome	1 crisprs	csa3,DEDDh,DinG,cas3,WYL	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041666_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041666_1

461442-461535

Orphan

Consensus_repeat	Method
AGAAGTACTCGAAGAGTGCAACCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041666_1

>merge|NZ_CP041666|1|461442-461535|CRISPRCasFinder
AGAAGTACTCGAAGAGTGCAACCAATCATTTTCTAACAACGTCGATTTACTTCTCCGTTAGAAAATAATAGTAGTACTCGAAGAGTGCAACCAA

>NZ_CP041666|1|1|461442-461535|CRISPRCasFinder
AGAAGTACTCGAAGAGTGCAACCAA	TCATTTTCTAACAACGTCGATTTACTTCTCCGTTAGAAAATAAT
AGTAGTACTCGAAGAGTGCAACCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041666.1\|WP_143891918.1\|468084_468726_+\|redox-sensing-transcriptional-repressor-Rex	unknown	unknown	gnl\|CDD\|235486
NZ_CP041666.1\|WP_143891909.1\|451395_453567_+\|S1-RNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225094
NZ_CP041666.1\|WP_143891904.1\|447216_447573_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP041666.1\|WP_143891907.1\|449416_449893_+\|anti-sigma-B-factor-RsbW	unknown	unknown	gnl\|CDD\|235217
NZ_CP041666.1\|WP_143891908.1\|449864_450656_+\|RNA-polymerase-sigma-factor-SigB	unknown	unknown	gnl\|CDD\|236306
NZ_CP041666.1\|WP_143891915.1\|464003_464453_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NZ_CP041666.1\|WP_143891920.1\|468975_469686_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP041666.1\|WP_143891913.1\|462848_463304_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|376771
NZ_CP041666.1\|WP_143891911.1\|453841_454300_+\|SprT-family-protein	unknown	unknown	gnl\|CDD\|235290
NZ_CP041666.1\|WP_143891910.1\|453640_453760_-\|cortex-morphogenetic-protein-CmpA	unknown	unknown	gnl\|CDD\|380221
NZ_CP041666.1\|WP_143897095.1\|450670_451249_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|214624
NZ_CP041666.1\|WP_143891912.1\|461869_462847_+\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|235583
NZ_CP041666.1\|WP_143891916.1\|464449_465487_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP041666.1\|WP_143891921.1\|469942_470227_+\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NZ_CP041666.1\|WP_143891919.1\|468768_468969_-\|DUF4305-domain-containing-protein	unknown	unknown	gnl\|CDD\|316654
NZ_CP041666.1\|WP_143891914.1\|463300_464011_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP041666.1\|WP_143891906.1\|449087_449417_+\|anti-sigma-factor-antagonist	unknown	unknown	gnl\|CDD\|132914
NZ_CP041666.1\|WP_143891905.1\|448029_449022_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|225118
NZ_CP041666.1\|WP_143891917.1\|465985_467914_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP041666.1\|WP_143897094.1\|447581_447983_+\|anti-sigma-regulatory-factor	unknown	unknown	gnl\|CDD\|340411

Protein	Function_ID	Function_description	E-value
NZ_CP041666.1\|WP_143891918.1\|468084_468726_+\|redox-sensing-transcriptional-repressor-Rex	gnl\|CDD\|235486	PRK05472, PRK05472, redox-sensing transcriptional repressor Rex; Provisional.	4.90323e-118
NZ_CP041666.1\|WP_143891909.1\|451395_453567_+\|S1-RNA-binding-domain-containing-protein	gnl\|CDD\|225094	COG2183, Tex, Transcriptional accessory protein [Transcription].	0
NZ_CP041666.1\|WP_143891904.1\|447216_447573_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	1.44703e-33
NZ_CP041666.1\|WP_143891907.1\|449416_449893_+\|anti-sigma-B-factor-RsbW	gnl\|CDD\|235217	PRK04069, PRK04069, serine-protein kinase RsbW; Provisional.	6.12323e-84
NZ_CP041666.1\|WP_143891908.1\|449864_450656_+\|RNA-polymerase-sigma-factor-SigB	gnl\|CDD\|236306	PRK08583, PRK08583, RNA polymerase sigma factor SigB; Validated.	6.76393e-156
NZ_CP041666.1\|WP_143891915.1\|464003_464453_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	7.54119e-43
NZ_CP041666.1\|WP_143891920.1\|468975_469686_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.04329e-13
NZ_CP041666.1\|WP_143891913.1\|462848_463304_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|376771	pfam02367, TsaE, Threonylcarbamoyl adenosine biosynthesis protein TsaE. This family of proteins is involved in the synthesis of threonylcarbamoyl adenosine (t(6)A).	5.91957e-58
NZ_CP041666.1\|WP_143891911.1\|453841_454300_+\|SprT-family-protein	gnl\|CDD\|235290	PRK04351, PRK04351, SprT family protein.	1.05191e-70
NZ_CP041666.1\|WP_143891910.1\|453640_453760_-\|cortex-morphogenetic-protein-CmpA	gnl\|CDD\|380221	NF033225, spore_CmpA, cortex morphogenetic protein CmpA. Members of this family are CmpA (cortex morphogenetic protein A), a small protein (37 amino acids) involved in endospore formation and frequently missed during genome annotation.	1.11118e-15
NZ_CP041666.1\|WP_143897095.1\|450670_451249_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|214624	smart00331, PP2C_SIG, Sigma factor PP2C-like phosphatases.	6.9514e-14
NZ_CP041666.1\|WP_143891912.1\|461869_462847_+\|thiamine-phosphate-kinase	gnl\|CDD\|235583	PRK05731, PRK05731, thiamine monophosphate kinase; Provisional.	2.29705e-129
NZ_CP041666.1\|WP_143891916.1\|464449_465487_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP041666.1\|WP_143891921.1\|469942_470227_+\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	5.26491e-48
NZ_CP041666.1\|WP_143891919.1\|468768_468969_-\|DUF4305-domain-containing-protein	gnl\|CDD\|316654	pfam14146, DUF4305, Domain of unknown function (DUF4305). This family includes the B. subtilis YdiK protein, which is functionally uncharacterized. This is not a homolog of E. coli YdiK, which belongs to pfam01594. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length.	9.00635e-05
NZ_CP041666.1\|WP_143891914.1\|463300_464011_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	1.72421e-62
NZ_CP041666.1\|WP_143891906.1\|449087_449417_+\|anti-sigma-factor-antagonist	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	1.43901e-30
NZ_CP041666.1\|WP_143891905.1\|448029_449022_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|225118	COG2208, RsbU, Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription].	5.99641e-77
NZ_CP041666.1\|WP_143891917.1\|465985_467914_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP041666.1\|WP_143897094.1\|447581_447983_+\|anti-sigma-regulatory-factor	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	6.22753e-45

>NZ_CP041666.1|WP_143891911.1|453841_454300_+|SprT-family-protein
MELPLTQVELEKLVHSLSVEYFHKPFVDDVAFNARLRTTGGRYIPTKRRIELNPKYLTELGRDEFEGIIKHELCHYHLHIEGKGYKHRDPEFRQLLKETKSPRFCSSLPSAENRRVKHSYKCVKCEQVYTRARQVNIKKYRCGKCRGKLQKV
>NZ_CP041666.1|WP_143891910.1|453640_453760_-|cortex-morphogenetic-protein-CmpA
MPKWFMKQMTEAFLSKNIYQIKILNQCWFFYREKNTNSS
>NZ_CP041666.1|WP_143891909.1|451395_453567_+|S1-RNA-binding-domain-containing-protein
MLSEVEQKDSLIKWVAKETGVAIQPIKQVITLIEKGNTVPFIARYRKEQTGGLDEVQIKAIEDKWQYALHLSERKEEVIRLIEEQGKLTPDLKEDIINATQLQKVEDLYRPYKQKRRTRATVAKEKGLEPLAQLIWKQQVQTLEAEAHTYLSEEHELTSVEEVLAGASDIIAEWIADDPTYREYIRDKTFRLGTIQAEAKKKEKDEKGVFEMYYEYHEPIRSIVSHRILALNRGEKEDILKVTIEPPTDDVLLYLNKKIILASASKETKELLASTIEDSYKRLIQPSIEREIRSSLSETAEEQAIDIFSKNLKNLLLQPPLKGKTVLGVDPAYRTGCKLAVIDETGKVHSINVIYPTPPKSDKKNAEAVVLDYMNKFNIELVAIGNGTASRETEQFIADTIRNNNLDVSYIIVNEAGASVYSASKLAREEFPDLQVEERSAVSIARRVQDPLAELVKIDPKSIGVGQYQHDVSQKSLSESLTFVVETAVNQVGVNVNTASASLLQYVSGLSKTVANNIVKQRNEEGKFTNRGQLKNIPRLGNKTYEQCIGFLRVLDGDQPLDRTPIHPESYKATEKLLNKLDCSVQDIGTPKLQDKLKSLDLASLAEELAIGRPTLEDIVGALARPERDPRDEFDQPLLKTDVLAMEDLKPGMELQGTVRNVVDFGIFVDIGVKQDGLVHISKMSKQFVKHPMDIASVGDVVTVWVEQVDVDKQRIALSMVEN
>NZ_CP041666.1|WP_143897095.1|450670_451249_+|SpoIIE-family-protein-phosphatase
MDVSVFQQAKKGNYYCGDSYYYEETDDGFICALADGLGSGEYAKESSHAVIQAIEHNKDVSLDQLIKICNQELIGKRGVVLGMLKVDYHSHTFSFTSIGNVGVMTITSSGEKKRSIPNSGYLAGYPRPFKVTKGQLENHLVFILFSDGVNDRDLSSKYFMMKEVHQITETFESICGTNEKDDTTLIAIKYTE
>NZ_CP041666.1|WP_143891908.1|449864_450656_+|RNA-polymerase-sigma-factor-SigB
MTTKSQPHNRGEDEVYQWIQHLQKYPTDEVIQEKIVLAYQDLVESLARKYSKNSSIHEDLVQVGMLGLLAAIRRYEPAYGKSFESFAIPTIIGEVKRFIRDKTWSVHVPRRIKELGPKIKRAIEELTTDQQKSPSIAEIANHLDVSEEEVLETLEMGKSYKALSVDRKIEADSDGSKVSILDLIGNEESGYDKIDRQMLLEKILPILTDREQQILKCTYFQNLSQKETGEQLGISQMHVSRLQRRALRKLREALQSDSSEVFS
>NZ_CP041666.1|WP_143891907.1|449416_449893_+|anti-sigma-B-factor-RsbW
MEPFDFIEIKVPAKAEYVGVVRLTSSGIANRMGFSYEDIEDLKVAISEAMTNAVTHAYEHDEIGEVTIGFGLYENRLEVMVADHGGSFNLEQVKDGIGPYEQKESIENLREGGFGLFLIEALMDKVEINNDYGVIVLMTKYLNENEVGIDDDQISTTQ
>NZ_CP041666.1|WP_143891906.1|449087_449417_+|anti-sigma-factor-antagonist
MNLDIKVTQEKNKSVVKLSGEIDAYTAPDLKDTLLPLATSEGTTVEVDLENVSYMDSTGLGVFVSALKATKEVGSQLALVRLQDRVLRLFKITGLIDIMDIEQKVRGGN
>NZ_CP041666.1|WP_143891905.1|448029_449022_+|SpoIIE-family-protein-phosphatase
MDRYQKLLKKYIETQDETALYQAEQFSKMSMQKKISPEEIIHVHNQAIMELFPDLPKDFHLAMKFLLETMMSYGLAYQEFQSLREKQLELKSEISVAANMQQTLLSTVKPSIEGLDIGVISVPANQMNGDYYHFIKGEHDGKLGVAIADVIGKGIPAALAMSMIKYFMDSLPESSMSPQMILKHLNRVVERNVDPSMFITMFYGSYDVDAEIFTYSSAGHEPGYYYNRETGMYKEIEAKGLVLGVDSKSSYEQFELNIEKGDKIVLLTDGVTECRQGDRFIEREEVFEVIQKYDHLPAQEAVEQVYKHFERLQDFHLRDDFTLIMLSKNV
>NZ_CP041666.1|WP_143897094.1|447581_447983_+|anti-sigma-regulatory-factor
MQPQTCVTIQKEWDIVGARQVGRDFAKKLGFGTVDQARIATAISELARNIYLYAGKGQICFEVIEDMEHKGLAILATDNGPGIRDISAVMEDGYSTSGGLGAGLPGVKRLMDDFNIISEHGKGTEIRTVKWIR
>NZ_CP041666.1|WP_143891904.1|447216_447573_+|STAS-domain-containing-protein
MRIPILKLQNYLLISIQIDLDDQTAIQFQEDLLNKIHQSGATGVVIDLTSVDIIDSFIAKVLGDVVTMSDLMGAKVVLTGIQPAVAMTLIDLGIHMQDVPTALDLEQGLIKLRQELEE
>NZ_CP041666.1|WP_143891912.1|461869_462847_+|thiamine-phosphate-kinase
MDEFSFIQSIQPKTYKRTNLIKGIGDDAAVFRPMYHDVVTSVDTFVEGIHFSKETMSAYDVGYRVLATNLSDMAAMGSTPSFYLVSIVIPKHWSEEELQALYKGMEDLARLYNMDLIGGDTVSGDQLVVSVTIMGEVTSGKARYRSHALPGDVVFVTGTLGDSAAGLHVLLKKEKGEDYDYVINRHRRPSPRVKFAKSLEAIKRLSLNDVSDGISSDVGEIAESSHVDLHIDYEALPIHSSLKTSFDKFLLRKWVLSGGEDYELIGTVPPSDWGRVEEAARKTGTRVTRIGRVEQAKGSTPTVFLHEAGTKQILKKEGFNHLKGD
>NZ_CP041666.1|WP_143891913.1|462848_463304_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MKSYEFIAHTELETKHLAEKLATLLHPGAVVTLEGDLGAGKTTFTKGIGTGLGVRRTINSPTFTIVKEYMGELPLYHMDVYRLEESEEDIGFDEYFNGPGISIVEWASFIADFLPDERLDIQLEIIDEHTRKIKLYPRGMKFERVCEELGR
>NZ_CP041666.1|WP_143891914.1|463300_464011_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MNILAMDTSNQVLGVAVIKDGNLAGEYMSNVQKNHSVRLMPAIYQLMSDTHTKPEELDRIVVAKGPGSYTGVRIGLTTAKTMGWALGIPVIAVSSLELVARQATYFSGLICPFFDARRGLVYTGLYEQNEAGELQLSKEETNILFEDWLKQLKIEGKPVLFLSQDIKLHKQRIQEIMKELAVFPTDSFYHIPRPSLMVDDLSEKEAEPVHSLTPSYLRLVEAEAKWLEQQGEQKNG
>NZ_CP041666.1|WP_143891915.1|464003_464453_+|ribosomal-protein-S18-alanine-N-acetyltransferase
MAEATIRKMVLEDIDQVVHIEQQSFATPWPRDIFFNELTNNQYANYFVVEVDGQVVGYCGLWVIIDEAQITNIAILPSHRGHSYGKLLFQHVMHKAAVLGGTRLSLEVRISNTVAQRMYSSFGLVPGGIRKSYYTDNNEDALVMWVNLR
>NZ_CP041666.1|WP_143891916.1|464449_465487_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MNKDQYILGIETSCDETAAAIVKNGKEIISNVVASQIESHKRFGGVVPEIASRHHVEQITFVIEQALEEAQMKVEDVDAIAVTEGPGLVGALLVGVNAAKALAFAKQKPLLGVHHIAGHIYANRLEKEFEFPLLALVVSGGHTELILMKEHGHFEVLGETRDDAAGEAYDKVARTLNLPYPGGPMIDKLAQSGEATIDFPRAWLEEDSYDFSFSGLKSAVLNTLHNAKQRGEELKSEDIAASFQASVVEVLTKKTLQAAREFHVKQVIVAGGVAANKGLRSSLEEVFKGEDVELMIPPLHLCTDNAAMIAAAGSIAFDQGHRAGWDLNANPSLDLELYGSRKSKV
>NZ_CP041666.1|WP_143891917.1|465985_467914_-|ATP-binding-cassette-domain-containing-protein
MILLQVNQLTKRFGAELILSNIKIEVQTKDRIAIVGRNGAGKSTLLKILAGELSYDSGEIFRPKQVSLGYLAQNTGLESNQTIWKEMLSVFTALIEQEKKLRQMEAEMGNPDLLANQAAYQNLLEEYDRRQDAFKRDGGYQYEADIKAVLNGLSFQGFDLDTPIHELSGGQKTRLALGKLLLSKPDILILDEPTNHLDIETLSWLEGYLNGYPGAVVIVSHDRYFLDKTVNVVYEISRHHSTKFHGNYSKYLDQKAENYERDRKLYEKQQTEIKKMEDFIQKNIVRASTTKRAQSRRKQLEKMDVMDRPDGDEASARFSFQVEKRSGNDVLKVRDLAFRYEDGDDFIFSDLHVDISRGDSIALVGPNGVGKSTLLKTIIGQLSPAYGQIQIGTNVQIGYYDQEQTQLHPQKTVLQELWDDYPLWNEKDIRTILGNFLFSGDDVLKVVSSLSGGEKARLALAKLMMEKSNLLILDEPTNHLDLDSKEVLEAALVDFPGTILFVSHDRYFINKIATQVLEMQPGSSTMYLGDYDYYLEKKQEEFELMELEKQEAAPVKETQTAKSTFEQEKALKKEMRKIQRRIEEIEQQIEELEARTEEIDELLCNPDVFQDHEKALELTEENTDIQQKLEALMEEWEALQTE
>NZ_CP041666.1|WP_143891918.1|468084_468726_+|redox-sensing-transcriptional-repressor-Rex
MNMENKIPQATAKRLPLYYRFLNNLHHQGKLRVSSKELSEAVKVDSATIRRDFSYFGALGKKGYGYNVEYLLGFFRKTLDQDEMAKIALIGVGNLGTAFLHYNFTKNNNTKIEMAFDADPDKVGKDIGGVPVYHIQDLEERLGDTSVAILTVPQSEAQPIAERLVEAGIDGILNFTPARITVPERIRVHHIDLVVELQSLVYFLKHYPLDEME
>NZ_CP041666.1|WP_143891919.1|468768_468969_-|DUF4305-domain-containing-protein
MRTSPLFTASLYFFIGILFTYLAITFVEDTIWNVTTILLLLFATTYVVISIRLFLLHLAIKRAKKK
>NZ_CP041666.1|WP_143891920.1|468975_469686_-|CPBP-family-intramembrane-metalloprotease
MPKRYWYVILTYVIMQLSGALVAPIIKAMGLDPFTAGVFWSVFSFLAALVITLFLLREDMNVGSERGAAGVGTIILWSILGIFLAYFAQFIAAIIETFLLKIPPGSENTQDIMNITRSAPIFILIVVFIAPILEEVIFRKIIFGTIYQKTNFIIAGVASALVFALVHADPLHLIMYMSMGFVFAFLYVQTKRIIVPIITHMAMNGFVVIAQYNMDPEEMEKMLEQFEKIQMIIFGG
>NZ_CP041666.1|WP_143891921.1|469942_470227_+|co-chaperone-GroES
MLKPLGDRVVIELVQQEEKTSSGIVLPDSAKEKPQEGKVVAVGSGRVTENNQKVALEVEEGNIVIYSKFAGTEVKYEGKEYLILRESDILAIVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

544017 : 552246

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143891982.1\|544017_545310_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	8.5e-18	24.7
WP_143891983.1\|545350_546064_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4R1E8	Synechococcus_phage	8.2e-39	40.3
WP_143891984.1\|546060_546312_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_143891985.1\|546308_546992_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_143891986.1\|546975_549201_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.3e-155	39.9
WP_143891987.1\|549176_550586_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.4e-53	31.9
WP_143891988.1\|550648_551674_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	3.9e-66	43.8
WP_143891989.1\|551673_552246_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.8e-29	39.9

DBSCAN-SWA_2

759075 : 775212

Bacillus_phage(28.57%)

terminase,tail,portal,integrase,capsid

attL 750889:750903|attR 775609:775623

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
750889:750903	attL	NA	NA	NA	NA
WP_143892182.1\|759075_760002_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	6.9e-46	35.0
WP_143892183.1\|760155_760995_+	hypothetical protein	A0A1B0WMY1	Flavobacterium_phage	3.2e-10	31.7
WP_143892184.1\|761372_761765_+	hypothetical protein	NA	NA	NA	NA
WP_143892185.1\|762434_763025_+	hypothetical protein	A0A220NTQ2	Escherichia_phage	1.9e-09	31.6
WP_143892186.1\|763026_763464_+	hypothetical protein	NA	NA	NA	NA
WP_143892187.1\|763812_764004_+	hypothetical protein	NA	NA	NA	NA
WP_158633926.1\|764047_765022_+\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	9.4e-70	42.4
WP_143892189.1\|765014_766100_+\|capsid	phage major capsid protein	A0A060AEU4	Staphylococcus_phage	4.0e-61	38.0
WP_143892190.1\|766261_766594_+\|tail	phage major tail protein, TP901-1 family	A0A0C5AMZ4	Paenibacillus_phage	3.8e-31	64.6
WP_143892191.1\|766683_766890_+	hypothetical protein	NA	NA	NA	NA
WP_143892192.1\|767019_767367_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_158633927.1\|767371_767569_+	hypothetical protein	NA	NA	NA	NA
WP_143892194.1\|767813_768458_+	DNA repair protein RadC	NA	NA	NA	NA
WP_143892195.1\|768552_770628_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_143892196.1\|770843_771032_+	hypothetical protein	NA	NA	NA	NA
WP_143892197.1\|771043_771592_+	hypothetical protein	NA	NA	NA	NA
WP_143892198.1\|771598_771844_+	hypothetical protein	NA	NA	NA	NA
WP_143892199.1\|771830_773486_+	hypothetical protein	NA	NA	NA	NA
WP_143892200.1\|774324_775212_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	4.1e-64	43.7
775609:775623	attR	NA	NA	NA	NA

DBSCAN-SWA_3

917103 : 925704

Staphylococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143892329.1\|917103_918192_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.9e-59	42.0
WP_143892330.1\|918192_918840_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.8e-43	46.9
WP_143892331.1\|918850_920044_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	8.2e-108	51.0
WP_143892332.1\|920057_920522_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-47	64.0
WP_143892333.1\|920643_920934_+	DinB family protein	NA	NA	NA	NA
WP_143891566.1\|920963_922326_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-112	74.1
WP_143892334.1\|922647_923130_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_158633938.1\|923370_923742_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_143892336.1\|923989_924832_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_143897127.1\|925035_925278_+	hypothetical protein	NA	NA	NA	NA
WP_143892337.1\|925296_925704_-	NUDIX domain-containing protein	D0R7I2	Paenibacillus_phage	1.2e-05	30.8

DBSCAN-SWA_4

1807852 : 1817953

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143893934.1\|1807852_1808284_-	AAA family ATPase	G3MAB6	Bacillus_virus	2.1e-05	31.5
WP_143893936.1\|1808285_1809431_-	exonuclease subunit SbcD	NA	NA	NA	NA
WP_143893938.1\|1809552_1809744_-	hypothetical protein	A0A2I7SCV7	Paenibacillus_phage	4.6e-05	48.0
WP_143893940.1\|1809854_1810184_+	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	2.7e-05	24.3
WP_143893942.1\|1810268_1810487_-	YozE family protein	NA	NA	NA	NA
WP_143897181.1\|1810502_1811225_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.8e-15	26.4
WP_143893944.1\|1811335_1811518_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_143893946.1\|1811655_1812144_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	1.6e-38	46.3
WP_143893949.1\|1812162_1813119_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.1e-123	65.0
WP_158633981.1\|1813133_1813832_-	toxin	NA	NA	NA	NA
WP_143893953.1\|1814051_1815080_+	hypothetical protein	A0A1V0DZX6	Clostridioides_phage	8.3e-16	40.2
WP_143893955.1\|1815118_1815727_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	6.6e-13	28.4
WP_143893957.1\|1815735_1816587_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_143893959.1\|1816902_1817103_+	cold shock domain-containing protein	Q9AZD3	Lactococcus_phage	4.5e-19	63.1
WP_143893961.1\|1817275_1817953_+	queuosine precursor transporter	A0A2H4J2N7	uncultured_Caudovirales_phage	2.7e-15	29.1

DBSCAN-SWA_5

2196682 : 2206531

Caldibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143894677.1\|2196682_2198206_-	recombinase family protein	A0A290FZV2	Caldibacillus_phage	4.3e-162	58.2
WP_143894679.1\|2198397_2198583_-	hypothetical protein	NA	NA	NA	NA
WP_158633992.1\|2198597_2199131_-	hypothetical protein	A0A0S2SXG5	Bacillus_phage	1.0e-17	31.1
WP_143894683.1\|2199123_2200008_-	cell division protein FtsK	A0A288WGQ0	Bacillus_phage	1.7e-62	43.2
WP_158633993.1\|2200069_2200207_-	hypothetical protein	NA	NA	NA	NA
WP_143894685.1\|2200386_2200584_+	helix-turn-helix domain-containing protein	A0A0U4IBA0	Bacillus_phage	5.1e-07	41.0
WP_143894687.1\|2200637_2201309_-	hypothetical protein	NA	NA	NA	NA
WP_143894689.1\|2201739_2202240_-	hypothetical protein	NA	NA	NA	NA
WP_143894691.1\|2202593_2202815_-	helix-turn-helix domain-containing protein	A0A290G4F8	Caldibacillus_phage	6.9e-13	53.5
WP_143894693.1\|2202952_2203444_+	helix-turn-helix domain-containing protein	A0A290GJU0	Caldibacillus_phage	4.8e-22	52.4
WP_143894695.1\|2203543_2204017_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_143894697.1\|2204107_2205961_+	DEAD/DEAH box helicase family protein	A0A097BY72	Enterococcus_phage	3.0e-16	24.6
WP_143894699.1\|2205976_2206309_+	hypothetical protein	NA	NA	NA	NA
WP_143894701.1\|2206348_2206531_-	helix-turn-helix transcriptional regulator	A0A290GJH9	Caldibacillus_phage	2.5e-16	83.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage