CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP041743	Paraburkholderia megapolitana strain LMG 23650 chromosome 1, complete sequence	2 crisprs	RT,WYL,csa3,PD-DExK	1	0	0
NZ_CP041745	Paraburkholderia megapolitana strain LMG 23650 chromosome 2, complete sequence	1 crisprs	cas3,csa3,WYL,DinG,DEDDh	0	0	3
NZ_CP041744	Paraburkholderia megapolitana strain LMG 23650 plasmid unnamed1, complete sequence	1 crisprs	NA	0	2	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041743_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041743_1

309614-309844

Orphan

Consensus_repeat	Method
TGTTGCCATCACCGTGGACGTTGCTGTCGGCACTCGTACTCAGGTCGTTGT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP041743_1

>merge|NZ_CP041743|1|309614-309844|PILER-CR
TGTTTCCACCACCGTGGACGTTGCTGTCGGCGCTCGTGCTCAGGTCGTTGTTGTTACCCAGTACATCGGCCCTCTCGCTCTCCACGAGCTTGTTGCCATCACCAACCACGTTGCTGTCGGCACTCTTGTCCAGAGCGTTCTGGTTACCCACGACACCCGCATTTGCACTGTCAGCCAGCGTGTTGCCGTCACCGTGGACGTTGCTGTCGGCACTCGTACTCAGGTCGTTGT

>NZ_CP041743|1|1|309614-309844|PILER-CR
TGTTTCCACCACCGTGGACGTTGCTGTCGGCGCTCGTGCTCAGGTCGTTGT	TGTTACCCAGTACATCGGCCCTCTCGCTCTCCACGAGCT
TGTTGCCATCACCAACCACGTTGCTGTCGGCACTCTTGTCCAGAGCGTTCT	GGTTACCCACGACACCCGCATTTGCACTGTCAGCCAGCGTGTTGCCGTCACCGTG
GACGTTGCTGTCGGCACTCGTACTCAGGTCGTTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041743.1\|WP_091007370.1\|322076_323210_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP041743.1\|WP_091007344.1\|303105_304791_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238300
NZ_CP041743.1\|WP_091007358.1\|316887_317439_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|182158
NZ_CP041743.1\|WP_091007355.1\|315351_316842_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143430
NZ_CP041743.1\|WP_091007374.1\|323445_324600_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_CP041743.1\|WP_091008822.1\|312707_313508_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|236764
NZ_CP041743.1\|WP_091007338.1\|301808_302582_+\|cyclase-family-protein	unknown	unknown	gnl\|CDD\|377240
NZ_CP041743.1\|WP_091008816.1\|300442_301774_+\|fumarylacetoacetase	unknown	unknown	gnl\|CDD\|215461
NZ_CP041743.1\|WP_091007333.1\|298214_298946_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380065
NZ_CP041743.1\|WP_091007330.1\|297021_298134_+\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP041743.1\|WP_091008819.1\|305408_306599_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NZ_CP041743.1\|WP_091007365.1\|319188_320523_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP041743.1\|WP_091007362.1\|317860_318067_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041743.1\|WP_091007336.1\|299139_300378_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP041743.1\|WP_091007327.1\|296432_296690_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041743.1\|WP_091008825.1\|318347_319124_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
NZ_CP041743.1\|WP_144269453.1\|302749_303109_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041743.1\|WP_091007368.1\|320560_321994_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
NZ_CP041743.1\|WP_091007347.1\|304881_305415_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP041743.1\|WP_091007352.1\|314254_315217_-\|agmatinase	unknown	unknown	gnl\|CDD\|235011

Protein	Function_ID	Function_description	E-value
NZ_CP041743.1\|WP_091007344.1\|303105_304791_+\|hypothetical-protein	gnl\|CDD\|238300	cd00538, PA, PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.	1.98729e-11
NZ_CP041743.1\|WP_091007358.1\|316887_317439_-\|cupin-domain-containing-protein	gnl\|CDD\|182158	PRK09943, PRK09943, HTH-type transcriptional regulator PuuR.	7.11438e-47
NZ_CP041743.1\|WP_091007355.1\|315351_316842_-\|aldehyde-dehydrogenase	gnl\|CDD\|143430	cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like. NADP+-dependent, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (GABALDH) PuuC of Escherichia coli which catalyzes the conversion of putrescine to 4-aminobutanoate and other similar sequences are present in this CD.	0
NZ_CP041743.1\|WP_091007374.1\|323445_324600_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	1.22287e-172
NZ_CP041743.1\|WP_091008822.1\|312707_313508_-\|OmpA-family-protein	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	1.9997e-27
NZ_CP041743.1\|WP_091007338.1\|301808_302582_+\|cyclase-family-protein	gnl\|CDD\|377240	pfam04199, Cyclase, Putative cyclase. Proteins in this family are thought to be cyclase enzymes. They are found in proteins involved in antibiotic synthesis. However they are also found in organisms that do not make antibiotics pointing to a wider role for these proteins. The proteins contain a conserved motif HXGTHXDXPXH that is likely to form part of the active site.	1.20324e-36
NZ_CP041743.1\|WP_091008816.1\|300442_301774_+\|fumarylacetoacetase	gnl\|CDD\|215461	PLN02856, PLN02856, fumarylacetoacetase.	2.59891e-165
NZ_CP041743.1\|WP_091007333.1\|298214_298946_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380065	pfam17939, TetR_C_30, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in the Pseudomonas aeruginosa PsrA which regulates the fadBA5 beta-oxidation operon. Functional analysis of PsrA indicated its importance in regulating b-oxidative enzymes. It has also been suggested that PsrA, a member of the TetR family of repressors, could affect global gene expression including activation of rpoS.	4.05782e-20
NZ_CP041743.1\|WP_091007330.1\|297021_298134_+\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	5.06454e-59
NZ_CP041743.1\|WP_091008819.1\|305408_306599_+\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.91926e-43
NZ_CP041743.1\|WP_091007365.1\|319188_320523_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	8.69596e-163
NZ_CP041743.1\|WP_091007336.1\|299139_300378_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.30181e-23
NZ_CP041743.1\|WP_091008825.1\|318347_319124_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.73453e-90
NZ_CP041743.1\|WP_091007370.1\|322076_323210_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.54731e-154
NZ_CP041743.1\|WP_091007368.1\|320560_321994_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
NZ_CP041743.1\|WP_091007347.1\|304881_305415_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	4.48511e-10
NZ_CP041743.1\|WP_091007352.1\|314254_315217_-\|agmatinase	gnl\|CDD\|235011	PRK02190, PRK02190, agmatinase; Provisional.	0

>NZ_CP041743.1|WP_091008819.1|305408_306599_+|MFS-transporter
MVSTSPVRWNAIAALNAVSALSQIGQFGIGFMVLPVWLAHRGLDAPRAGLFSAAQWTGLLAGLLVTPALMNRIGARWTVLLGLVASTVAFAIMGALSWPLWIVPGALIGFGIGLRWIANETWLYQLVPTQSSGRVVGIHEALVATAGVIGPALAVWCNVDGHITFMAGAAFTLAAAVPLCMTASSKADGITTQPAARQSAKPHAPFDALVCLGMVVAAIGGLSDGALYGLFPLFADGRGMNGAQTATLLTFFGIGAMACQFPVGWFADRAGLGAAVIVCAATSTLAIFTFSLAAPSSWLLMASAVLLGGMHSAFLTLGCYAVARSGTAALSFNVRRVSIAFTAGSIVGPLLAGVAMKALGSDMLMWQLAILSGALTAYAIGLHEGRRQPGRSSSIS
>NZ_CP041743.1|WP_091007347.1|304881_305415_+|winged-helix-turn-helix-transcriptional-regulator
MTQRTENLLGVLAVLVTDEMNGQDTPPALAGATARAMLNAIGQYPDSSIEVLREAVDLSHPAAVRAVAGLVDAGLVEKKTGDDRRSVALVLTAAGKREMNRVRSARDRMLKRIVGRLDDHERVAFEDLLIKILWEETRDPAHAMQLCRFCDDGPCLKAGCPVECREQGLPMPERSAS
>NZ_CP041743.1|WP_091007344.1|303105_304791_+|hypothetical-protein
MSMLKNGLAAAVLLALAGAAQATQMVIVNVDQAGLGLNDPTVVQPVGGNPGTTLGQQRTIAYQYAADAWGSVINSTVPIKVQASFAALACTATTAVLGSARSAYVLYNFNASAIPNIWYPAALANAVNGADLLSGGAAIVSSFNANIGQPNCLAGTTWYYGLDDNAPAGTTDFIDTVMHEIAHGLGFASTTNVSTGALLNNMGDVFSTPIFDHVSGLNWNAMTTAQRKASIVGQGLVFGGPTVTQEIPLVLLNRLSLNARMGASTTSYSIGMANFGPPANASNFVGQVSVVSDGSANPSQGCGTLINTGSGGDGGPLAGLIALAVAGGCNSGTKAFQAQLAGATGIIIVSNQPGPAPYLTDGYTNNAIPTVSLAQADGTKLQGSIPGVSVTLATIAGMYQGADNQGRGMLYAPPVVQPGSSLSHWDLTMQPHTLMEPVAQSGQMANLKLDLTPAALKDIGWTRNTANGVLGGGLISGGLLPACDTGVPAVAAGGAITGASIVARANVCRLNPGLLGTEYMSCVNNYASTLAAQKLITMAQQLQVGVCATTTGILPLATKSK
>NZ_CP041743.1|WP_144269453.1|302749_303109_+|hypothetical-protein
MSGYQRCYKGARWVLGMALLISGSVLAQTSTRNAPLSSSQEVGNSEIVTLDPVTHKLRPATADEINQLKTSVAQPRTFANGALLPRNEAEALTTLRPLPHGGYIMRMPESLVSPLGEQP
>NZ_CP041743.1|WP_091007338.1|301808_302582_+|cyclase-family-protein
MTRLIDISIALDNDTLSDPPFMRPSIGYTTHEASAVDLIASFPGMTVDQLPDRMGWAVETVTLSTHNGTHIDAPWHYHPTMDGGARAIAIDEVPLEWFMQPGVKLDFRHLPDGHVVTPAEIDAELARIGHTLKPLEIVVVNTRAGERYGEADYIHSGCGMGRDATLHLTSFGVRVVGTDGWSWDAPFSHTARRYAETGDASLIWEGHKAGREAGYCQIEKLHNLESLPADGFTVVCFPAKIRNASAGWTRAVAILPD
>NZ_CP041743.1|WP_091008816.1|300442_301774_+|fumarylacetoacetase
MMIELDATHDPKRTSWVDSANAPDTDFPIQNLPFGIFSSDLVTPTVSRHFGIAIGASVFDVTRARQLGLLEGLAAQAADLASTGTLNALFAQGRAPSRELRKQVSALLDDKSAEGARARALHEQLLYPASACELHLPTAVGNYTDFYSGIHHAIAAGSLLTPDNPLPANYKWVPIAYHGRASSVRPSGTQIRRPHGQRGGTADRPPVFGPSQRLDFELEMGFYVGAGNALGEPVPVAQAGDHIVGFSLLNDWSARDVQRWEMFPLGPFLSKNFGTSVSPWVVTADALAPFRMPAMERPASDPQPLPYLHDPVDQRHGGIDVDLSVKLSTEAMRAAGTPAAQIIHSNAQYLYWTPAQMLAHHTSGGCDLLPGDLIGTGTISGPTRDQLSSLLELTFGGTQPVTLPNGEQRAFLQDGDEITFHGRCQRAGFVTIGFGSCVGRIVA
>NZ_CP041743.1|WP_091007336.1|299139_300378_+|MFS-transporter
MRMNSRWVALAIIFVSFLQFTLNWFNIVPAFGGLIADLHLSLPQVGVVIGMFIAGYGLAHIPGGMLAEAFGMRFAMLFGIAVETIGTVLSAVAHRYDVLLVARFICGVGGSVYIGSAIGLTAAWFRDHELATANGLVTGVAFTVGASLGLYLWTDIVAALGWRAALLFGAAAGAITFAALLWVFPVPFETRGSDSARGVAGNHLNLAALRRTFGNRNLWFLGLSFLGAYGSYFTAAQLLPAYGVAHLQLGPAAANSLGVMLLTSGAVGGTVGGWLADKVFGVIPTMVGALIIESVALLLIPYLGAAGLQIAAAAIGGMGILAFVPWIAMPGLYRDEIELSDIPTACGLMLTIVALGGVTLPALYGWVATHYGYTNAWTALAAASFVSMLFCFLVRRPDAAHSASTNAEAAFK
>NZ_CP041743.1|WP_091007333.1|298214_298946_-|TetR-family-transcriptional-regulator
MANRPRLQADTATRRKPPARKPSAGAKPHRSVIPAEEASRPDRRAEILRSAEILVAQHGYHAVSVRDIAAHAGVPFALVGYYFGKKNELLKTMFEHRKPYITERMTRMREVDTSRDNPQAVEDIVRAWAEPVVALRADEDGESFSVLVARTMWEPGEEASAIQQEYYDPLATLFIDVMCKALPGTKRDTVVWGYEFALGALLMLVADRRVERLSKHGATWGDPKQCERLIRFLTEGFLSMAKK
>NZ_CP041743.1|WP_091007330.1|297021_298134_+|porin
MRKRKTALMAALLATAAGAQAQSSVTLYGRVDAGVEYMSGAPTGAGPNSPATGSASRFRAESGDWGTSLWGLKGTEDLGGGYAAVFHLEGAFNTMNGQGSSDGLFDRYATVGIASSQFGTLLLGRELFISNGVWDFDPFGQSNWSSASLVRGRNWLHSSNNISYQSPTIGGFDAFGQYALSNSTSWNGNGTTPQGRWAGLQLTYTSPLFQVRGIYDEIRNAQNGQLTDPFTASREYTAAVNVFLGKFKIQGAYQAIRTSGGDATAGVAPTTLDHEWGGVTWQATPAASLIAAVYHVNANKGAGNATIYTVGGTYNLSKRTLLDMQIATVQNSKTANFGLNANSAGDTVSSDNPIVGHSQSGVYAGIQHLF
>NZ_CP041743.1|WP_091007327.1|296432_296690_-|hypothetical-protein
MRHKLILSLLASLTMAGVAYTAHAASRDEQTKACKADAMHFCASDIPNKQKITACMKTHYDELSPGCKTMFHKPADGGSKQPVNR
>NZ_CP041743.1|WP_091008822.1|312707_313508_-|OmpA-family-protein
MKNNLIYTLFASGLMAMLAGCAGNNPAGSFPDVKSATMAEGIFVNVDNLRNVGAGLSKDQVYNLIGAPHFNESVFGVRTWNYLFNFRSADQVVSCQYQVAFGEDKKVSGVQWRDPSCADFLHTSSTPITPKIEKQVEVENVEQLTMRSDALFPFGKSDLDDMQPDGLEALDNLVTHIGKYNKLVRVHIVGHTDRIGSLSSNYKLSLARATAVRNFLVSKGVNRHLVSVAGVGSSQPVSHCGPGNGSSAIACLAPDRRVSVSITGVM
>NZ_CP041743.1|WP_091007352.1|314254_315217_-|agmatinase
MTELLYGDGAIRRPSLYGSSIENTYAGVLSFMRRRYTRDLDGVDAVVSGVPLDLATTFRSGARLGPAAVRAASVQLSELHPYPWGFNPFDDLAVTDYGDCWFDAHNPLTIKPAIVEHARTILRSNAKMLTFGGDHYITYPLLIAHAEKYGKPLSLIHFDAHCDTWADDSPDSLNHGSMFYKAVKDGLIDPATSVQIGIRTWNDDFLGINILDAAWVHEHGVRAAVERIVSIVGMRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQGLAIVRGLGALNLVGADVVEVAPAYDQSEITALAAAHIACDVLCLWRQQKVGAR
>NZ_CP041743.1|WP_091007355.1|315351_316842_-|aldehyde-dehydrogenase
MDKNSLAYWQDKAATLSIEGRAFIDGAYRDAQSGRTFDCVSPIDGKLLAKVADSGAADVDAAVAAARRAFDARVWSGLNPRKRKSVLLRWAKLMREHRDELSLLETLDAGKPIADTTSVDVPGAAYCVEWYAEAIDKVGGEVVPSDHHLVGLVTREPIGVVAAVVPWNFPLLMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLALDAGIPAGVFNVVPGGGEPGKLLALHADVDCLAFTGSTNVGKLIMQYAGQSNLKRVWLELGGKSPNIVLPDCPDLDRAANAAAGAIFYNMGEMCTAGSRLLVHRDIKDAFLERLAVAARGYTPGNPLDPQTSMGAIVDQVQLDRVLGYIEAGRAEAKLLLGGSRVKQESGGFYIEPTVFDVKPDAKIAREEIFGPVLSVITFDTVEEAVRIANDSDYGLAAAVWTGNLTTAHEVARSLRAGTVWVNCYDEGGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLVRLR
>NZ_CP041743.1|WP_091007358.1|316887_317439_-|cupin-domain-containing-protein
MSIEVATRLQYIRKKHGLSQRELAKRAGVTNGTISLIEQNRVSPSVGSLKKLLESIPMSLAEFFTFEVEASRGVVSRRVDMPNLGNESIEFYLAGSGMKDRNMCIMREVYQPLSDTGPEMLQHAGHEGGVVVSGQLELTVNETTWLLDPGDSYYFESRFPHRFRNPSAEQVCEVVSANSPPTF
>NZ_CP041743.1|WP_091007362.1|317860_318067_+|hypothetical-protein
MVRWDRSQPARCLRADRTIADGSNGRLAFRRFLSVFTILSRRSVRRHNAISARAFIAVRTDEVASLLP
>NZ_CP041743.1|WP_091008825.1|318347_319124_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MQTRPVVGISADRNMMGVHPSHMTGEKYIAAIVDGSQALALLLPALGDRQASADILQAVDGLLFTGSYSNVEPQRYGGHASAPGTLHDPARDATTLPLMRAAIAAGVPVLAICRGVQEMNVVFGGTLHQIVHTVEGLHDHRENKEDTLDTQYGPSHSLQLTPGGVLQQLAAGAAQVRVNSLHGQGIERLGAGLVTEAVAPDGLIEAVSVEGARAFALGVQWHPEWKFAADPLSTAIFRAFGDACRARIRNRAGALSAG
>NZ_CP041743.1|WP_091007365.1|319188_320523_+|glutamine-synthetase
MHEIDEFLKKHRITEIEAIIPDMAGIARGKIIPRSKFESGESMRLPQAVMIQTVTGDYPEDGTLTGVTDPDMVCVPDPSTIRIIPWAVDPTAQVIHDCVHFDGTPVEISPRRVLRRVLELYKAKGWKPVVAPELEFYLVDMNKDPDLPLQPPIGRTGRPETGRQAYSIEAVNEFDPLFEDIYEYCDVQELEVDTLIHEVGAAQMEINFMHGDPLNLADRVFLFKRTVREAALRHHMYATFMAKPMENEPGSAMHIHQSLVDEETGQSVFTGPDGKPTELFHSYIAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVQWGYDNRTVGFRIPHSGPAARRVENRIPGVDCNPYLAIAATLAAGYLGMTQKLKPTEPLTTDGYEQPYQLPRNLEEGLTLMGACEPMAGILGEPFVKAYLALKETEYGAFFRVISSWERRHLLLHV
>NZ_CP041743.1|WP_091007368.1|320560_321994_+|aspartate-aminotransferase-family-protein
MSYRIEDSAYILPAQPAGGQTLPSRSTAEYRALDAAHHIHPFSDMGALNRAGSRVIVKAKGVYLWDSDGNKIIDGMAGLWCVNVGYGRKELAEAAYGQMMELPFYNTFFKTTHPPVIELSALLAELTPEPFNHFFYCNSGSEGNDTVLRIVHQYWVTQGKQSKKYVISRRNGYHGSTIAGGTLGGMGYMHEQMPSKVEHIVHIDQPYFFGEAEGNLTPEEFGLARAQQLEAKILELGAENVAAFIGEPFQGAGGVIFPPSTYWPEIQRICRKYDILLVADEVIGGFGRTGEWFSHQHFGFEPDLITLAKGLTSGYVPMGAVGLHDRIAKAIIEHGEFNHGLTYSGHPVAAAVAVANLKLLRDEKIVERVKTDTGPYFQKLLRETFAQHPIVGDISGVGLVAGLQLAQEPKTRKRFANGGEVGTICRDFCFNGNLIMRATGDRMLLSPPLVITKQEIDEIVSTAKKALDSTAQQVGVS
>NZ_CP041743.1|WP_091007370.1|322076_323210_+|polyamine-ABC-transporter-substrate-binding-protein
MSASQSGRPPRLAVAGAALAVIAGLCTVLPPPARAADTELNVYNWSDYIAKDTIPNFEKETGIHVKYDNYDSDDTLQAKLLAGSSGYDIVVPTSNYMAKQIQAGVYQKLDKAQMPNLKNLDPVLMKMIADADPGNQYGVPWAYGTDGVGYNVQAVQKALGANAPVDSWALVLDPANLSKLKGCGVSFLDQAVDVFAATLQYMHKDPNSTNPADYQAAFEVLKKVRPYITQFNSSGYINDLANNDICVALGWSGDVGIARRRTQEAKRSYEIKFSNAKEGGLLWFDVMVVPKDAPHAEAAMKWINYIEDPKVNAAITNEVFYPTANKSARQFVTPGVSGDTTVYPGDEVLSKMTLMRPMPTDILRLQNRLWAQLKTGH
>NZ_CP041743.1|WP_091007374.1|323445_324600_+|polyamine-ABC-transporter-ATP-binding-protein
MISTPPIQAAQAAGQTVATKTKSDEFVRIENVVKKFGDSIAVDNVNLSIAKNELFALLGSSGCGKSTLLRMLAGLETATSGRIFVDGEDLAALPPYRRPVNMMFQSYALFPHMSVEANVAFGLKQEGTPKNEIKERVADVLNLVQMSKYTQRKPHQLSGGQQQRVALARSLVKRPKLLLLDEPMSALDKKIRQKTQLELVNIIEKVDVTCVMVTHDQEEAMTMAGRLAVMSEGRIVQIGSPTQVYEFPNSRFSAEFIGTTNMFEGHVVEDEPDHIFVESEDLETRMYVSHGITGPLGMPVGISVRPERIKVSRERPSSPHNWARGVVSDVAYMGSYSLYHVRLPSGKIVVSNLSSSHLMNEGAPDYNDDVFVYWSPNSGVVLTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041743_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041743_2

1215032-1215131

Orphan

Consensus_repeat	Method
ACGAGCCTGTCGAGTTCGACGTCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041743_2

>merge|NZ_CP041743|2|1215032-1215131|CRISPRCasFinder
ACGAGCCTGTCGAGTTCGACGTCGAGCGGCATCACGTCGTTATCGACTGGCCTGAGCACGACCAACAGTAACGTGACGAGCCTGTCGAGCTCGACGTCGA

>NZ_CP041743|2|1|1215032-1215131|CRISPRCasFinder
ACGAGCCTGTCGAGTTCGACGTCGA	GCGGCATCACGTCGTTATCGACTGGCCTGAGCACGACCAACAGTAACGTG
ACGAGCCTGTCGAGCTCGACGTCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041743.1\|WP_091012129.1\|1228743_1229541_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616
NZ_CP041743.1\|WP_091012127.1\|1226819_1228634_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP041743.1\|WP_091012109.1\|1211171_1211900_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP041743.1\|WP_091012116.1\|1222165_1223326_+\|DUF2827-family-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP041743.1\|WP_170275669.1\|1202832_1204200_+\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NZ_CP041743.1\|WP_091012131.1\|1229569_1230835_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223928
NZ_CP041743.1\|WP_091012119.1\|1223328_1224486_+\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP041743.1\|WP_091012123.1\|1225131_1225608_+\|DUF4019-domain-containing-protein	unknown	unknown	gnl\|CDD\|372517
NZ_CP041743.1\|WP_091012093.1\|1204213_1205119_+\|isocitrate-lyase/PEP-mutase-family-protein	unknown	unknown	gnl\|CDD\|119340
NZ_CP041743.1\|WP_143098069.1\|1212013_1212847_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP041743.1\|WP_091012104.1\|1208711_1210169_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP041743.1\|WP_091012134.1\|1230925_1231600_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP041743.1\|WP_091012136.1\|1232184_1232871_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP041743.1\|WP_091012101.1\|1207211_1208678_+\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NZ_CP041743.1\|WP_091012097.1\|1205115_1206525_+\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|183543
NZ_CP041743.1\|WP_091012088.1\|1201600_1202809_+\|PrpF-protein	unknown	unknown	gnl\|CDD\|225384
NZ_CP041743.1\|WP_091012125.1\|1225604_1226732_+\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP041743.1\|WP_091012121.1\|1224482_1225079_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041743.1\|WP_091012106.1\|1210193_1211027_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP041743.1\|WP_091012099.1\|1206517_1207153_+\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314

Protein	Function_ID	Function_description	E-value
NZ_CP041743.1\|WP_091012129.1\|1228743_1229541_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.00825e-27
NZ_CP041743.1\|WP_091012127.1\|1226819_1228634_+\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	5.89773e-14
NZ_CP041743.1\|WP_091012109.1\|1211171_1211900_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	5.75916e-66
NZ_CP041743.1\|WP_091012116.1\|1222165_1223326_+\|DUF2827-family-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	1.48015e-152
NZ_CP041743.1\|WP_170275669.1\|1202832_1204200_+\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	4.70328e-91
NZ_CP041743.1\|WP_091012119.1\|1223328_1224486_+\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	0
NZ_CP041743.1\|WP_091012123.1\|1225131_1225608_+\|DUF4019-domain-containing-protein	gnl\|CDD\|372517	pfam13211, DUF4019, Protein of unknown function (DUF4019). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 130 and 183 amino acids in length. There is a single completely conserved residue E that may be functionally important.	7.22223e-32
NZ_CP041743.1\|WP_091012093.1\|1204213_1205119_+\|isocitrate-lyase/PEP-mutase-family-protein	gnl\|CDD\|119340	cd00377, ICL_PEPM, Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), and 2-methylisocitrate lyase (MICL). Isocitrate lyase (ICL) catalyzes the conversion of isocitrate to succinate and glyoxylate, the first committed step in the glyoxylate pathway. This carbon-conserving pathway is present in most prokaryotes, lower eukaryotes and plants, but has not been observed in vertebrates. PEP mutase (PEPM) turns phosphoenolpyruvate (PEP) into phosphonopyruvate (P-pyr), an important intermediate in the formation of organophosphonates, which function as antibiotics or play a role in pathogenesis or signaling. P-pyr can be hydrolyzed by phosphonopyruvate hydrolase (PPH) to from pyruvate and phosphate. Oxaloacetate acetylhydrolase (OAH) catalyzes the hydrolytic cleavage of oxaloacetate to form acetate and oxalate, an important pathway to produce oxalate in filamentous fungi. 2-methylisocitrate lyase (MICL) cleaves 2-methylisocitrate to pyruvate and succinate, part of the methylcitrate cycle for the alpha-oxidation of propionate.	1.00526e-95
NZ_CP041743.1\|WP_143098069.1\|1212013_1212847_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	2.30249e-77
NZ_CP041743.1\|WP_091012104.1\|1208711_1210169_+\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.69601e-35
NZ_CP041743.1\|WP_091012134.1\|1230925_1231600_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	1.225e-36
NZ_CP041743.1\|WP_091012136.1\|1232184_1232871_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	6.99294e-61
NZ_CP041743.1\|WP_091012101.1\|1207211_1208678_+\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	2.51646e-129
NZ_CP041743.1\|WP_091012097.1\|1205115_1206525_+\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|183543	PRK12466, PRK12466, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP041743.1\|WP_091012088.1\|1201600_1202809_+\|PrpF-protein	gnl\|CDD\|225384	COG2828, COG2828, Uncharacterized protein conserved in bacteria [Function unknown].	2.12228e-121
NZ_CP041743.1\|WP_091012131.1\|1229569_1230835_+\|hypothetical-protein	gnl\|CDD\|223928	COG0859, RfaF, ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane].	1.20105e-06
NZ_CP041743.1\|WP_091012125.1\|1225604_1226732_+\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	0
NZ_CP041743.1\|WP_091012106.1\|1210193_1211027_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	3.25886e-51
NZ_CP041743.1\|WP_091012099.1\|1206517_1207153_+\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	5.0326e-89

>NZ_CP041743.1|WP_143098069.1|1212013_1212847_-|EAL-domain-containing-protein
MKNIGSGLSAPPSRAMDAGETSRRSDGALAARVRRGLHDGEFRVAFQPIIHAQTSRLSSIECLLRWQHPDYGLLLPGSFVEAFEDARAAREASYFVLESACEQLRTMQREGHPLPRVSINIQPSQLADDELITTIRATTERYGIDPSHLELELVETADASKLLAISEITDSLRQLGVRIAIDGFGSGYASLAILSSTQIDTIKLAREFMARVPTSHRACTVMSCVLDMLDKLAVTVVIEGVETEAQLRWLSRRAEVYAQGYHIARPQTKFAAAIAIG
>NZ_CP041743.1|WP_091012109.1|1211171_1211900_-|response-regulator-transcription-factor
MRIAILDDDADQAALTNDTLTTAGHTCHTFEQGQLLLRQLRRESFDLLVLDWNVPDLSGAEILEWVRQNLSERLPVLFVSSRARESDIVTMLNAGADDYVVKPVSPGVLTARVASLLRRSYPMNPASTKETFGNLEFDLKVRQVSVDGNPVSVTQKEFDLALLLFQHLSRPLSRAHILDAVWKQTTDIPSRTLDTHIAMVRTKLGLRPENGFRLTPIYGYGYRLEAVGQDDTNAATDGTANP
>NZ_CP041743.1|WP_091012106.1|1210193_1211027_-|GntR-family-transcriptional-regulator
MSTTPSAMPTLPRSRGTALHRQIFVVLRERIVTGRYAAGAVLPREEDLCEHFGVSRITARRALADLEAQGFVQRRQGIGTFVREDLPVARAAATLSFVDALHKSATDTKVEVLGVHIENVPASIAAQLQLAPDEPAVHALRLRKTGNVTLMVSDAWVPARFSKQVTASRLKKEALYEILMNQGVEFGRVIQEVTAVAADPTFAHWLGTDVGMPLLRVTRIVYDVSLEPVQHLTLTVSPEHSRIVTDLPVDKINTLGTGQIVHDVQPEELKRSKRRGV
>NZ_CP041743.1|WP_091012104.1|1208711_1210169_+|MFS-transporter
MSSPGKVIGAAEVRTTEAVSTYAVTGTIGARLDRLPASRTVWMLVVLISLGGFFEFYELFSTAYLAPGIIRSGILTETTKTFFGMTGLASFIAAAFAGLLVGTLMFGVVADRLGRRSVFTFALLWYTVSAAVMAFQTDAGGLNFWRFMVGVGLGVELVTIDTYLSELVPRHVRGRAFALNQVITYLSVPTIALLAWQLVPLAPLGFDGWRWVVLVGSVAAVLIWVIRTRIPESPRWLASHGEQARAEAVVAALEARVERDTGRALPPFERLQSPEPHVADSAETGQLREVFSRRYLSRTVMLCTFHVFQTIGLYGFSNWVPTFLVRQGIDVTASLGYTLGITLVMPCGPLVAMLYADRFERKWQIVASALLVAAAGLAFAQVRQPVWIVLTGGLVTLGATTLSYNFHAYQAELYPTRIRARAVGFVYAWSRLSGVFSGFLVSWALSRAGVSGALLLIAASMGIVALSIATLGPRTNGRSLESLTG
>NZ_CP041743.1|WP_091012101.1|1207211_1208678_+|MmgE/PrpD-family-protein
MSSITAVPTTDRRGASGAVPTDPDGPTGRLASWLAELQIGDIAERALERGKYLTLDGLGCALVGARLPWSSKATELVCALESGERATLIGSGRKTSVPAAALLNSTFIQSFELDDFHPLAPLHSASVVLPSLLASAELLGRVNGERFLLAAMCGYEVGPRVGLALHGSQMLSRGWHSGAVFGTHASAAAAGKLHGLDAAQFEDALGLAGTQSGGLMAAQFEAMSKRMHHGFASRSGLYAAVLAAGGYTGIKRVFEREYGGFLSTFGEGHAPDATQIAANLGSVWEVEKNIIKPYPAMGALLAPIEAVLEIRAQRPFNVDDIERIELDLASAAFHHGGWQAARPLTPIGAQMNLAYAVAVTAIDGEARMKQFSPARIDADDVWTLMQRITVRHETSYDEDGPLARGATRLRMFFTDGRCEDMLLRHPRGRPLVQMTNDEIVAKFRSLTGDVIDTARQQRIEELVLHIERLDDVGELIEALAPVVANPFA
>NZ_CP041743.1|WP_091012099.1|1206517_1207153_+|3-isopropylmalate-dehydratase-small-subunit
MNKVDIVTGAAAPLLRANLDTDTVIRIERLTQQPRHALGQYAFEALRRRADGSEDPDFVLNRQAYRAAPILLTGANFGCGSSREGAVWALFEAGIRCVIAESFGEIFYGNCFQNGMLPVRLDASQIAELAALSEAGEPVTVSLVDCTVSAGSTRFAFEIDPLRRDALMAGLDEITQTFAYREQISDWQMADRERRPWIWIPLERQPAQSGS
>NZ_CP041743.1|WP_091012097.1|1205115_1206525_+|3-isopropylmalate-dehydratase-large-subunit
MKPSVMFDKVWDSHVVAQAGDDIALLHIDRLLLHDLSGTAALHALHERGLPIHSPDLAFATPDHAVSTMPGRTGTTFAGGARLWAGLKALSSQGGVRFFDLGEPGQGIVHVMAPELGLVQPGATLVCGDSHTCTNGGVGALAFGIGSSEVTHVLATQTLWQRKPKTLRIRFDGRLQDGVFAKDLVLYLIGRLGAHAATGHAVEYAGEAIRALDVEARLTLCNLSIEFGAKVGMVAPDDTTYAYLEGRAYAPRGELFARAVDYWRTLPSDELARFDREVSFDAGTVPPMMTWGTSPEQVIAIDGRIPDPDAAPDAAHRDAWRNALDYMGLKPGDALEGTPVDWVFIGSCTNSRLSDLREAARLARGRHVAPGVRAWVVPGSEQVRRDAQAEGLDRIFLEAGFEWREPGCSMCVAANGETVPSGARAVSTSNRNFVGRQGPGARTHLASPQSAVAAAVTGVIADSRRLAHE
>NZ_CP041743.1|WP_091012093.1|1204213_1205119_+|isocitrate-lyase/PEP-mutase-family-protein
MKQAMKLREQLATGELLVAPGVYDGLTARIAEQAGFGTLYMTGAGTAAARGYPDYGLLTMTEMVENAGVIARSASVPVIADADTGFGNELNVTRTVREYELRGVAGIHIEDQLAPKKCGHLDGKELVSRAEFIAKIRAAVAARTSPDFVLIARTDARAVIGFDEAIWRANAALDAGADIAFVEAAQGLDEVAAVPRAVHGPCLLNIVRGGKTPDIGLRDVAEMGYRIAILPSLLLGAVIESCDRTLSALRETRVPPASAGHASVRERFRRLGADEWDAIRTRFRDPEPEVDGEPAVQGNAR
>NZ_CP041743.1|WP_170275669.1|1202832_1204200_+|MmgE/PrpD-family-protein
MKIATFANGFDPARIDGDHYRLCARSFADTFACAVAGRNEPASRAALRYLEHAGLVDVDVSSMQGSRAHLWGQPATASAEAAAFYNGVAGHVLDYDDVTVPLRGHPSVVLWPALMALAEAEDLSGERLASAYAVGFEALCRLARVIAAAQYEKGWHCTATLGAVAATVACGHLLRLDEAQIVHAIGLAVAQSSGVRANVGSDAKSFQAGQASAAAVRAALLAQAGFCASADALDGPHGYANLYAHGEDIGAALHALGPDARELERSGLDVKQYPMCYATHRVLDGLLAFRRERGVTLADVERVSIYTSRAALIPLTHHRPKTGLEGKFSLEYAVAAALADGHIRLATFTDEAVNRPHIQQFFECVDASDGDTPMLPRRADITLTLRNGTCERRSIETLHGSTQDPLTDDELTAKLADCLDWAGSHIDPQRLFSLALDLRSLRTRDLFNAFESPTH
>NZ_CP041743.1|WP_091012088.1|1201600_1202809_+|PrpF-protein
MLVTRHPELLAVPCTIMRAGTSKGLFFHDRDLPEPGAQRDAVLMAALGSSDLLQIDGLGGSRLVTSKIAIVKPSTRPDADVDYTYAIVPPARGIVVYTSNCGNISSGVGPFAIDTGLVDATGPITTMRIFNTNTKKILVAHVPVSDGVASVTGDFAIPGVPGTGAEIFMDYTHTIGAKTGHVLPTGRAVDTIALEDGRTLEVTLGDVANPCVFLRASDVGVSGSELPDQIDTMRALLDTLREARGKAAQRIGLCEHWTQAERDSPALPLVVLIAPPATYADAKGETVDAATMDLRARLIFYNRCHESMAGTGSMCTAAMSRVPGSIVHQAVPDATGGTLRIGHPLGVMAVAVQAHSAGAANEIVYTRLGFSRTARRLMEGVVYVPRAAIASAVTATPVEAHL
>NZ_CP041743.1|WP_091012116.1|1222165_1223326_+|DUF2827-family-protein
MRIGISVISHQGQNIWQNGLGQNIIFLARLFQRLPFVRGVTLIDVGDQGVMPEQVDTATLGLTVMSQREASDQVDVIIEMAGALDTQWLALMRARGKKAVYYCCGHPFAGLAEPAVFEKPSHFSRADRCDEIWSLPEYRLFASFQRTLHRCPVFTVPYLWHPQFVRQRIAEVETQGYRFGWEAARAKSTAGGAHKGLSVAIFEPNISVAKTSTISMLACDEAYRADRSSIEAMHVLNTLHMANHPTMLHLANSLDLVREHKSTFHGRHDIVGFMVQHADTVVSHQWTNDQNYSYLDALSGDYPLIHNSEWLKEFGAGYYYPEFDAVQGGAQLRHALAHHDAGLVDYHSASQRVFDAVDPFAAHNLQGYADRLLDLCRDTDFVDGRH
>NZ_CP041743.1|WP_091012119.1|1223328_1224486_+|DUF2827-domain-containing-protein
MTTPTPLQKGTGRLNVGVTIHVRKGTQSLWENGIFQNCLFLVLLLTRVPRIDKVFLVAGGDGSTEDARNFLGDSPAPVIDMNTAMETLDLMIEMSAQLGREWIVAFRERGGKVATMRVGNDYVIDAERMVFDKQHGLLISGAPYDEIWTLPQYEKTAAPYYRSAMRAEVRIVPHLWSSAVLEREVAALPAGTSFGYQPGRRRWRAGIFEPNICMVKTGFIPMLCCEVAHRADPDMLERVWAYNTFHLKEHVTFNGFAHSLNIVQHGLSSFEGRFPFVQIVSANVDVVVSHHWENAQNYVYYEALYGGYPLIHNSHLLGDCGYRYHDFDCEEGGAALRRAFAEHDTNLASYRQTAKTYLRRLDPENEVNVRAYADAIDALYVNRQP
>NZ_CP041743.1|WP_091012121.1|1224482_1225079_+|hypothetical-protein
MISALSRLAAYFRSGACATAAACCAVSMTMFVPAASAQSVLSAPTPSGPLNSMAAAVNNVGIKQCRPQLTSLSTLGVQGTASNDLLLDWDHKRVNSSPVFSLIGLDYGSNAAAMSITAVPEADGSCSVLAERISAAPVACKTIATQELHGYRATPLLNQMTVYTDGKDPGSSVSLIDSPPGCLVIRRYVAFSKAASAH
>NZ_CP041743.1|WP_091012123.1|1225131_1225608_+|DUF4019-domain-containing-protein
MKHRFTKLAATTLLMSFAAGAMAAGTSADELLHDADAVLQQIDASHGGALWDNAAPFVKTKFERAQFITQLQQQRQSYGAVSSRGWASVTRLQYTNSHDVPDGLYANVDYASHTTDGQTVFELVSFRLESDGQWRLVGYNARRNQERNATVQPAAPKP
>NZ_CP041743.1|WP_091012125.1|1225604_1226732_+|DUF2827-domain-containing-protein
MNALRVGITIGLHHEAETLWNNGIKQNAVFLAEALRQCPNVAATVLVNTTQTAITDKLPWDQTRWPTRTFDDAKDTLDVLIELGGQIDAAQTEYLKQRGVRLVSYCCGFEYVHAMESVLFRRPLWGENLFVNQRYDDIWMIPQVDNISRSYFEVLRRLPARVAPFIWSPMFVEERSKDLPESGRYRPGSGPKRLSVIEPNHNVVKFCLYPALIAELVYRERPDSIAILQVTNAEQIARESHEFIALMNQLDIVRNHKAVFLGRHDTPEFLARNTDIVISHQLENPLNYIYLEVCWQGYALVHNASLCPELGYYYPANDAAKGAQQVLSALDQHDAHASWYRERQRTMIGRFLPDNPQLVATYSALLDDLVRKPIR
>NZ_CP041743.1|WP_091012127.1|1226819_1228634_+|hypothetical-protein
MLFGRIAGLIEAGDLVDAAHEIAHWRSAQPDDAGALTLAARVMRLCGRYGEATTTLGHALGVVPGYVPALVEMARTARTQGQAGPAAEWFARAWQAQQATHGEYGDHDWPAEWMELLSQSGRNQEGRDIAAVWCERDGKRAAPWFTLGLACQRDGELNAAFDAYSRAMQIDPDLPMLRSNLAALYNQLKDAQTARRLALDVIRGDPDNSLAWVNLSSAYLALRQPENALIAADRACVLAPSYNEALGGRISALKELQRWDEALATAIHLAQLAPNNRRVQWTVAMLQLVRGDYANGLINHEARWQGSGELAKVPVFRPEHRWQGEDLAGKTLFVWGEQGFGDALQFVRFVPLIAERVKAAGGTLAYNCFAGVLPLFQRSLARYGIEPVAHNAGNLAAFDFHVPIGSLPLMFGMTAETIPLPEGYLLADANRVAQWRGKLGGPEKLRVGLVWSGSRGHQRNPLRSIDPMKYAQTFAGVAGVEFYSLQVDDRDSVVRMRDAGLPVSDPTPELASFDDTAALMSSLDLVITVCTSVAHLGGALGVPTWLLLDVNPHWVWMLERSDSPWYSSLKLFRQSAYGDWSPVLDALQTALRERTEQHARQHTG
>NZ_CP041743.1|WP_091012129.1|1228743_1229541_+|class-I-SAM-dependent-methyltransferase
MSLANMQVVPQQTLCKCCGQSSRLCGVVDFSRCGADQHAGKKVDPYVGVPIYYYRCDECHFVFTQAMDAWTNQDFATCIYNDDYDRHDPDYLGKRPRDNAEIIAGNFPEMAQANLLDFGSGLGLLEKELRARGFTQIDSYDPYTSGETGRTGLAAKYRTVVAFEVFEHHPQPRELMADLAALLDDDGAIFFSTLLVSDEIASEGIDKWWYCAPRNGHISFFTPQSLSRIGAEHGLKLGSFNEGFHFFFRQQPPAWAVKFSHQAWS
>NZ_CP041743.1|WP_091012131.1|1229569_1230835_+|hypothetical-protein
MQQSIDEEALVSAYTTYLSKGDFASAMSWCRALRLSGRAGEAQDLCTRWIDKVDGPYECAQLGIDMIYLGMFAQGEAQLTAAMGAFPYGTNRHLAMSELAIAKYQLGKYYEAHEIFRSLRDKGESANLVRLLYPDAGEDTWRHFQQKFLALSDSIAGRRVGIVQEGGMGDLIMYSRYVDMLLQEGASSVCIQTPPALRSCIKPDPRITLVEQLDAELLECDFITTMFSLFARYQSNPYFPNAPSSIIALPPLHAFSGSPATLIDEGTTERKVGLIWRSTSGVRHEPYRSIDLRKLLPLLENQSCRFFSLQVGELSADEKTLMSEHGIVDLGPHLATFADAAAIMRKLDLLISIDTGPAHLAGTLGCPVWLLLSQACDSRWYDDPRFTPWYASMRLYRQRKLGDWTEPLDEAKVALALPAIG
>NZ_CP041743.1|WP_091012134.1|1230925_1231600_-|OmpA-family-protein
MKKIALCWFALAAALTGCTASSGPTYTAYSIDMPGHPKAYRVECGGIFESSNNCMKTAQHICGDQPVQVIQSIDALRTDGSAANPRTLTFQCGAPEVAAAPPPPAPVPAAAPQTLELSGEANFVTDRADLTPAATAKLDKLISDSKDATFANVTVNGYTDSTGSRAHNEGLSRRRAESVLSYLKEHGLKSAAFEAHGFGPDNPVASNATREGRAKNRRVTVSAR
>NZ_CP041743.1|WP_091012136.1|1232184_1232871_+|response-regulator-transcription-factor
MRVCILDSDIQILDMISRVLEGAGHVCHQFTEGRMLIKHLQRQSLDLVILEWNLPDISGGEVLSWVRKHLPPGVLVMFLTNRRRDTDIVSIFNGGADDCVAKPVSPSVLAARIESLLRRKHTTASVADSVSYGPYTFHGGGTVTMNDNVLPLTRKERDLALMLFQHVNQPVSRDHLLEVVWKSDVRFESRTVDTHISVLRKKMQLHPGTGFRITTIYGYGYRLEAVGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP041743_1	1.2\|309755\|55\|NZ_CP041743\|PILER-CR	309755-309809	55	NZ_CP041743.1	309199-309253	2	0.964

1. spacer 1.2|309755|55|NZ_CP041743|PILER-CR matches to position: 309199-309253, mismatch: 2, identity: 0.964

ttgtccagagcgttctggttacccacgacacccgcatttgcactgtcagccagcg	CRISPR spacer
ttgtccagagcgttctggttacccacgacacctgcatttgcgctgtcagccagcg	Protospacer
********************************.********.*************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041745_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041745_1

3983347-3983438

Orphan

Consensus_repeat	Method
TTTCTTCGATCCGGCCAGCGGGCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041745_1

>merge|NZ_CP041745|1|3983347-3983438|CRISPRCasFinder
TTTCTTCGATCCGGCCAGCGGGCAACGGGCGAACTGATATCGCACCGCAGCCGGTAAAGCATCTACGTTTCTTCGATCCGGCCAGCAGGCAA

>NZ_CP041745|1|1|3983347-3983438|CRISPRCasFinder
TTTCTTCGATCCGGCCAGCGGGCAA	CGGGCGAACTGATATCGCACCGCAGCCGGTAAAGCATCTACG
TTTCTTCGATCCGGCCAGCAGGCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041745.1\|WP_091019937.1\|3991644_3993459_-\|aminopeptidase-P-family-protein	unknown	unknown	gnl\|CDD\|238518
NZ_CP041745.1\|WP_091019866.1\|3977672_3978767_+\|redox-regulated-ATPase-YchF	unknown	unknown	gnl\|CDD\|236583
NZ_CP041745.1\|WP_091019839.1\|3993478_3993733_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041745.1\|WP_091019852.1\|3986727_3987255_+\|2,4'-dihydroxyacetophenone-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|380436
NZ_CP041745.1\|WP_091019872.1\|3973373_3975164_-\|M61-family-metallopeptidase	unknown	unknown	gnl\|CDD\|226483
NZ_CP041745.1\|WP_091019878.1\|3970848_3971475_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143624
NZ_CP041745.1\|WP_091019842.1\|3991030_3991582_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP041745.1\|WP_091019848.1\|3988666_3989395_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187605
NZ_CP041745.1\|WP_091019876.1\|3971537_3972356_+\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NZ_CP041745.1\|WP_091019940.1\|3985467_3986604_+\|DUF748-domain-containing-protein	unknown	unknown	gnl\|CDD\|377502
NZ_CP041745.1\|WP_091019846.1\|3989432_3990245_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP041745.1\|WP_091019859.1\|3981363_3982209_+\|sn-glycerol-3-phosphate-ABC-transporter-permease-UgpE	unknown	unknown	gnl\|CDD\|182875
NZ_CP041745.1\|WP_091019850.1\|3987322_3988624_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP041745.1\|WP_091019870.1\|3975322_3976048_-\|DsbC-family-protein	unknown	unknown	gnl\|CDD\|239318
NZ_CP041745.1\|WP_091019868.1\|3976201_3977374_-\|UbiH/UbiF-family-hydroxylase	unknown	unknown	gnl\|CDD\|181057
NZ_CP041745.1\|WP_091019861.1\|3980482_3981367_+\|sn-glycerol-3-phosphate-ABC-transporter-permease-UgpA	unknown	unknown	gnl\|CDD\|182550
NZ_CP041745.1\|WP_091019874.1\|3972535_3973135_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP041745.1\|WP_091019863.1\|3979042_3980368_+\|sn-glycerol-3-phosphate-ABC-transporter-substrate-binding-protein-UgpB	unknown	unknown	gnl\|CDD\|182876
NZ_CP041745.1\|WP_091019844.1\|3990410_3991034_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|319790
NZ_CP041745.1\|WP_091019854.1\|3983646_3985311_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992

Protein	Function_ID	Function_description	E-value
NZ_CP041745.1\|WP_091019937.1\|3991644_3993459_-\|aminopeptidase-P-family-protein	gnl\|CDD\|238518	cd01085, APP, X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also known as X-Pro aminopeptidase, proline aminopeptidase, aminopeptidase P, and aminoacylproline aminopeptidase. Catalyses release of any N-terminal amino acid, including proline, that is linked with proline, even from a dipeptide or tripeptide.	2.02417e-116
NZ_CP041745.1\|WP_091019866.1\|3977672_3978767_+\|redox-regulated-ATPase-YchF	gnl\|CDD\|236583	PRK09601, PRK09601, redox-regulated ATPase YchF.	0
NZ_CP041745.1\|WP_091019852.1\|3986727_3987255_+\|2,4'-dihydroxyacetophenone-dioxygenase-family-protein	gnl\|CDD\|380436	cd20302, cupin_DAD, 2,4'-Dihydroxyacetophenone dioxygenase (DAD), cupin domain. 2,4'-Dihydroxyacetophenone dioxygenase (DAD) catalyzes the oxidation of 2,4'-dihydroxyacetophenone to 4-hydroxybenzoate and formate as part of the 4-hydroxyacetophenone catabolic pathway. This enzyme is a homo-tetramer containing one iron per molecule of enzyme. This enzyme is an unusual dioxygenase in that it cleaves a C-C bond in a substituent of the aromatic ring rather than within the ring itself. As a bacterial dioxygenase, DAD plays an important environmental role in the aerobic catabolism of aromatic compounds; expression of this enzyme in appropriately engineered microorganisms has the potential to use these aromatic pollutants as a carbon source and thus remove them from the environment. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.44737e-57
NZ_CP041745.1\|WP_091019872.1\|3973373_3975164_-\|M61-family-metallopeptidase	gnl\|CDD\|226483	COG3975, COG3975, Predicted protease with the C-terminal PDZ domain [General function prediction only].	0
NZ_CP041745.1\|WP_091019878.1\|3970848_3971475_+\|CYTH-domain-containing-protein	gnl\|CDD\|143624	cd07756, CYTH-like_Pase_CHAD, Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain. This subgroup belongs to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily. Members of this superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). A number of proteins in this subgroup also contain a C-terminal CHAD (Conserved Histidine Alpha-helical Domain) domain which may participate in metal chelation or act as a phosphor-acceptor. The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup have not been characterized.	2.26369e-67
NZ_CP041745.1\|WP_091019842.1\|3991030_3991582_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	7.0886e-49
NZ_CP041745.1\|WP_091019848.1\|3988666_3989395_+\|SDR-family-oxidoreductase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.20463e-69
NZ_CP041745.1\|WP_091019876.1\|3971537_3972356_+\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	3.12475e-138
NZ_CP041745.1\|WP_091019940.1\|3985467_3986604_+\|DUF748-domain-containing-protein	gnl\|CDD\|377502	pfam05359, DUF748, Domain of Unknown Function (DUF748).	1.91252e-13
NZ_CP041745.1\|WP_091019846.1\|3989432_3990245_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.35436e-62
NZ_CP041745.1\|WP_091019859.1\|3981363_3982209_+\|sn-glycerol-3-phosphate-ABC-transporter-permease-UgpE	gnl\|CDD\|182875	PRK10973, PRK10973, sn-glycerol-3-phosphate ABC transporter permease UgpE.	0
NZ_CP041745.1\|WP_091019850.1\|3987322_3988624_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.49179e-95
NZ_CP041745.1\|WP_091019870.1\|3975322_3976048_-\|DsbC-family-protein	gnl\|CDD\|239318	cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.	8.38069e-83
NZ_CP041745.1\|WP_091019868.1\|3976201_3977374_-\|UbiH/UbiF-family-hydroxylase	gnl\|CDD\|181057	PRK07608, PRK07608, UbiH/UbiF family hydroxylase.	0
NZ_CP041745.1\|WP_091019861.1\|3980482_3981367_+\|sn-glycerol-3-phosphate-ABC-transporter-permease-UgpA	gnl\|CDD\|182550	PRK10561, PRK10561, sn-glycerol-3-phosphate ABC transporter permease UgpA.	5.55527e-145
NZ_CP041745.1\|WP_091019874.1\|3972535_3973135_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	4.53258e-83
NZ_CP041745.1\|WP_091019863.1\|3979042_3980368_+\|sn-glycerol-3-phosphate-ABC-transporter-substrate-binding-protein-UgpB	gnl\|CDD\|182876	PRK10974, PRK10974, sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB.	0
NZ_CP041745.1\|WP_091019844.1\|3990410_3991034_-\|HAD-family-phosphatase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.40766e-37
NZ_CP041745.1\|WP_091019854.1\|3983646_3985311_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0

>NZ_CP041745.1|WP_091019859.1|3981363_3982209_+|sn-glycerol-3-phosphate-ABC-transporter-permease-UgpE
MIENRRGFDLFCHAVLLIGVVLVVFPVYVAFCAATMSEHEVFSVPLSLIPSTHLFENIAAVWSHGSGNAASPFGRMLFNSLVMALIISIGKIAISMISAYAIVFFRFPFRNTAFWLIFVTLMLPVEVRIFPTVQVVSSMHLSNTYAGLTLPLIASATATFLFRQFFMTLPDELMEAARIDGAGPLRFFWDVVVPLSKTNLAALFVITFIYGWNQYLWPILITSQQSLTTAVVGIKSMIASGDTATEWHLVMTATLLAMLPPLAVVLTMQRWFVRGLVDAEK
>NZ_CP041745.1|WP_091019861.1|3980482_3981367_+|sn-glycerol-3-phosphate-ABC-transporter-permease-UgpA
MEKRSRFGTGVLPYLLVAPQLLITAVFFLWPAGAALWQSTQSQDAFGTSSEFVGLANFKQLFADPLYLSSLTTTLIFCALVTVFGLVISLLLAACADRVTRGAKAYQTLLIWPYAVAPAIAAVLWSFLFNPSIGIVTYALAKYGIVWNHALNAGQAMFLVVLASVWKQVSYNFLFFYAGLQAIPRSLIEAAAIDGAGPVRRFFGIALPLLSPTSFFLLVVNLTYAFFDTFPVIDAATGGGPAQATRTLIYKIFAEGFQGLDIGSSGAQSVVLMVIVVGLTVVQFRFIERRVQYS
>NZ_CP041745.1|WP_091019863.1|3979042_3980368_+|sn-glycerol-3-phosphate-ABC-transporter-substrate-binding-protein-UgpB
MKFKPLFRSFSVAAVLALGVAQSAHAATEIQFWHAMEAALGEHLNDIATAFNASQSDYKIVPVFKGSYDQTLAAGIAAYRSGNAPAILQVYEVGTATMMQAKKAVIPVSDVFKQAGVPLDEKAFVPTIASYYSDAKTGELISMPFNSSTPVLYYNKDAFKKAGLDPNKPPKTWQELQQDAQKLKASGMSCGYSSGWQSWIQLENYSAWHGVPFASENNGFDGADAVLEFNKPLQIAHIQFLQTMLKEGTFTYVGRKDEPVSKFYSGDCGIITNSSGSLATIKKYAKFSFGTGMMPYDANVKGAPQNAIIGGASLWVLSGKDAATYKGVAKFLAYLSSPAVAAKWHQDTGYLPVTTAAYQLTQQQGFYDKNPGSDTAIKQMLNKPPLPFTKGLRLGNMPQIRTIIDEELEQVWAQKKSPKDALDSSASRGDELLRRFEKAGS
>NZ_CP041745.1|WP_091019866.1|3977672_3978767_+|redox-regulated-ATPase-YchF
MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGIVEVPDARLTALADIVKPERIVPAIVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVVRCFDDENVIHVAGKIDPLSDIEVINTELALADLATVEKSLTRYSKAAKSGNDKEAGKLAAVLEKVRAQLDQAKPVRALDLSDDENALLKPFCLITAKPTMYVANVKEDGFENNPHLDAVRKHAEAENAPVVAVCAAIEAEIGELGDEDKEVFLADMGMDEPGLNRVIRAGFKLLGLQTYFTAGVKEVRAWTIHIGDTAPQAAGVIHTDFERGFIRAQTIGFADFVAYKGEHGAKEAGKMRAEGKEYVVHDGDVMNFLFNV
>NZ_CP041745.1|WP_091019868.1|3976201_3977374_-|UbiH/UbiF-family-hydroxylase
MNAHHQTFDVAVIGGGLVGKTAALALTQGGLRVALLAQPCVPPPADAAFDARVYALSASSQALLERLRVWQALDPSRLSPVYDMRVFGDAHAELHFSAFQASVPQLAWIAESSLIEQALDAALRFQPNLTWLDARAQALDVKASGATIALANGRTIETDLVVGADGAHSWVRAQIGSKVLRRDYQQTGVVANFKAERPHGETAYQWFSGGEIVALLPLPDGHVSLVWSARTEHADALLEHDPAKLAAEVERVTQGTLGALECVTPAKGFPLALQTVDRLIAPRVALVGDAAHLIHPLAGQGMNLGLRDVMSLAEVVAQKEAFRDLGDTVLLRRYERSRREDIRALMLATDGLQKLFAVPGPLARVVRNAGMAMIGAQPLVKRWLVSAALG
>NZ_CP041745.1|WP_091019870.1|3975322_3976048_-|DsbC-family-protein
MKKPIRIVALVLAVAAATLGCTAQADQTTDKLKAALQTRLADATIKSIEKSPIAGLYEVNLGSQIIYSDATGDYLILGDLIDAKNHKNLTEARLSETNRINFASLPFANAVKVVKGNGSRQIAVFSDPNCPYCKQLENTLKSVDNVTVYTFLYPVLSPDSEVKSKSIWCSTDRAKAWESWMQNRTAPTAAGTCDTAAIDKNLKLGHEMNVTGTPTVFLADGRRLPGAVPADELNKQISAVR
>NZ_CP041745.1|WP_091019872.1|3973373_3975164_-|M61-family-metallopeptidase
MKPIRYTIVPSQPAAHLFEVTVTVADPDPAGQRFMLPVWIPGSYMVREFARNIVTLRAFNDAGRKVRVTKTDKHTWQVAPVKGALTLRYEVYAWDLSVRAAHLDDTTGFFNGTSVFLAVPGHEDAPCVVEIQKPAGAQYRQWRVATALPEARGTKRYGFGEYRAQNYDELIDHPVTLGEFALKTFKAHGVPHDIVISGRVVGLDMERLAADLKRICEAQIALFEPKSKKAPVDRYVFMTQAVSDGYGGLEHRASTALICNRGDLPVTGREPMTEGYRTYLGLCSHEYFHTWNVKRIKPAAFAPYDLTRENYTSLLWLFEGFTSYYDDLILVRSGVITQDDYFGLVGKVVGGVQRGSGRLKQTVAESSFDAWVKYYRQDENAPNAIVSYYTKGSLIALAFDLTIRAQTRNRKSLDDVMRLLWQRYGRDFYRGKPVGVEEADVEALFAEATGANLAELFTDGVRGTVDLPLAALLAPFGVSLKPETDVGAKPSLGARVRGGADCTLAAVHDGSAAQKAGLSAGDVLVAIDGLRVTGANLDALLARYLPGAKVEVHAFRRDELRVVQLKLDAPEVARYVLSAADSRAAGTRARDRWLKA
>NZ_CP041745.1|WP_091019874.1|3972535_3973135_-|NAD(P)H-dependent-oxidoreductase
MTTILQINSAARSQGAQSTLLADELTAKLQQSNPGAQVVVRHLHAEPLPHLDDEILGAFFTPAEQRNAEQQAISARSEALIAELQAADIVVIAAPMYNFGISSQLKTYFDFIARAGITFRYGASGPEGLVKGKKVFIVAARGGKYVGTPGDTHTPYLKTFLGFLGMTDVNFIYAEGLNMGPDAAAAALAGAREVIATAA
>NZ_CP041745.1|WP_091019876.1|3971537_3972356_+|uracil-DNA-glycosylase
MTSSSRSRTPQASQPSLFADEPAAAAPVAIPAGVQPLEAQFDALPPAWRALLDPFIGSEAYTALCRFVDGERAAGKTVYPADVFRALRLTSPDEVKVVILGQDPYHGEDRDTPQAHGLAFSVPPGVRPPPSLKNIFKEIAASLGHEAPAHGCLDAWAQQGVLLLNTVLTVERNNAASHAKRGWEKCTDTLIHELAQRHDGLVFMLWGAHAQAKRALLGGRSHKVLEAPHPSPLSAHRGFLGCGHFSLANAYLVEAGRKPIDWRLPEIARTLA
>NZ_CP041745.1|WP_091019878.1|3970848_3971475_+|CYTH-domain-containing-protein
MGIEREIKLALPADQTDAATQWFVARTAQAGHAVPLANRYFDTPALALARAKSALRLRHTPEGWLQTFKTAGTSQAGLHSRHEWEMPVAGPALEIDALLRACDDEPSAAALREAAPELVELFRTDFTRTIWHVDHTGAAIEAAIDQGEVVAQVNGETRRAPLCEIELELKHGDESALHTLAAELRAHIPGLTPDDISKAQRGYRLQER
>NZ_CP041745.1|WP_091019854.1|3983646_3985311_+|energy-dependent-translational-throttle-protein-EttA
MAQYVFTMNRVGKIVPPKRQILKDISLSFFPGAKIGLLGLNGSGKSTLIRIMAGVDKDIEGEATPMPNLNIGYLPQEPQLDPQKTVREAVEEGLGEVFGAQKKLDEIYAAYAEPDADFDALAAEQAKYEAILATADGSAEQQIEIAADALRLPAWDAKIENLSGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVEWLEQFLTRFPGTVVAVTHDRYFLDNAAEWILELDRGHGIPWKGNYSSWLDQKEERLKQEESSESARQKAIKKELEWVRQNPKGRQAKSKARIARFEELNSQDYQKRNETLEIFIPVGDRLGNEVIEFKNVSKAYGDRLLLDNVSFKVPAGAIVGIIGPNGAGKSTLFRMLTGKEQPDSGEIVQGPTVKLAYVDQSRDALDGSKTVFEEISGGADVLTVGKYETPSRAYIGRFNFKGGDQQKNVGNLSGGERGRLHLAKTLIAGGNVLLLDEPSNDLDVETLRALEDALLEFAGSVMVISHDRWFLDRIATHILAFEGDSQITFFDGNYQEYEADKIKRLGEEAARPKRLRYKPIAR
>NZ_CP041745.1|WP_091019940.1|3985467_3986604_+|DUF748-domain-containing-protein
MATSIRKRVVIAAVCVVAALAGIALAGLYFVQREVRARIVEVLGPLGSAERIDVGLSSVRLVKVRLKAPSGWPTPDVLRADQITLTPDIRDLLARRVHLRDIVVSGFDLTVLRTKDGKLRLLPNLRQSSSNAQAAGAASTSASSKPSPSAEKLIDHIVFEHGTFEFYDLSVSDPAYRVTVSDANATVDHLHLPALSEPTTVAVTGSIKGPQHTGTVSFGGWIKIASKDSQTTTTLRGVDVVTLDPYLLKKAGAKARVNGGTLDLSIDSTVRDYQLHAPGTLTLHDLQIAPSDDPLDTFMSIPTRVAIAALKLHSGAITLHFVLDGNLKDPKFTLDDNFATELRAGLAKVLGVSAEGVAKGAGQTVKGLGNALLNLIGQ
>NZ_CP041745.1|WP_091019852.1|3986727_3987255_+|2,4'-dihydroxyacetophenone-dioxygenase-family-protein
MAAPTTGADALTPYQLPNPPEALREIVVESAVPKDERLWVPQAENVWFRPLCLNVSSGYWMNLLRVRKSGVLSRHRHPQAVHGMVLKGKWRYLEHDWVATEGSYVFEPPGETHTLYVPEDVEEMITYFQVNGVMYYCDPYGNFTGYEDVFTKLEMCRAHFERVGLGGGFVDQFVR
>NZ_CP041745.1|WP_091019850.1|3987322_3988624_+|MFS-transporter
MQAKTPRLRRIQWVALAFLMLAGIVNYLDRSTLSIANHSVSGELGLSASQMGLLLSAFSFSYAFSQLPVGVLLDRFGARIMLGLGMLVWSVAQLFGGLVHTLPQFLAARICLGIGEAPQFPAGAKVVSEWFSLRERGRPSGIFVASSTIGPALAPPILTSLLLVFGWRWMFIVMGVLGIAVALGWYAVYRNRSEVALAPEELVHLTEEEPHARAERRVTFAEWRGLFAAPTTWGLIFGFMGVVYMVWLYLTWLPAYLEHERHLSIARTGWIVSIPYLFGTLGMLSSGFVADGLMARGVAPIRSRKWPICTGLIFAAIFTVPAAYTPNTTLAIVYLSLAMYFINLASGGAWALVSVAAPRHLVASLGSIQNFGGYFGGSFAPFITGVVVDRTHSFVNAFLISAAVSVVAALVYMFVVRVPIAERVDQGAAARLA
>NZ_CP041745.1|WP_091019848.1|3988666_3989395_+|SDR-family-oxidoreductase
MTFQHDLFAGKTAVVTGGTQGIGAGIAHRLAALGARVVAAGLTPTDAQRASFGAGIEVVALDVSSNDEVAALFAPLTSLDILVNCAGMIRRGDEHEIEVFEQVIDVNLTGTMRACSVARALLAASRGTIVNTASMLSFFGGGLVPAYSASKGGIAQLTKSLALAYARDGIRVNAVAPGWIATPLTQALQDDDVRSRAILERTPLGRWGEPDDIAQAVAFLCSPAAAFITGTIVPVDGGYLAA
>NZ_CP041745.1|WP_091019846.1|3989432_3990245_+|IclR-family-transcriptional-regulator
MTISADTADNHDARATGTAAFSKFMTVLQLIADAASPLGIAQLAALSGYPRPTVYRIVGALIAEGLVVDSLRGSTFELGPRLITLASRSWERSDLRVAAIDALQTLRDITQETVHLAVRSGSEMVFIEKLESPHAVRMASRIGTRVTLYSSSVGKAYLAALDTGTRTALLRGVALERLTPNTIVEPAVLAAELETTRERGHAEDREENEAQIFCYGCAIPDPDGRPVACISVSIPLFRRSATPQETYIAPLRDACRAVAERLTPMSRGGV
>NZ_CP041745.1|WP_091019844.1|3990410_3991034_-|HAD-family-phosphatase
MTIKAVVFDFGGVLIDWSPEHLYRKLIPDEAERRWFLTHVCTMDWVVRQDGGQPLAEGTAELVAKFPEHEALIRAFYTRWHEMIGGLHEDTMAIVETLEAAGVPLYGLTNWSDETFPYAWEHFPMLRRFHDIVVSGRVKLVKPDPAIFAAMRERIEVRLPGIAPGELAFIDDNRKNVEAATALGWHAIHHTSAAITAAALRELGLPV
>NZ_CP041745.1|WP_091019842.1|3991030_3991582_-|cysteine-hydrolase
MAGVAVVVIDVQRAFFFGPDAAYRGDEVVAEINRLTGAARAAGAPVFFVQHDGEAGDEVEPHTEGWQLHPGFVRSDTDVVVNKAVGDSFHETPLADMLARRDVDSLLICGYATEFCIDATARRAAFLGYRTTVVSDLHTTQHTSSLTPQQIVDHYNQLWPRASLSGNRVAVRPLADVLAAEFA
>NZ_CP041745.1|WP_091019937.1|3991644_3993459_-|aminopeptidase-P-family-protein
MNARLPETSTIPERIAALRAAMSREGLAAYLVPSADPHLSEYLPGRWQSREWLSGFTGSAGTLVVTGSFAGLWTDSRYWSQAEAQLAGTGVQLMKMLGGQQSAPHFEWLAQNVASGSAVGVDGAVLGIAPARALTDALTARGVQLRTDVDLLDTIWPQRPALPVDAVYEHIAPHASVTRTDKLDQVRRAMQEKGAQWHFISTLDDLAWLFNLRGADVSYNPVFVAHALIGLDSATLFVSNGKVPEALAASLARDGVRVEPYAHAVPALVALPAGTTLLIDPRRVTLGVMKSLPSTVKVIEAVNPSIFFKSRKTEAEAEHIRATMEQDGAALAEFFAWFEGALGHQTITELTIDERLTAARARRPGFTSLSFATIAGFNGNGAMPHYRATEASHATIEGNGLLLIDSGGQYLSGTTDITRVVPIGTISDAHRHDFTTVLKGTMALSRARFPRGIRSPMLDAIARAPIWEAGADYGHGTGHGVGYFLNVHEGPQVIAHYAAAESWTAMEEGMITSIEPGLYRPGKWGVRIENLVLNRAAEQTEFGDFLRFETLTLCPIDTRCLALPLLRDDERAWLNSYHETVRARVSPHVSGDAKAWLEARTQPV
>NZ_CP041745.1|WP_091019839.1|3993478_3993733_-|hypothetical-protein
MGWFGIIVLGAAVGLAGAWLHPLRRATRARWWLAVVAGIAGAALGLMAGNVTGLFHDGDTLEWPFCTAFAFIAVALTVGLFSRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6191 : 70132

Liberibacter_phage(14.29%)

integrase,protease,transposase,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_091020679.1\|6191_6656_+\|transposase	transposase	NA	NA	NA	NA
WP_170275755.1\|6655_7009_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	6.7e-18	38.5
WP_091020683.1\|7101_8712_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.5e-56	32.3
WP_091020686.1\|8957_10085_+	J domain-containing protein	NA	NA	NA	NA
WP_091019194.1\|10109_10529_+\|integrase	integrase arm-type DNA-binding domain-containing protein	H2BDA3	Pseudomonas_phage	1.0e-09	32.1
WP_091019196.1\|10537_11248_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_091019199.1\|11250_14532_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	2.7e-60	26.4
WP_091019201.1\|14763_16038_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	8.9e-36	43.2
WP_091019203.1\|16034_17651_-	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	4.4e-96	38.9
WP_170275765.1\|18350_19463_+	nucleoid-associated protein	NA	NA	NA	NA
WP_091019208.1\|19465_20698_+	hypothetical protein	NA	NA	NA	NA
WP_091019209.1\|21027_21954_-	hypothetical protein	NA	NA	NA	NA
WP_143098170.1\|21950_22754_-	hypothetical protein	NA	NA	NA	NA
WP_170275766.1\|23145_23307_+	hypothetical protein	NA	NA	NA	NA
WP_091019537.1\|23721_24129_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_091019539.1\|24563_25055_+	hypothetical protein	NA	NA	NA	NA
WP_091019212.1\|25069_27034_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_091019214.1\|27020_27959_+	TniB family NTP-binding protein	NA	NA	NA	NA
WP_170275767.1\|27960_29472_+	hypothetical protein	NA	NA	NA	NA
WP_143098171.1\|29798_31181_+	hypothetical protein	NA	NA	NA	NA
WP_091019222.1\|31226_31838_+	hypothetical protein	A0A2H4N839	Lake_Baikal_phage	5.4e-07	34.3
WP_091019225.1\|31927_32722_+	metallophosphoesterase	K4K650	Caulobacter_phage	1.4e-50	43.5
WP_091019227.1\|33290_33539_+	hypothetical protein	NA	NA	NA	NA
WP_091019229.1\|33735_34668_-	sugar kinase	NA	NA	NA	NA
WP_091019231.1\|34664_35693_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_091019541.1\|35782_36532_+	NUDIX hydrolase	NA	NA	NA	NA
WP_091019233.1\|36655_36922_-	PAAR domain-containing protein	R9U4D0	Rhizobium_phage	7.6e-06	46.8
WP_170275768.1\|37332_38661_-	hypothetical protein	NA	NA	NA	NA
WP_091019238.1\|38663_40400_-	hypothetical protein	NA	NA	NA	NA
WP_170275769.1\|40422_42966_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.9e-83	34.3
WP_091019243.1\|43577_44678_+	DUF91 domain-containing protein	NA	NA	NA	NA
WP_091019248.1\|45659_47321_-	hypothetical protein	NA	NA	NA	NA
WP_091019251.1\|48293_48986_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_091019253.1\|49834_50659_-	ATP-binding protein	A0A1B1P8D0	Bacillus_phage	8.7e-08	30.9
WP_091019255.1\|50655_52143_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_091019257.1\|52298_52568_+	type II toxin-antitoxin system ParD family antitoxin	A0A0N7C055	Escherichia_phage	8.5e-13	50.0
WP_091019544.1\|52711_53614_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_091019260.1\|53610_54513_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_091019262.1\|54509_56075_-	recombinase family protein	E5DV73	Deep-sea_thermophilic_phage	1.0e-09	25.2
WP_091019265.1\|56243_56687_-	hypothetical protein	NA	NA	NA	NA
WP_091019267.1\|58708_61246_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.5e-05	32.0
WP_091019269.1\|61251_62223_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_091019271.1\|62268_65118_+	hypothetical protein	NA	NA	NA	NA
WP_091019274.1\|65114_65852_+	hypothetical protein	NA	NA	NA	NA
WP_091019277.1\|65886_66138_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_143098172.1\|66191_66752_+	hypothetical protein	NA	NA	NA	NA
WP_091019280.1\|66992_68294_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_091019282.1\|68320_70132_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_2

660659 : 669882

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_091010028.1\|660659_662612_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.8e-144	47.9
WP_091010030.1\|662868_664008_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	3.1e-24	38.6
WP_091010898.1\|664047_665958_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.5e-50	35.5
WP_091010032.1\|666089_666905_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	9.1e-34	29.2
WP_091010034.1\|666971_667703_-	deoxynucleoside kinase	A0A288TXV5	Enterococcus_phage	6.1e-05	38.5
WP_091010036.1\|667746_668277_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_091010038.1\|668325_669882_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	2.3e-25	36.5

DBSCAN-SWA_3

1612648 : 1736575

101

uncultured_Caudovirales_phage(30.77%)

integrase,transposase,head,plate,tRNA,protease,terminase,tail,capsid

attL 1614149:1614167|attR 1672951:1672969

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_091018881.1\|1612648_1613842_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
1614149:1614167	attL	NA	NA	NA	NA
WP_091018877.1\|1619490_1620834_+	EAL domain-containing protein	NA	NA	NA	NA
WP_091018874.1\|1620894_1622352_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_091018872.1\|1622449_1623214_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_091018870.1\|1624033_1624435_-	hypothetical protein	NA	NA	NA	NA
WP_143098164.1\|1625178_1625688_-	hypothetical protein	NA	NA	NA	NA
WP_091018866.1\|1625805_1626054_-	hypothetical protein	NA	NA	NA	NA
WP_091018864.1\|1626380_1626713_-	hypothetical protein	NA	NA	NA	NA
WP_091018862.1\|1626879_1627203_-	hypothetical protein	NA	NA	NA	NA
WP_091018860.1\|1627341_1627833_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_091018858.1\|1628054_1628267_+	ParD-like family protein	NA	NA	NA	NA
WP_091018856.1\|1628263_1629031_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_091018853.1\|1629037_1632850_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_144269481.1\|1633005_1634040_-	diguanylate cyclase	NA	NA	NA	NA
WP_091018841.1\|1634380_1634944_+	peroxiredoxin	NA	NA	NA	NA
WP_091019167.1\|1635018_1635486_+	hypothetical protein	NA	NA	NA	NA
WP_091018838.1\|1635490_1638796_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.4e-70	23.2
WP_091018836.1\|1638875_1642007_-	MdtB/MuxB family multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_091018834.1\|1642026_1643421_-	MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_091018832.1\|1643785_1644622_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_091018830.1\|1645073_1645454_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.8e-29	58.4
WP_091018827.1\|1645792_1647445_+	CHASE3 domain-containing protein	W8CYF6	Bacillus_phage	2.0e-11	23.7
WP_091018825.1\|1647467_1648049_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_091018823.1\|1648336_1648732_+	hypothetical protein	NA	NA	NA	NA
WP_091019165.1\|1648819_1649275_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_091018821.1\|1649398_1650046_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_091018820.1\|1650252_1650612_+	glyoxalase	NA	NA	NA	NA
WP_091018818.1\|1650625_1651255_-	cysteine dioxygenase family protein	NA	NA	NA	NA
WP_091018815.1\|1651385_1651853_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_143098163.1\|1652018_1653113_+\|integrase	tyrosine-type recombinase/integrase	I6NSG1	Burkholderia_phage	8.0e-94	46.1
WP_091018810.1\|1653091_1653358_-	pyocin activator PrtN family protein	I6NSR8	Burkholderia_phage	4.4e-22	61.0
WP_091018808.1\|1654261_1654525_-	hypothetical protein	NA	NA	NA	NA
WP_091018805.1\|1654687_1655167_-	hypothetical protein	NA	NA	NA	NA
WP_091018802.1\|1655102_1655624_-	helix-turn-helix transcriptional regulator	G9L6A6	Escherichia_phage	4.8e-12	40.2
WP_091018800.1\|1655742_1655976_+	hypothetical protein	NA	NA	NA	NA
WP_091018798.1\|1656087_1656615_+	hypothetical protein	C7BGG0	Burkholderia_phage	3.6e-31	49.4
WP_091018796.1\|1656666_1658049_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	7.9e-139	59.2
WP_091018794.1\|1658097_1659159_+	helix-turn-helix domain-containing protein	C7BGG2	Burkholderia_phage	7.8e-78	47.3
WP_091018792.1\|1659175_1659583_+	hypothetical protein	C7BGG3	Burkholderia_phage	6.8e-30	48.9
WP_143098162.1\|1659723_1659915_+	hypothetical protein	NA	NA	NA	NA
WP_091018788.1\|1660446_1662567_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	1.2e-170	53.1
WP_091018786.1\|1662577_1662784_+	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	3.3e-09	50.0
WP_091018781.1\|1664272_1665385_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A2H4JDI2	uncultured_Caudovirales_phage	9.8e-55	37.6
WP_091018779.1\|1665388_1665745_-	hypothetical protein	NA	NA	NA	NA
WP_091018776.1\|1665964_1666309_+\|head	head decoration protein	NA	NA	NA	NA
WP_091018774.1\|1666431_1667427_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	4.9e-114	60.6
WP_091018772.1\|1667437_1667731_+	hypothetical protein	NA	NA	NA	NA
WP_091018769.1\|1667733_1668273_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	4.3e-08	26.9
WP_091018767.1\|1668262_1668790_+	hypothetical protein	Q9JML9	Wolbachia_phage	6.3e-28	43.4
WP_091018766.1\|1668786_1669464_+\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	1.4e-27	36.6
WP_170275804.1\|1669637_1670168_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_091018762.1\|1670427_1670631_+	hypothetical protein	NA	NA	NA	NA
WP_091018760.1\|1670633_1670969_+	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.4e-27	53.7
WP_091018758.1\|1670965_1671868_+\|plate	baseplate J/gp47 family protein	E5FFH3	Burkholderia_phage	1.3e-84	55.1
WP_091019163.1\|1671881_1672421_+\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	3.3e-72	77.7
WP_091018756.1\|1672452_1674462_+	hypothetical protein	E5E3V2	Burkholderia_phage	1.8e-155	46.5
1672951:1672969	attR	NA	NA	NA	NA
WP_091018754.1\|1674473_1675130_+\|tail	phage tail protein	E5FFH0	Burkholderia_phage	1.5e-79	74.2
WP_091018751.1\|1675204_1676386_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.0e-158	73.5
WP_091018749.1\|1676396_1676900_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	2.4e-53	59.9
WP_091018747.1\|1676978_1677302_+\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	7.5e-08	38.3
WP_091018745.1\|1677367_1679794_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	9.2e-58	32.5
WP_091018743.1\|1679820_1680714_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.2e-34	40.2
WP_091018741.1\|1680688_1680895_+\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	6.5e-13	56.7
WP_091018738.1\|1680938_1681991_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	4.0e-82	45.1
WP_091018736.1\|1682074_1682566_+	hypothetical protein	A0A0S0N2E7	Pseudomonas_phage	7.2e-18	34.0
WP_091018734.1\|1682562_1683126_+	N-acetylmuramidase	A0A0E3JI96	Rhodoferax_phage	3.0e-52	59.2
WP_091018732.1\|1683122_1683737_+	hypothetical protein	A0A0E3M0Y2	Rhodoferax_phage	4.8e-11	46.1
WP_091018730.1\|1686319_1689169_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.9e-49	27.3
WP_143098161.1\|1689172_1691221_+	phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase family protein	NA	NA	NA	NA
WP_091019158.1\|1691239_1692535_+	sel1 repeat family protein	NA	NA	NA	NA
WP_091018728.1\|1692562_1692850_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_143098160.1\|1692881_1694021_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_091020698.1\|1694620_1695708_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_091015964.1\|1695797_1696529_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_091015967.1\|1696646_1697168_-	hypothetical protein	NA	NA	NA	NA
WP_143098127.1\|1697354_1698542_+	hypothetical protein	NA	NA	NA	NA
WP_091015972.1\|1698538_1700770_+	hypothetical protein	NA	NA	NA	NA
WP_143098128.1\|1701055_1701811_-	hypothetical protein	NA	NA	NA	NA
WP_143098129.1\|1701812_1703540_-	hypothetical protein	NA	NA	NA	NA
WP_091015986.1\|1704169_1705738_-	DUF3471 domain-containing protein	NA	NA	NA	NA
WP_091015989.1\|1705743_1706112_-	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_143098130.1\|1706675_1707566_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_091015995.1\|1707593_1707941_-	hypothetical protein	NA	NA	NA	NA
WP_091015998.1\|1708135_1709089_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.1e-115	65.6
WP_091016001.1\|1709239_1710175_-	pseudouridine-5'-phosphate glycosidase	NA	NA	NA	NA
WP_091016004.1\|1710222_1711278_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	3.9e-45	34.1
WP_091016006.1\|1711289_1712207_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	4.2e-35	35.9
WP_091016010.1\|1712221_1713004_-	2-oxopent-4-enoate hydratase	NA	NA	NA	NA
WP_091016012.1\|1713000_1713987_-	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_091016016.1\|1714002_1714470_-	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	1.2e-19	35.1
WP_144269501.1\|1714781_1715573_-	AraC family ligand binding domain-containing protein	NA	NA	NA	NA
WP_144269482.1\|1716825_1717368_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_091016025.1\|1717419_1718253_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_144269483.1\|1718365_1719217_-	hypothetical protein	NA	NA	NA	NA
WP_170275805.1\|1719365_1719536_+	hypothetical protein	NA	NA	NA	NA
WP_144269484.1\|1720828_1721590_-	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_091016037.1\|1723808_1724006_+	hypothetical protein	NA	NA	NA	NA
WP_091016041.1\|1726703_1730159_+	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_091016043.1\|1730155_1733917_+	exodeoxyribonuclease V subunit beta	G3MA40	Bacillus_virus	3.0e-07	29.4
WP_091016046.1\|1733913_1736082_+	AAA family ATPase	A0A1P8DII4	Virus_Rctr197k	3.2e-17	25.7
WP_091016830.1\|1736170_1736575_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP041744

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041744_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041744_1

44583-44726

Orphan

Consensus_repeat	Method
CTGCGTTGTGTCAAACTCTATT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP041744_1

>merge|NZ_CP041744|1|44583-44726|PILER-CR
CTGGGTTGTGTCAAACTCTTCTGTCGCAAGATGCCTATGCGAATTGAGTTGGGCTGTGTTTGTGTCGAACTCTATTTCGTCTGGCAGTGACGCGCGCGTCGCTAGGTGGCTGATTTTATTGTCTGCGTTGTGTCAAACTCTATT

>NZ_CP041744|1|1|44583-44726|PILER-CR
CTGGGTTGTGTCAAACTCTTCT	GTCGCAAGATGCCTATGCGAATTGAGTTGGGCTGTGTTTG
TGTCGAACTCTATTTCGTCTGG	CAGTGACGCGCGCGTCGCTAGGTGGCTGATTTTATTGTCTGCGTTG
TGTCAAACTCTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041744.1\|WP_091020365.1\|39054_39459_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020361.1\|37172_37391_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020358.1\|36528_37164_+\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|214947
NZ_CP041744.1\|WP_091020672.1\|47347_49672_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227032
NZ_CP041744.1\|WP_091020668.1\|46258_46756_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020371.1\|41188_42292_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223228
NZ_CP041744.1\|WP_091020675.1\|49671_51213_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP041744.1\|WP_091020369.1\|40392_40983_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP041744.1\|WP_143098186.1\|43407_44463_+\|alpha/beta-hydrolase	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020390.1\|37701_38127_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020582.1\|52742_53597_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|214780
NZ_CP041744.1\|WP_091020677.1\|51224_52454_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP041744.1\|WP_091020379.1\|45207_45579_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020363.1\|38403_38841_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020377.1\|44737_45196_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020367.1\|39648_40275_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271188
NZ_CP041744.1\|WP_143098185.1\|35431_35929_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020670.1\|46854_47355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_091020380.1\|45640_45847_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041744.1\|WP_144269470.1\|45843_46311_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP041744.1\|WP_091020582.1\|52742_53597_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|214780	smart00702, P4Hc, Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.	6.05225e-15
NZ_CP041744.1\|WP_091020677.1\|51224_52454_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.75967e-09
NZ_CP041744.1\|WP_091020358.1\|36528_37164_+\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|214947	smart00974, T5orf172, This entry represents the putative helicase A859L.	4.41958e-09
NZ_CP041744.1\|WP_091020672.1\|47347_49672_-\|hypothetical-protein	gnl\|CDD\|227032	COG4688, COG4688, Uncharacterized protein conserved in bacteria [Function unknown].	2.71628e-145
NZ_CP041744.1\|WP_091020371.1\|41188_42292_+\|hypothetical-protein	gnl\|CDD\|223228	COG0150, PurM, Phosphoribosylaminoimidazole (AIR) synthetase [Nucleotide transport and metabolism].	6.46468e-68
NZ_CP041744.1\|WP_091020367.1\|39648_40275_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271188	cd01188, INT_RitA_C_like, C-terminal catalytic domain of recombinase RitA, a component of the recombinase trio. Recombinases RitA (also known as pAE1), RitB, and RitC are encoded by three adjacent and overlapping genes. Collectively they are known as the Recombinase in Trio (RIT). This RitA family includes various bacterial integrases and integrases from the deletion-prone region of plasmid pAE1 of Alcaligenes eutrophus H1. All three integrases contain a catalytic motif, suggesting that they are all active enzymes. However, their specific roles are not fully understood. All three families belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.45614e-56
NZ_CP041744.1\|WP_091020675.1\|49671_51213_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.1036e-07
NZ_CP041744.1\|WP_091020369.1\|40392_40983_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.06375e-21

>NZ_CP041744.1|WP_143098186.1|43407_44463_+|alpha/beta-hydrolase
MSIASAETQGLKSIPPDSGIGAMPERELVNTPVPLVQKGRLDIETRSGDFKLPVAVSRDWTKPQDDVTRAVIVIPGWPRRDLRSGEHAAEVAGAAARTTVIVTPQFLTARDVTAHNLADNVLRWGEDDWKVGNLSQDTAAISSFQVVDEIFHRLADRAIFPNLNTIVLAGHSAGGQFVQRYAVLGRGESDLGDARVHVRYVVANPATYLYLTDERPDSNGDFAPFNAASCRAFNRWSYGLQAGIPAYSPRPGSIDELKTRYLRRDIIYLLGTADNAPDGDGQDQSCAAEAQGASRYARGQAFDAYVHILDPHTTQRVYEARGIGHSSYRMFSSLCGQAALFDKPGCDSASE
>NZ_CP041744.1|WP_091020371.1|41188_42292_+|hypothetical-protein
MTSLSYEAAGVDYGVIDPLKIAAQEAAKSTAGNLTRHGFRELEESRGESAYVVDTGSLLIASITECLGTKILITDEVYRATGKSHYAAIAQDTLAMAINDLVTVGATPVSAHAYWAAGGNEWFADARRANDLVQGWKAACDYCGVAWGGGETPNLSGVVVDGRIDLAASCVGIVASRERLTLGKNLAIGDAIVLLGSSGIHSNGVSLARTLAASLPGGYATPIEDGRTFGEALLDPTVLYSTVTEAIFKAGILPKYSANVTGHGWRKLMRHAGDFSYDIHSIPPVPAVLKFICSAGKLDVREAYSTLNMGAGFAIFTAPEDAPRVVAIAESLGVTALEAGRVEAGPKRLRIKPLDIEFAGSELTVRA
>NZ_CP041744.1|WP_091020369.1|40392_40983_+|GNAT-family-N-acetyltransferase
MISIPANGILLRDFRRDDLSQYQILRSDPKFQRFYSEEDSAPDKAKELLRMFISQRDEAPRTKYQLAVVSDSGDLMGSCGIRIESPGHASIGCELGRRWHGTGAARYAVDALLEFGFLELAVQRIFAETISENKAAIRLCKTVGMRVESEHVNDRHFKGREWTTTVLAISRNEWQVDHARREPRQGRHPNGSFLKL
>NZ_CP041744.1|WP_091020367.1|39648_40275_+|tyrosine-type-recombinase/integrase
MEATVNSNAPRVPWNKDKLTGQKSPLKLREIWAIRIRLQLGAKTRDLAMFNLAIDSKLRACDLTKLRVRDICLGTRVASRATVMQQKTQRPVQFEITEQTRDSVESWIRSAGLSPSDFLFPGRIHASPHLSTRQYARIVHRWVKSIGLDDTAYGTHTMRRTKASLIYRRTKNLRAVQLLLGHTKLESTVRYLGIEVDDALEMAEQTEV
>NZ_CP041744.1|WP_091020365.1|39054_39459_-|hypothetical-protein
MNDHATELVIALAKHVIGQMQITFSGWSEVYIRFDAPSDFQHGVRASYATTSGVQLISTTQHRDFIDGIMRIGTQLRDALSNNGRKFCVGLLRANSRFSYRMDYEWDDPTKWNITKLNGASGFPDGLDALAPLD
>NZ_CP041744.1|WP_091020363.1|38403_38841_+|hypothetical-protein
MNSLSWDDIFVDAAQLDFGNLLAQWPRSVNGQVRPIGASVFGDLFFEQRSGKVEKIDVLEGGLHPLADSFREFSALMNSRDWQEQHLLTEGVALLKDKGVTRAVGQFFGFAPHPSLAGRIVWSTVMPLDAVVWNSICAQILSGRS
>NZ_CP041744.1|WP_091020390.1|37701_38127_+|hypothetical-protein
MGELPESVYSEIRDACEAGDADAKRREYESAIGHYSRAWQLIPDPKNAWNASTWILGAIADACYLGGFLTSAEDALQYAMTCPNGIGNPFLHLRYGQVSLDKGDEALAADELMRAYMGAGVEIFANEDDRYLAFLKMHATI
>NZ_CP041744.1|WP_091020361.1|37172_37391_+|hypothetical-protein
MALAFDPGQTVRLIREAFDDETGYSFPAGSVCEFAQSLGGARCVVEIDKALGDPLDHGWTPVVVDIEILEAI
>NZ_CP041744.1|WP_091020358.1|36528_37164_+|GIY-YIG-nuclease-family-protein
MKLVDAVYTVVSGASMPVTPQHIRDEIKRRYPELYGTDAAKRNVERRNFNDLDHALLSPIYKICTKDDRYFVDRSTKPFSVSLASISAVEDALDSDVGEDFEQEVGTLYVLSTGVYTRDGKAIVKIGFTTQELSLRIKQLYTTGAMFRFEPVVSYEVRGYDLLEQALHRLLAPFRLNEAREFFTDEVLPFVEDVVNVHRRIQGARSTASRS
>NZ_CP041744.1|WP_143098185.1|35431_35929_+|hypothetical-protein
MRDEMVFPHVPLPEQLTYEFLGTFARCEYALKCSGFAKGGQKSVEADWDKFAIDIAWHFSRVKAEDFKECVEYLLREPPRKQVLRDGHIEWQESAPDANLPRSQQTLLMVRRVRNNLFHGAKVWSPERSADRDRDVRLVSSALIVIKGCVALREGVQDAFRFGIF
>NZ_CP041744.1|WP_091020377.1|44737_45196_+|hypothetical-protein
MDQNRDLAQKLGEAIWAFALVERATYRYMKKLSSDTLDVLMADQSIPVRIRVIKQLIARADGPESMKQLAYKCVKAISELSEERNLFAHNPFHTWIDFDAREFVHEIEKVTDASQVKSLGEMEAFTQKSLTLAEEFEDALSHLTYQGNARSA
>NZ_CP041744.1|WP_091020379.1|45207_45579_+|hypothetical-protein
MRKAFAKVVVIALPVLIISTPLRVSAGLFEPDDYSGCILEKMPGVQNDLSAGAIANECNQRFPNWKEAHRRSGFFAAYHSGSACFAEKSRATGSEMAARLIYFACHNLYDPAAFDPESAQPVQ
>NZ_CP041744.1|WP_091020380.1|45640_45847_+|hypothetical-protein
MGKVLYVYECAECRKRGEQRLDGDSHDGEASTCASCGAPVTLEWDGGVVLETPQTIAADAIARARERK
>NZ_CP041744.1|WP_144269470.1|45843_46311_+|hypothetical-protein
MTSTGKRCEARLELKQLVGMAEVRDEEEIPIDDLLKKYPTDPGVVALYGRYYRTCHVTQKSSILGIYGVMLRWFGFSGFVIFQRVRRPTYPQDIHIFRHFLLRDRTTGVCCVDVYPETQRDRSWQRVIASLSVAFLPAPSTSLTSHPIPTACRCS
>NZ_CP041744.1|WP_091020668.1|46258_46756_-|hypothetical-protein
MSYCPFFQTLHDETRPVGNLGKGTHYSVLRAPVWHDESMNTLARCAFLDFAIIWDEDHDDRVIDAIMVLYISGLLTPVRYIGERKGTLSVLLASDVVRTWDPETLRQYRDDIDGICQCLEDPWSAKIDSADGHEHSIIHSSAENVATYLRNIDMLWELGVKSKMY
>NZ_CP041744.1|WP_091020670.1|46854_47355_-|hypothetical-protein
MTEPKEITPSSDDDQMREILETLLANDEDITARAVARLHPSINAASSITRSESRSKLLAEYQRRQSEYRRWRGRVAKRSGADTAASLADKDIRIAELEATVQLLTASHLAMLRAVGELGGFSKWARFYEQYRDARDKLAELGAIPESTVSPMPAENPKRRGKTKSL
>NZ_CP041744.1|WP_091020672.1|47347_49672_-|hypothetical-protein
MNPHYSAFIELGKALAREKDLGWEIPLDETGAALDGVGWNLTVAAGDVPPPAHYMRDLGTEVKALAIVNAERVERGLASLARRPLSTAWQDLVKAAVAEQLLFRRNTTGHIAQCIARPLRVIATCVDKEPWELTVDDLHVAVRVGKAIQATGKLGDMVVGIVKIVFDAQHICDAGPLYAALAVPRMKGKSAIKAKHTWSAEKLRDDLEARKRDERLPERRAFWELTRIVMTEQPRTFMDDLRFAAMRVLIVTGMRAGEVALLPVDWKRERTYLDSKGRPAGESGGISTSLMVRHFAEKQQEDETDSRVLREATQPVPEMFRTLLTETLDHVARITEPLRATLKLQCETGRLLPWYPVDSVVPVTEIYTRLMGNPFWLKIERRPFIERYRDGFDPAVLAELHEYQHVRRRSGDLGLDMAVYMFGNRLKTSMLEGKTGLRFRHGDGSQVKLLDRMEWHAAHLHVGELEEHIRLKTPTKVSDLDPLPLAVGSVQPWEFLFVHPKRSLAEERNDGLCDVTRYMSINRPDPTLIGQALGDAKYLPPLFEKYGQTDEDRALKIESHMLRHLQNTELFRLGVADTIISKRFNRRSVAQSYEYDHRSLAEDLEQIEIPQDIEIMLGAKTSTVARLIKGGKANGPIVDAFRRIQETDGDVAAYEYLRAEADGFHATPYGHCLNSFTVDPCPKHLECFADCRHLSATDLPEHRQNLVRLEGKFKLALESINARPSTSIGWKNQLDHAEKRLAGIQKLLATPAGEHPFPDGVDLSRPRQRGVLDD
>NZ_CP041744.1|WP_091020675.1|49671_51213_-|tyrosine-type-recombinase/integrase
MQLSRSIGVTGVARDAGELIADIVSRLPALPPVIRYYDEFDDTTRSIAAPTEAKVFELWIYGRLHRLDFDRYPGAYGMLVKHLFLFLLGRGLHVVSAFKAAGGAMHFSASEVEKLIDAGPHKIGHEWTVMRARHLPQDGYRFGKTLLRLLRVHRLCGWSTTYEEFIRSSLPGPVMDSHAGVRSGDVFLSVDEEAMIVRHLDETVSALTLPMNAHPEHEDLCDAGMLLCAYQFAMRPIQIAMLTMRNVRIWVDVPDEPPTVHLTFHMAKQKSDTKRKPLTRRVKREWAPILVALNAQRRAAGLTGAGRFFAVESNYEAGSRIAALVRKLIDSEDLGTATDLRHTAAQRLVDAGASHEELAEFLGHSHIQTGLVYYETSATHAERVNRALGASDIYRRVAKIAHDRFISPEELTLLKGEQQIAGVPHGIPIAGIGGCTSGQPACPYNPVTSCYGCRKFMPLHDKAMHESVLASMREVVAFFEQSSRGDTRSPTYLQLQRTIAEIQTVIGELEGDD
>NZ_CP041744.1|WP_091020677.1|51224_52454_-|tyrosine-type-recombinase/integrase
MTFLQLSDSLVPGQLRSVTLVGKPPIPRYWASVWLIMSMGHLAESTQTGKLRYIEDLYQHADRILGPNGLDDALADVDDGALADVLESWFVSIRNRSRATRADELRWHAGLGFVTDVLTWLSRSRIPDDRLRGIEARLHRLSTLYSQLHVRKSSQAETVRSLPASVVEALYDLLDPESGRNPFKHARTRWRVYIAFVLMLHQGLRRGELLLLTADCVKSGFDRKRQTLRYWLNVQENEYDDAEADESIDSRYSKPSIKTVHSLRQIPVSPLTAQLVQTYVENYRGRPSHPFLLNSSVGNPLATESLTKAFREVSKALPDPVRQELSDRSDKDSVMPHDLRHTCAVVRLHQLLDNGDPMDEALQKMRTFFGWSKKSVMPSRYARAVFEDRLADVWNDSFDERVALLRAIP
>NZ_CP041744.1|WP_091020582.1|52742_53597_-|2OG-Fe(II)-oxygenase
MKPFSFDADLCTSIRSKLKAGMDYSEAVIDLAIEHGFSFPIAYRIVESALRECSPDGILFDPVYYPDSKEMMVRSPDYVDYGPSREFLTDEGVTLIAEWASPRVILLSNFLSSDQCLALINCAISKGPTVEERHALGNLNVVHFPSGSDLLVDRAVARVSRAFDWPMENLEIPKILHYRPGGYITHHSEYFKTNEVNQRIANCIIYLNEPKSGGATILSNLGLRVHPRLGGLLFFGYPEPVPNSGTMHAGEPVSEGEKWLLTIVFRQSPVDHHVEACELGLSRE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041744_1	1.1\|44605\|40\|NZ_CP041744\|PILER-CR	44605-44644	40	NZ_CP041744	Paraburkholderia megapolitana strain LMG 23650 plasmid unnamed1, complete sequence	44602-44641	0	1.0
NZ_CP041744_1	1.2\|44667\|46\|NZ_CP041744\|PILER-CR	44667-44712	46	NZ_CP041744	Paraburkholderia megapolitana strain LMG 23650 plasmid unnamed1, complete sequence	44659-44704	0	1.0

1. spacer 1.1|44605|40|NZ_CP041744|PILER-CR matches to NZ_CP041744 (Paraburkholderia megapolitana strain LMG 23650 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tctgtcgcaagatgcctatgcgaattgagttgggctgtgt	CRISPR spacer
tctgtcgcaagatgcctatgcgaattgagttgggctgtgt	Protospacer
****************************************

2. spacer 1.2|44667|46|NZ_CP041744|PILER-CR matches to NZ_CP041744 (Paraburkholderia megapolitana strain LMG 23650 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tcgtctggcagtgacgcgcgcgtcgctaggtggctgattttattgt	CRISPR spacer
tcgtctggcagtgacgcgcgcgtcgctaggtggctgattttattgt	Protospacer
**********************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

39648 : 99460

Moumouvirus(15.38%)

transposase,integrase

attL 85722:85736|attR 103220:103234

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_091020367.1\|39648_40275_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SFL0	Streptococcus_phage	7.8e-09	27.7
WP_091020369.1\|40392_40983_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_091020371.1\|41188_42292_+	hypothetical protein	Q58MH8	Prochlorococcus_phage	4.0e-16	27.9
WP_143098186.1\|43407_44463_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_091020377.1\|44737_45196_+	hypothetical protein	NA	NA	NA	NA
WP_091020379.1\|45207_45579_+	hypothetical protein	NA	NA	NA	NA
WP_091020380.1\|45640_45847_+	hypothetical protein	NA	NA	NA	NA
WP_144269470.1\|45843_46311_+	hypothetical protein	NA	NA	NA	NA
WP_091020668.1\|46258_46756_-	hypothetical protein	NA	NA	NA	NA
WP_091020670.1\|46854_47355_-	hypothetical protein	NA	NA	NA	NA
WP_091020672.1\|47347_49672_-	hypothetical protein	NA	NA	NA	NA
WP_091020675.1\|49671_51213_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_091020677.1\|51224_52454_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_091020582.1\|52742_53597_-	2OG-Fe(II) oxygenase	M1PMD0	Moumouvirus	1.3e-14	29.8
WP_091020579.1\|53618_54479_-	2OG-Fe(II) oxygenase	M1PMD0	Moumouvirus	1.5e-10	26.8
WP_091020577.1\|56225_57482_+	MFS transporter	NA	NA	NA	NA
WP_143098196.1\|58196_58556_+	hypothetical protein	NA	NA	NA	NA
WP_091020569.1\|58691_59873_+	MFS transporter	NA	NA	NA	NA
WP_091020567.1\|60184_61039_-	class I SAM-dependent methyltransferase	A0A2R8FDY2	Brazilian_cedratvirus	1.2e-36	40.3
WP_091020565.1\|61060_62263_-	hypothetical protein	M4SNV7	Cyanophage	3.1e-06	25.5
WP_170275748.1\|62277_63429_-	hypothetical protein	NA	NA	NA	NA
WP_170275749.1\|63476_64688_-	MFS transporter	NA	NA	NA	NA
WP_170275750.1\|64677_65868_-	hypothetical protein	A0A1D7SFD0	Cyanophage	5.8e-05	37.1
WP_091020558.1\|66498_67662_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_091020556.1\|68155_68830_-	hypothetical protein	NA	NA	NA	NA
WP_091020554.1\|68840_70139_-	YcaO-like family protein	NA	NA	NA	NA
WP_143098194.1\|70135_71443_-	MFS transporter	NA	NA	NA	NA
WP_170275751.1\|72222_73104_-	hypothetical protein	A0A1D8KS77	Synechococcus_phage	8.7e-06	27.5
WP_091020548.1\|73199_74501_-	MFS transporter	NA	NA	NA	NA
WP_091020546.1\|74488_75595_-	ThiF family adenylyltransferase	A0A291ATS8	Pandoravirus	5.6e-10	31.7
WP_091020588.1\|75598_75859_-	MoaD/ThiS family protein	NA	NA	NA	NA
WP_091020543.1\|75871_76672_-	hypothetical protein	NA	NA	NA	NA
WP_091020541.1\|76668_77349_-	hypothetical protein	NA	NA	NA	NA
WP_091020539.1\|77348_78599_-	YcaO-like family protein	NA	NA	NA	NA
WP_170275752.1\|78670_78835_-	hypothetical protein	NA	NA	NA	NA
WP_143098193.1\|79998_80355_-	BON domain-containing protein	NA	NA	NA	NA
WP_091020537.1\|80764_81355_-	hypothetical protein	NA	NA	NA	NA
WP_091020535.1\|81652_81958_-	hypothetical protein	NA	NA	NA	NA
WP_091020585.1\|82493_85259_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.4e-25	24.7
WP_091020531.1\|85645_86080_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
85722:85736	attL	NA	NA	NA	NA
WP_143098192.1\|86057_86576_+	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_091020527.1\|86545_87931_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	2.8e-19	29.8
WP_091020525.1\|87951_88779_-	response regulator	NA	NA	NA	NA
WP_091020523.1\|89306_89876_+	hypothetical protein	NA	NA	NA	NA
WP_091020520.1\|89977_90238_+	hypothetical protein	NA	NA	NA	NA
WP_170275753.1\|90535_91471_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_091020514.1\|94925_95936_+	PRTRC system protein D	NA	NA	NA	NA
WP_143098191.1\|95940_96255_+	hypothetical protein	NA	NA	NA	NA
WP_170275754.1\|96358_96523_+	hypothetical protein	NA	NA	NA	NA
WP_091020510.1\|96526_96775_+	hypothetical protein	NA	NA	NA	NA
WP_091020679.1\|96939_97404_+\|transposase	transposase	NA	NA	NA	NA
WP_170275755.1\|97403_97757_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.7e-10	37.6
WP_091020683.1\|97849_99460_+\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	2.6e-40	34.0
103220:103234	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041743

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP041745

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP041744

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection