CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041763	Gordonia sp. HY186 chromosome, complete genome	2 crisprs	cas3,csa3,DinG,DEDDh,WYL	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041763_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041763_1

546119-546213

Orphan

Consensus_repeat	Method
TGGTTGAGCGAGCGAAGCGAGTCGAAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041763_1

>merge|NZ_CP041763|1|546119-546213|CRISPRCasFinder
TGGTTGAGCGAGCGAAGCGAGTCGAAACCACGTCGGCGGGAAATGGGAATGCTCGGCCGCTCTCGCTGGTTGAGCGAGCGGAGCGAGTCGAAACC

>NZ_CP041763|1|1|546119-546213|CRISPRCasFinder
TGGTTGAGCGAGCGAAGCGAGTCGAAACC	ACGTCGGCGGGAAATGGGAATGCTCGGCCGCTCTCGC
TGGTTGAGCGAGCGGAGCGAGTCGAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041763.1\|WP_132993086.1\|540732_541779_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP041763.1\|WP_132993080.1\|533456_535022_+\|amidophosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236113
NZ_CP041763.1\|WP_132993087.1\|541786_543556_+\|thiol-reductant-ABC-exporter-subunit-CydD	unknown	unknown	gnl\|CDD\|274323
NZ_CP041763.1\|WP_132993082.1\|536614_536803_-\|DUF3073-domain-containing-protein	unknown	unknown	gnl\|CDD\|378620
NZ_CP041763.1\|WP_132993091.1\|547490_548318_-\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP041763.1\|WP_132993097.1\|554602_555379_+\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184587
NZ_CP041763.1\|WP_132993084.1\|538180_539038_+\|aminodeoxychorismate-lyase	unknown	unknown	gnl\|CDD\|236114
NZ_CP041763.1\|WP_132993094.1\|550315_551200_+\|mycothiol-synthase	unknown	unknown	gnl\|CDD\|132489
NZ_CP041763.1\|WP_132993088.1\|545412_545910_+\|ferritin	unknown	unknown	gnl\|CDD\|153113
NZ_CP041763.1\|WP_132993095.1\|551624_552692_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	unknown	unknown	gnl\|CDD\|270283
NZ_CP041763.1\|WP_132993085.1\|539164_540721_+\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP041763.1\|WP_132993093.1\|549587_550289_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP041763.1\|WP_132993089.1\|546218_546836_-\|FABP-family-protein	unknown	unknown	gnl\|CDD\|378046
NZ_CP041763.1\|WP_132993092.1\|548587_549496_-\|DUF2993-domain-containing-protein	unknown	unknown	gnl\|CDD\|378597
NZ_CP041763.1\|WP_132993083.1\|536966_538166_-\|folate-binding-protein-YgfZ	unknown	unknown	gnl\|CDD\|223431
NZ_CP041763.1\|WP_132993441.1\|543563_545222_+\|thiol-reductant-ABC-exporter-subunit-CydC	unknown	unknown	gnl\|CDD\|274331
NZ_CP041763.1\|WP_132993081.1\|535139_536225_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
NZ_CP041763.1\|WP_132993096.1\|553742_554600_+\|phosphate-ABC-transporter-permease-PstA	unknown	unknown	gnl\|CDD\|223654
NZ_CP041763.1\|WP_132993090.1\|547144_547450_-\|DUF1416-domain-containing-protein	unknown	unknown	gnl\|CDD\|377793
NZ_CP041763.1\|WP_132993442.1\|552844_553741_+\|phosphate-ABC-transporter-permease-subunit-PstC	unknown	unknown	gnl\|CDD\|273992

Protein	Function_ID	Function_description	E-value
NZ_CP041763.1\|WP_132993086.1\|540732_541779_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	7.37666e-106
NZ_CP041763.1\|WP_132993080.1\|533456_535022_+\|amidophosphoribosyltransferase	gnl\|CDD\|236113	PRK07847, PRK07847, amidophosphoribosyltransferase; Provisional.	0
NZ_CP041763.1\|WP_132993087.1\|541786_543556_+\|thiol-reductant-ABC-exporter-subunit-CydD	gnl\|CDD\|274323	TIGR02857, transport_ATP-binding_protein, thiol reductant ABC exporter, CydD subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD.	3.06245e-142
NZ_CP041763.1\|WP_132993082.1\|536614_536803_-\|DUF3073-domain-containing-protein	gnl\|CDD\|378620	pfam11273, DUF3073, Protein of unknown function (DUF3073). This family of proteins with unknown function appears to be restricted to Actinobacteria.	1.93634e-21
NZ_CP041763.1\|WP_132993091.1\|547490_548318_-\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	2.38983e-106
NZ_CP041763.1\|WP_132993097.1\|554602_555379_+\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184587	PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional.	0
NZ_CP041763.1\|WP_132993084.1\|538180_539038_+\|aminodeoxychorismate-lyase	gnl\|CDD\|236114	PRK07849, PRK07849, aminodeoxychorismate lyase.	5.67148e-108
NZ_CP041763.1\|WP_132993094.1\|550315_551200_+\|mycothiol-synthase	gnl\|CDD\|132489	TIGR03448, mycothiol_MshD, mycothiol synthase. Members of this family are MshD, the acetyltransferase that catalyzes the final step of mycothiol biosynthesis in various members of the Actinomyctes, Mycothiol replaces glutathione in these species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	1.30661e-107
NZ_CP041763.1\|WP_132993088.1\|545412_545910_+\|ferritin	gnl\|CDD\|153113	cd01055, Nonheme_Ferritin, nonheme-containing ferritins. Nonheme Ferritin domain, found in archaea and bacteria, is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The ferritin protein shell is composed of 24 protein subunits arranged in 432 symmetry. Each protein subunit, a four-helix bundle with a fifth short terminal helix, contains a dinuclear ferroxidase center (H type). Unique to this group of proteins is a third metal site in the ferroxidase center. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite.	5.29868e-52
NZ_CP041763.1\|WP_132993095.1\|551624_552692_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	gnl\|CDD\|270283	cd13565, PBP2_PstS, Substrate binding domain of ABC-type phosphate transporter, a member of the type 2 periplasmic-binding fold superfamily. This subfamily contians phosphate binding domain found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	9.15509e-81
NZ_CP041763.1\|WP_132993085.1\|539164_540721_+\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP041763.1\|WP_132993093.1\|549587_550289_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	7.01742e-47
NZ_CP041763.1\|WP_132993089.1\|546218_546836_-\|FABP-family-protein	gnl\|CDD\|378046	pfam08768, DUF1794, Domain of unknown function (DUF1794). This domain forms a beta barrel structure but the function is unknown. The GO annotation for this protein indicates that the protein has a function in nematode larval development and has a positive regulation on growth rate.	1.4018e-56
NZ_CP041763.1\|WP_132993092.1\|548587_549496_-\|DUF2993-domain-containing-protein	gnl\|CDD\|378597	pfam11209, DUF2993, Protein of unknown function (DUF2993). This family of proteins with unknown function appears to be restricted to Cyanobacteria.	2.14429e-15
NZ_CP041763.1\|WP_132993083.1\|536966_538166_-\|folate-binding-protein-YgfZ	gnl\|CDD\|223431	COG0354, COG0354, Predicted aminomethyltransferase related to GcvT [General function prediction only].	3.06931e-61
NZ_CP041763.1\|WP_132993441.1\|543563_545222_+\|thiol-reductant-ABC-exporter-subunit-CydC	gnl\|CDD\|274331	TIGR02868, ABC_transporter_ATP-binding_protein, thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.	1.30891e-126
NZ_CP041763.1\|WP_132993081.1\|535139_536225_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP041763.1\|WP_132993096.1\|553742_554600_+\|phosphate-ABC-transporter-permease-PstA	gnl\|CDD\|223654	COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism].	5.44876e-81
NZ_CP041763.1\|WP_132993090.1\|547144_547450_-\|DUF1416-domain-containing-protein	gnl\|CDD\|377793	pfam07210, DUF1416, Protein of unknown function (DUF1416). This family consists of several hypothetical bacterial proteins of around 100 residues in length. Members of this family appear to be Actinomycete specific. The function of this family is unknown.	2.99284e-49
NZ_CP041763.1\|WP_132993442.1\|552844_553741_+\|phosphate-ABC-transporter-permease-subunit-PstC	gnl\|CDD\|273992	TIGR02138, phosphate_transport_system_permease_protein_PstC, phosphate ABC transporter, permease protein PstC. The typical operon for the high affinity inorganic phosphate ABC transporter encodes an ATP-binding protein, a phosphate-binding protein, and two permease proteins. This family consists of one of the two permease proteins, PstC, which is homologous to PstA (TIGR00974). In the model bacterium Escherichia coli, this transport system is induced when the concentration of extrallular inorganic phosphate is low. A constitutive, lower affinity transporter operates otherwise. [Transport and binding proteins, Anions].	3.50648e-78

>NZ_CP041763.1|WP_132993088.1|545412_545910_+|ferritin
MKMSETLAVEFVKQINREYESSFLYRQLAIEADLRDLPGIASWLRSQSGEELVHADKLIDHLTARDNHPVIGDIEIQSVKVEKISDIFEIALDAERAVSEGIRELYKLAEDERDLDSRPTIDWFISEQVEEEATVSEILGRLRMVDGDGSGVLRIDTELASAGAA
>NZ_CP041763.1|WP_132993441.1|543563_545222_+|thiol-reductant-ABC-exporter-subunit-CydC
MRAFSFVGLRPRALLAAVGLGAAGALSALGLAALSAWLITRAWQMPPVLYLSVAVTAVRALGISRAVFRYLERLATHDLALNAMSRARERVYRVLASGSPEHSVRQRRSELLARTADDVDEIGDAVVRGLVPMAVGAVTGIAAVAVMSMVSPLSAVVLALALLVSGVLGPIIATRASVRIVGDGARARERVGAAATALLWHGPELVVARRRSTALGELRAADDTHAVAVDRGMSRQATAASLTPVAMLVSVVAAAVIAVDLASRLPGSLADVSSSGEGITPMLFGVLVLLPLSSFEMTGPLTDAAIAWERGRQSAARVMSLVEDAGSAATASYASASSDPVFDRRPATLTAQRLQWGRTAPLGPDGGVDLDLPPGGRLVIVGPSGSGKSTLALTLAGLLPPLGGIVSTAPSDSSSCAAYFAEEAHLFSTSVRENLRVARGDVSDDEIVEALDRVGLGEWLAGLPAGLDTELIGGGAALSGGQRRRLLLSRALVHPARIVILDEPTEHLDSNDAGHVLRRILDDDGVFGADRVVVAVTHQRADDLGVSVVDLR
>NZ_CP041763.1|WP_132993087.1|541786_543556_+|thiol-reductant-ABC-exporter-subunit-CydD
MTTAHDGVAAGAASGDPGTERAGNRDSAAARMRRTPPVDPRLLRYSPTARRYSVAIALFSAGTVAAVIAGAVALAGLLSELITDPASRSFAAQSVHLAVIVAAFAARALMSYLGDRYAHRAALATIAELRAEAADALTDPSRTPPHDLVAERDRASTILLRGLDALTDYLSDYVPALLSTVIITPLVVVVVGWVDWPSAVIIIVTIPLIPIFMVLIGLLTRDRTTRKLDAMSRQSSQLLDLLAGLPTLRALGRAHGPSQRVADLGQDFRRTTMSSLRIAFLSGAVLEMLATLSVALVAVGIGLRLVFGEMSLYAGVLALVLAPEAYLPLRRIGSAFHAAEDGMEASREALDVISRESLALQGTRCIDVAGTQIVLDGVGVRGRDGWTPREASALIVPGQMTVLTGPNGSGKSTLLSAILGLEAPAEGMVTVGGVNVREVDREHFHSQIAWLPQHPVIVPGTVAGNLALFGSLDPDAAGRVARAVRFDEVLADLPLGDQTLIGATGEGMSAGQRQRLALVRTLASTAPLLLLDEPAAHLDEETASAVVDALTERAAAGATVIVVSHHDDMISAGDVVVEISGEVVGGVQA
>NZ_CP041763.1|WP_132993086.1|540732_541779_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MTLENAWFVIIAVLFVMYFVLEGFDFGVGMLMPFLGKRSEPDGDKRRRALLNTIGPVWDGNEVWVITAGAAMFAAFGGWYATMFSALYLPLFLLLIGLIVRVVAIEWRGKINELRWRRWCDIGIGLGSWLPAILWGVAFANVIRGLPIGADQQYTGGFFNLLNPYALLGGATTLLVFLTHGAVFIALKTTGVLRDDAQTVAARLSIPTLVVAAAFLLWTQLEYGKPWTWAIVAAGAVAAVVMVIGAFARREGLAFAATCIAIAGTVALLFCVLFPNVLPSTTDEAFNLTIGNTSSSHYTLVVMTWAAGLMTPVVLLYQGWSYWVFRKRLSVEQIPPSIGLSFGDRASR
>NZ_CP041763.1|WP_132993085.1|539164_540721_+|cytochrome-ubiquinol-oxidase-subunit-I
MDVVDISRWQFGITTVYHFILVPLTIGLAPLIAVMQTVWHRTGNEQWLRATKFFSKLFLINFALGVATGIVQEFQFGMNWSEYSRYVADVFGAPLAMEGLVAFFMESTFIGLWMFGWGRLPRRIHLACIWMVAIGVNASAYFIVAANSWMQHPVGAEWDHTRDRPAMNNFLALITNNTTLVAFPHVIAGALLTASTFVAIIGLWWMARNSFRARKLEEAAVSGDDSEVPDTTSPSQLDRTPEQLRADNVKLWRPVTKMALWVTVAAGVGLMITGDMQAQLMFKQQPMKMAAAESLCETEEGAAFSVLSIGRQNNCDHIEHVIKIPNMLSFLADHTFTSEVKGVNELQKTYQEALNMPGQNFAPNLFVTYWSFRAMITWAGGSALVALAGLWLLRKGRSEIPMRFGKFALWLLPTPFLANASGWIFTEMGRQPWVVVPNWADEDGDPLRIHMLVQDGVSNHPAGLVWTTLIGFTLLYGALGVVWFYLERRYVIEGPSDKDAVPPDEGADDSSDHLSFAY
>NZ_CP041763.1|WP_132993084.1|538180_539038_+|aminodeoxychorismate-lyase
MVDVIVVDGSGEVHDPEAPLLHADDLGALRGDGVFETILIRGGRARLVDEHLRRLADGAAGLDLPAPDPTALRRCIDVAERQWASGDEAALRVICSRGRESVPDGPPTVYVTVGPLPARSVVARRAGVSVMTLERADDPDVVPRAPWELLGVKALSYARNMAALRHAHRAGADDGIYLSSAGSVLESPRANVVAVIDGVLTATPRADGILPGITQAALFATAERRGLVVGERRLTPADLRGADGVWLLSSLTLAARVHALDGERLPPLSVSAPDIAALVDEAVAG
>NZ_CP041763.1|WP_132993083.1|536966_538166_-|folate-binding-protein-YgfZ
MSADPIRPASDDTYVSPLLASQPGAVVTPEDDASPGVAWHYGDPLGEQRRATRSAAIVDRSNRAVIELAGPERLSWLHTISTQHVAELGDRRSAENLSLNGNGRVEDHFVLTDINEVTWLDTETARGAPLSDFLTKMVFWAQVTPTLRTDMAVITLVGPDVRTGEIASVLDIPAAADVYAAGDLPELHHDDEPLGFWRVMPPTGEGRTAPVVDVVVPRDDLPRWWETLVNAGAAPAGMWTLEALRVAAGRPRLGLDTDERTIPHEADWIGSPDEGGAVHLEKGCYRGQETVSRVANLGRPPRRLVLLHLDGSADYRPSTGDSVFVGGRSLGRVGTVIDHFELGPVALALVKRSVPADAELLVGDDAESGAAARIDADLYTADDAIPAGRAAINKLRGKP
>NZ_CP041763.1|WP_132993082.1|536614_536803_-|DUF3073-domain-containing-protein
MGRGRAKAKQTKVARQLKYSTPNTDLDSLQRELSGSSGHSSYAADSWSDEDSRYSEDEWRRA
>NZ_CP041763.1|WP_132993081.1|535139_536225_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTDGSASDQTAGASYASAGVDIDAGERAIELFAPHAKRATRPEVLGGLGGFAGLFSMKGDYREPVLAASSDGVGTKLAVAQAMGVHHTVGRDLVAMVVDDLVVCGAEPLFLQDYIAVGKVIPEMVADIVKGIADGCVDAGCALLGGETAEHPGLMGDGHYDISATGVGIVEADSILGPDRVRPGDVVIAMGSSGLHSNGYSLARKVLLELGHLDLGGHVEEFGRTLGEELLEPTRIYAKDCLALVAESEVRTFAHITGGGLADNLGRVLPKGLEAVLERGSWTPAPIFSLIAQRGRVERAEMERTFNMGVGMVAIVAPEDTDRAQAVLTARHVDNWVLGSIKRSADGVSGSAELVGDHSRF
>NZ_CP041763.1|WP_132993080.1|533456_535022_+|amidophosphoribosyltransferase
MTDLSIHSRNLLDPQQPDEVENEPREECGVFGVWAPGEDVSKLTYYGLYALQHRGQEAAGIAVGDGSQVLVFKDLGLVSQVFDEQTLASMHGHVAVGHCRYSTTGSTTWENSQPIFRHTDAGSGVALGHNGNLVNTAELAARARELGVYGSGSRGAATSDSDVVGALLAHGAADKTLEQAAAELLPSLKGAFCLTFQDETTLYAARDPHGIRPLSLGRLDRGWVVASETAAFDIVGASFVRDIEPGELLAIDHNGVRSTRFAEATPKFCVFENVYLARPDSVINGRAVHSTRVDIGRRLAREEPAEGDLVIPVPESGTPAAVGFAQESGIPYGQGLMKNAYVGRTFIQPSQTIRQLGIRLKLNPLREVIRGRKLVVVDDSIVRGNTQRALIRMLREAGALEVHVRIASAPVRWPCFYGIDFASPAELIANGMESEEHMVDGVRQAIGADTLGYISVDGMIAATGQESSNLCAACFDGHYPIELPEETAMGKAVLETMSGADGSVPHPLSAGNDNVSAVMRP
>NZ_CP041763.1|WP_132993089.1|546218_546836_-|FABP-family-protein
MTRSGNEAISDAEQRAQETAGKNVPAIGDLPLPVDTANLREGPDLHPGLLALLPLVGVWEGEGEGHDHATGGDYQFGQQIIVTHDGGNYLNWQSRSWVIDDEGAYVRPDLRESGFWRISEEDDIELLLTHAEGVVELFYGRPLNQMSWNVTTDVTIRTETGVHTGGAKRLYGLVPDGDLAYVEERVDPDGELTPHLSAKLHRVIG
>NZ_CP041763.1|WP_132993090.1|547144_547450_-|DUF1416-domain-containing-protein
MCAAPKQGQTLPAGVDVEKETVLTGQVVDGAGNPVAGAFVRLLDSTGEFTAEVVASATGDFRFFAAPSTWTLRALSSQGNGDVTVSPEGPGVHNHDVTVSK
>NZ_CP041763.1|WP_132993091.1|547490_548318_-|sulfurtransferase
MARSDVLVSADWAEQNLNTDNVVFVEVDEDTSIYDTNHIPGAIRLDWKKDLQDGLRRDFLNAEQFSALLSERGVANDDTVVLYGGNNNWFAAYAYWYFKIYGHKDVRLLDGGRKKWELDGRELSSETVNRDATTYTAQAADTSIRAFRDEVVDSIGNKNLVDVRSPDEFSGKIAAPAHLPQEQAQQRGHVPGAINIPWSSTANEDGTFKSEDDLEKLYADKGFDDAKETIAYCRIGERSSHTWFVLQELLGKKNVKNYDGSWVEYGSLVGVPVEV
>NZ_CP041763.1|WP_132993092.1|548587_549496_-|DUF2993-domain-containing-protein
MSTSARIAPRRRVARAVALTVVAAVILLVIGYIADTFAASRAEHRIAVALERSSGIDYEPEVGLGGFPFLTHASSGEFGSMLISARGVAFDGHDDTDYDSTATVDARLGDVDTGRVWDVTPQTELTAQSVTAETRINSVNLGRLMGILDLYINTPAPDGKVGGGGPGDGLLERSEGVMLSGTVPLPGSPEHDHGLPPSASGYHHPKVKISVKARLSVVDGRVRIEATDLYDGPEDHYSADLPKEFYSHVLKRFSTTVPVLPMAWDVIPKKAMSRGSDLVVTGERGPGALRVDDYSPAIDPGA
>NZ_CP041763.1|WP_132993093.1|549587_550289_+|response-regulator-transcription-factor
MDLLLLTSEPSPDSVLESLTLLPHDVSLAPVDTSSLVSAAESDLVLVDARTDLANARAICRLLDTTGVRVVAVVAEGGLVAVSADWGIDDFLLPDTGPAELDARLRLIVARGIDPEPEISDKIVLGDLVIDENTYTARLRGRPIDLTYKEFELLKFLAQNPGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGSDHESLIGTVRNVGYKAVKPSVRKAEGEYNSGEPD
>NZ_CP041763.1|WP_132993094.1|550315_551200_+|mycothiol-synthase
MSDFSIRTVRGALTAADVDHALTVQAAATEVDGTEPLSEQHLMAIRDGGALHLVSEHGYGNVLSARDGEPPMAEAVVHPDARGAGEGRALVDALLAAAQELGDGPQVWAHGDLPAAGKVAAALGLESERELLQLRRPLSEPLPDVAERSDIVLRTYRESDDAEILRVNNAAFDWHPEQGGWTQRQVDERTGADWFDPKGVFLAFDAADPDTLLGFHWTKVDKPGLGEVYIVGVDPAAQGRGLGNLLTLAGLHYLAGRELDAVELYVEGDNDAALKTYGRLGFTRYRADITYRRG
>NZ_CP041763.1|WP_132993095.1|551624_552692_+|phosphate-ABC-transporter-substrate-binding-protein-PstS
MSVNRKFVHSAGAASATVVAAALVLSACGSGSDAATVTGEGSTAQQKAMEVFSEALADGDKVNLDYTGSGSGAGIKKFLAGEVDFAGSDSPLKDDEIAQAKERCGGNEAWHIPLVAGPVAVSYNLPGVDKLVLDSKTLAKIFDSKIKKWDDAAIKAQNPGVELPSTPIIPVHRSDSSGTTDNFTKYLNAAAPQEWPYEHSKEWAGHGGSGASKSTGVGDTVKKTEGAITYVEWGFATENDLGVAQIDFGAGATELTPETAGKALDSVKFTKPGSKDLVVDTEGLYGMSEPGAYPLLLTPYEIVCSTGYDDAKISESLKTAFSEILDNGQEGLPEAGYVPLPEKFKQTLRGTIDAL
>NZ_CP041763.1|WP_132993442.1|552844_553741_+|phosphate-ABC-transporter-permease-subunit-PstC
MRTLATGSGLIVSTVIGLIALFLLIQAIPSLLKNQENFFTFEGSWVVSGDELHFGIPQQFYATVLVSVIALIIAMPVALGIAMFVTEYAPKRLKKPVAYVVDLLAAVPSIVYGLWGILVLGPAMVGINQWLVDNAGFLPFFSKPQNAANMSTGGTMLTAGIVLAIMILPVITAVTREVFAQTPRGHREAALALGASQWEVVRFAVLPFGFSGYISGAMLGLGRALGETMALLLIISTAGPINFNLLESGQTFATVIANNAAEFDDPLKTGAFISAGLVLFALTFIVNAAARAVIARKA
>NZ_CP041763.1|WP_132993096.1|553742_554600_+|phosphate-ABC-transporter-permease-PstA
MELITMSPRRKITDGAVRTGVVISVLLAILPLGWLLWTLVSRGIEPILDPEWWMESERKGGAANAIVGTLVQTGLAAVVAVPLGVLVGIYLVEYGSARSTLTRVTTFMVDVLAGVPSIVAALFVYAVWRTTLDLPRSGLVVALALVLLMVPLVVRATEEMLKIVPQDLREAAYALGVPKWKTILRVVLPTAMSGIITGIMLAIARVMGESAPILILVGATSGMNWNPFQGDQQSLPLMMIQEYNKGPSGYDEVWGAALTLVIAVAIVYVIARLLAQFTGPKIEGR
>NZ_CP041763.1|WP_132993097.1|554602_555379_+|phosphate-ABC-transporter-ATP-binding-protein
MAKSLTLEELNIYYGDFHAVQDVSLKIKPKSVTAFIGPSGCGKSTVLRTLNRMHEVTPGAYTTGSVKLDELDLYDKNVDPVGVRTTIGMVFQKANPFPTMSIRDNVVAGLKLNGVKDKKELDEVAEASLRGANLWNEVKDRLDKPGGSLSGGQQQRLCIARAIAVSPQVLLMDEPCSALDPISTMAIEDLIAELKSDYTIVIVTHNMQQAARVSDQTAFFNLIGAGKPGQLVEVGDTNKVFSAPDLKETEDYISGRFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041763_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041763_2

574752-574857

Orphan

Consensus_repeat	Method
TGGGGCTCCTCTCGCCGGTTGAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041763_2

>merge|NZ_CP041763|2|574752-574857|CRISPRCasFinder
TGGGGCTCCTCTCGCCGGTTGAGCAAGTGGAGCTCCTCTCGCCGGTTGAGCGAGTGGGTCTCCTTTCTCGCCAGTTGAGCAAGTGGGGCCCTCTCGCCGGTTGAGC

>NZ_CP041763|2|2|574752-574857|CRISPRCasFinder
TGGGGCTCCTCTCGCCGGTTGAGC	AAGTGGAGCTCCTCTCGCCGGTTGAGCGAGTGGGTCTCCTTTCTCGCCAGTTGAGCAA
GTGGGGCCCTCTCGCCGGTTGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041763.1\|WP_132993112.1\|575781_576342_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NZ_CP041763.1\|WP_132993116.1\|579951_581106_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|236095
NZ_CP041763.1\|WP_132993110.1\|572035_574732_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173534
NZ_CP041763.1\|WP_132993114.1\|578182_579067_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235737
NZ_CP041763.1\|WP_132993105.1\|565425_567459_-\|NAD(+)-synthase	unknown	unknown	gnl\|CDD\|235057
NZ_CP041763.1\|WP_132993118.1\|583132_585469_-\|helicase-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|379300
NZ_CP041763.1\|WP_132993115.1\|579306_579936_+\|alpha-ketoglutarate-dependent-dioxygenase-AlkB	unknown	unknown	gnl\|CDD\|225687
NZ_CP041763.1\|WP_132993113.1\|576440_578180_+\|adenylate/guanylate-cyclase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143636
NZ_CP041763.1\|WP_132993117.1\|581321_582956_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223989
NZ_CP041763.1\|WP_132993109.1\|570266_571214_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NZ_CP041763.1\|WP_132993120.1\|585867_586518_-\|transglycosylase-family-protein	unknown	unknown	gnl\|CDD\|369056
NZ_CP041763.1\|WP_132993101.1\|561042_561561_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP041763.1\|WP_132993107.1\|568070_568982_+\|copper-resistance-protein	unknown	unknown	gnl\|CDD\|224195
NZ_CP041763.1\|WP_132993104.1\|564827_565337_+\|DUF1877-family-protein	unknown	unknown	gnl\|CDD\|378105
NZ_CP041763.1\|WP_132993119.1\|585538_585727_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041763.1\|WP_132993111.1\|575027_575630_-\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP041763.1\|WP_132993108.1\|569283_570186_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP041763.1\|WP_132993102.1\|561735_563307_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373989
NZ_CP041763.1\|WP_132993103.1\|563407_564847_+\|wax-ester/triacylglycerol-synthase-family-O-acyltransferase	unknown	unknown	gnl\|CDD\|274360
NZ_CP041763.1\|WP_132993106.1\|567529_568066_+\|copper-resistance-protein-CopC	unknown	unknown	gnl\|CDD\|377255

Protein	Function_ID	Function_description	E-value
NZ_CP041763.1\|WP_132993112.1\|575781_576342_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	6.2869e-59
NZ_CP041763.1\|WP_132993116.1\|579951_581106_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|236095	PRK07777, PRK07777, putative succinyldiaminopimelate transaminase DapC.	0
NZ_CP041763.1\|WP_132993110.1\|572035_574732_+\|hypothetical-protein	gnl\|CDD\|173534	PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional.	2.95674e-09
NZ_CP041763.1\|WP_132993114.1\|578182_579067_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|235737	PRK06197, PRK06197, short chain dehydrogenase; Provisional.	9.96262e-105
NZ_CP041763.1\|WP_132993105.1\|565425_567459_-\|NAD(+)-synthase	gnl\|CDD\|235057	PRK02628, nadE, NAD synthetase; Reviewed.	0
NZ_CP041763.1\|WP_132993118.1\|583132_585469_-\|helicase-associated-domain-containing-protein	gnl\|CDD\|379300	pfam13625, Helicase_C_3, Helicase conserved C-terminal domain. This domain family is found in a wide variety of helicases and helicase-related proteins.	6.36031e-37
NZ_CP041763.1\|WP_132993115.1\|579306_579936_+\|alpha-ketoglutarate-dependent-dioxygenase-AlkB	gnl\|CDD\|225687	COG3145, AlkB, Alkylated DNA repair protein [DNA replication, recombination, and repair].	4.74011e-23
NZ_CP041763.1\|WP_132993113.1\|576440_578180_+\|adenylate/guanylate-cyclase-domain-containing-protein	gnl\|CDD\|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	1.49806e-40
NZ_CP041763.1\|WP_132993117.1\|581321_582956_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	2.75577e-117
NZ_CP041763.1\|WP_132993109.1\|570266_571214_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	4.45192e-30
NZ_CP041763.1\|WP_132993120.1\|585867_586518_-\|transglycosylase-family-protein	gnl\|CDD\|369056	pfam06737, Transglycosylas, Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.	2.49124e-35
NZ_CP041763.1\|WP_132993101.1\|561042_561561_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.48111e-07
NZ_CP041763.1\|WP_132993107.1\|568070_568982_+\|copper-resistance-protein	gnl\|CDD\|224195	COG1276, PcoD, Putative copper export protein [Inorganic ion transport and metabolism].	9.68354e-05
NZ_CP041763.1\|WP_132993104.1\|564827_565337_+\|DUF1877-family-protein	gnl\|CDD\|378105	pfam08974, DUF1877, Domain of unknown function (DUF1877). This domain is found in a set of hypothetical bacterial proteins.	6.00038e-24
NZ_CP041763.1\|WP_132993111.1\|575027_575630_-\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	4.58804e-43
NZ_CP041763.1\|WP_132993108.1\|569283_570186_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.04482e-17
NZ_CP041763.1\|WP_132993102.1\|561735_563307_+\|hypothetical-protein	gnl\|CDD\|373989	pfam15648, Tox-REase-5, Restriction endonuclease fold toxin 5. A predicted toxin of the restriction endonuclease fold present in bacterial polymorphic toxin systems. In bacterial polymorphic toxin systems, the toxin is exported by the type 2, type 5, type 6, or PrsW-peptidase dependent secretion system. Versions of this domain are also found in caudoviruses.	3.56102e-05
NZ_CP041763.1\|WP_132993103.1\|563407_564847_+\|wax-ester/triacylglycerol-synthase-family-O-acyltransferase	gnl\|CDD\|274360	TIGR02946, Putative_diacyglycerol_O-acyltransferase_Mb3115, acyltransferase, WS/DGAT/MGAT. This bacteria-specific protein family includes a characterized, homodimeric, broad specificity acyltransferase from Acinetobacter sp. strain ADP1, active as wax ester synthase, as acyl coenzyme A:diacylglycerol acyltransferase, and as acyl-CoA:monoacylglycerol acyltransferase. [Unknown function, Enzymes of unknown specificity].	3.61e-131
NZ_CP041763.1\|WP_132993106.1\|567529_568066_+\|copper-resistance-protein-CopC	gnl\|CDD\|377255	pfam04234, CopC, CopC domain. CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule. Along with CopA, CopC mediates copper resistance by sequestration of copper in the periplasm.	3.74972e-28

>NZ_CP041763.1|WP_132993110.1|572035_574732_+|hypothetical-protein
MAEDGEDLMNPSLNIVDNVVDREYTVERFVENPVETVIEKPITLERIVERLVVDTVDTIIDKPATVSRLVERPVVTVVDDVVDKPVNISRLVERPVVTVEDELVDKPVEIPRLVEKPIVTVVDRIVDTPVDVERLVEQPIVTVVDKVVDAPIDVERRVDKPVVNFVDDVVDKPVDLPRMVEKPVVTVHDEIEEKTVELKRLVEKPVVTVLDEIVEKAVELKRLVEKPAVTVVDEIVQKPVDVSRLVERPVVTIVDDIEETEFEISRLVEKPIVTVLDKIADKPVEVQRLVERLIVTVVDEIVERPSEVTRKIEKLIVDVNDEVVEKPITVERMVEKPIVTLVDRIVEVPVESIVEKVIEKPVEKIIEITVEKPVEKIVEHVIEVPVEKNVYSTVEKVIEVPVEEVVYKTVEKPVEKVIEVTVEKPVIKVVEVPREVVVERIVDKPVEKPVDHVIERVVEKPNVVEKVIEKPVEKVIERIVEKPDIIEKVIEKPVTHELERVVEKPEVVERVVEVPVERVIERVVEQPNVVEKVVEKPVDREVERVVEQPNVIEKTVEKIVDHVVERIVEKPHVIERVVEQPVDHVVERVVEQPNVIEKVIEKVVDHVVERVVEKPNVIEEVIEKSVDHVIGKEVETPNIIEQVVTRPTDHVVEKVVEVPEISEQTVERVVQRVVEKIVERPNIVEKLVEQTVDHVVERIVERPHVVEKVIDKPVEHEVEKIVERPEIVETVVEKPVHREFEKVVQTPVLVENVIEKQINVVSERIVEKPIEHIVEKVVEKPVYREVERIVEKPIEKIVEIVVEKPVIVRRVVEKEVERVIEDDTSTRTVTHDADDAVPPLEPKYLDKQPGGSHRWVEATTGEHPDDETVGSDSPEAAARDRVEATYQTRRARHRSAED
>NZ_CP041763.1|WP_132993109.1|570266_571214_+|alpha/beta-fold-hydrolase
MTESTAAGPDDGQSTRSGLRETANNGFGRVRRGARHALRPHPVEHVPAGRRIDLPGRGTTYITDSGNPDGPAVFLLHSVSTTGLLCWYPAIPELQKDYRVLTIDHRWHGRGIRSDGFSLADCADDVVAVADQLGVDTFTAAGFSMGGGIAQLTWRRHPDRVDGLVLCSTGPYFSSIEPGRLAAEQRIGKALKVADKVLPTPSDKRLDDAGRHPVAWALAQVASTPLGHQGEFSAAMAEFDSRLWLNEVDVPSAVVVSTRDKIVAPERQQLLVDAIPGAQRFDVDGGHACCVLGSEEFVPQFASAVGAVSRAAVKA
>NZ_CP041763.1|WP_132993108.1|569283_570186_-|alpha/beta-hydrolase
MIPIDRPKLEGSIAVGDKRQRRIGFSEFGNPDGPAIVWLHGTPGARRQIPTQAREYAETRGFRLIGLDRPGVGSSTAHSYDSISDFASDFQTVLDTLGIDKFSVIGLSGGGPYALAVTHVLSDRVVSTGVVGGVAPINGPDAVHGGAVQLAQHAVPLINVAGAPIGKALSTILGVARPIADPAISIYGRLSPEADREILSRPEFRAMFLDDLLHGGSRRMEAPFADLQLFVRDWGFRIGDVQSKVHWWHGDADNIIPYEHGAHMVALLPNATLYTLPDQSHLSGLNHAVEILDTLLNAWE
>NZ_CP041763.1|WP_132993107.1|568070_568982_+|copper-resistance-protein
MTKHRGLVAGASALTVLAGVAVVWILARPDGPEPSAWVDAFALAAVSTLFGLGMLALVDAEPAPGTVAVVAALWGATSLISAWLQVAERAGAGPLDVGLRDMATGVESGLPVIVCVLGALAVLGWSYAAASGARSGGVNAYVVGAIAAVGILVSSVTGHAGQSSWVPLVVGVHAIAAAWWVGTLAALVLTVRGRGGWARSLPVFSERAIVVVGVLTVTGVIAGVAQIGIGSQWWDTGYGRVLVAKVVALGCAVAVAWWHRTTWLAKARRHGASEKDSIRHAGYELALLTLVLGLAAGLAATGV
>NZ_CP041763.1|WP_132993106.1|567529_568066_+|copper-resistance-protein-CopC
MVRFVKRSTVLTVLIAFAALLGGVMAGPAAAHSALTGSSPEDGASLDKAPDTVTLTFNEELQENYAVLKIVGPDNHFWEKGKPAISGTEVSVPVQDLGPAGEYKVNYRVTSADGHPVEGQVAFTLTAAGNGTPGPVADDWQPQAHDDGIKAWPFIIGGVVLVLLVGGAVAYVLIKRRR
>NZ_CP041763.1|WP_132993105.1|565425_567459_-|NAD(+)-synthase
MSTYSHGFARIAAAVPPVALADPHENAARTVELIQRAHDEGAALVAFPELGLCGYSVDDLVQQDALLDGVMDALMTVVEATRRVSPVVLVGAPLRIDDALYNCAVIIHDGQVLGVAPKSYLPNYREFYEQRYFAAARDTVVDSITLGDHEIPFGADLVFEAVDLPGLRFHVEVCEDGWVPIPPSTWAALAGATLLVNLSGSPVTVGKEEYRRTLATSHSARNVAAHLYVASGFGESTTDLAWDGDALIAENGTLLARSETFSMDPQLIVADVDLDRIRQERSRMISMRDQVGDYADQARAIRRIPFELDLALDDDVVADLRRTVLRFPFVPTGTADRDQRCRDVLDIQVQGLVARLRATGIGKIVIGVSGGLDSTLALLVAVQAFDLLGLPRTDIRAYTMPGFATGDATLARSHVLMDSLGVTGTELDIRPSCERMLADLGHPFADGRPVYDVTFENVQAGERTSHLFRLANYLGGLVLGTGDLSELALGWCTYGVGDQMSHYNVNGSVPKTLIQHLIRWKIATGGYPEATIEALREIVDDVISPELVPADADGNVQSTEGKVGPYELHDFFLYHLTRFGYRPSKMAYLAHQAWGDSSRGPWSDMLAPEQRNQYDAATIERWLEVFLKRFMSSQFKRTAMPNGPKIGSGGSLSPRGDWRSPSDASAAAWLRELHGEL
>NZ_CP041763.1|WP_132993104.1|564827_565337_+|DUF1877-family-protein
MRRSRTDRMLSVYLAVPTGADERLATVDPDGVIEYVEGLLESGVPSIDLGEAWDGLHFLLTGASASEPIEDEPLSEAVVGVYEFESDDLLGLTPAEDLPFILARLETVNIEQLLAGADFATFAKAEIYPDRWTDEPESLRALLREAFTNLIEFHRYCRAESRDLLVSIH
>NZ_CP041763.1|WP_132993103.1|563407_564847_+|wax-ester/triacylglycerol-synthase-family-O-acyltransferase
MQRLSGLDASFLYLETPSQVMNVAAIMQVDPTTVPGGYTFDGLRNEMARRVTAIPSLRRKLSDSLANVDHPVWVEDDDFRIERHVHRIAIPSPGRVEEMAQMCGHLVGQVLDRKKPLWDLWVLEGMEDGKIALMLRMHHAGVDGATVADILGELATAAPEPPELDPAKMAESAGSASRRDMAVGGAANYFLQRPIAALKLIPKTVPLPIDWFRRVRSGAGMPAPFLAPRTRFNAPLSPRRSLALTQLPLDDVKRVKNHFGVKMNDVVLALAGGALREYLDENGELPDEPLVGMVPVSVRGADEHDLVESGTNKVSGMFTRLPSQIADPVERLRVAGEYANQSKDHHQEIDANILRSYAEFAPGNTMGAVMRLYADRRMSGLHPPVFSTIVSNVAGPASKMYMLGALVEAVYPLAPIFHGLGLNITVFSSAGKLNVGLLTCSDIAPDIWAMARAFHDQLDLLLGEVEAGAVLAHDATVED
>NZ_CP041763.1|WP_132993102.1|561735_563307_+|hypothetical-protein
MRKKQALTAGAAIAVVAVLAVCLSGVLKPSVDGTPVPNETMQALNGLNDASTSLADAPAARYDGLVSDDDGDKLEVNDLTVSAMGDVYGKFSRDRGRGEVLQIDGRTLIKADSGFWSGLSQGKRPAGLRMEGIPSDKWVVTDESVLGVDLGAVLRPDKLGLSLNQQDRRLDRTDIEGSVVDAGRDTPDRRASTGRDPAGVSEVEVEDHDGGVDGTQRFKSDEMTVGADDNGDITGIRGPLSVGVAGDSDELTADLRVAPLDAASARQMYVSIKSVTRTAKVGSWNIDVGTPSGGLDCTPGGRCTVTYTLRNKAEGLERGTVDISLNADFKANGRDLGKCDAKGTMPINGSGKVSCGVPLGISGSFNANSNSRFTVSVNGELDSAAIAESAEVGIKFSEKAKGWEATAPKASETARRYNRQITLVPSGYVYRTGDVAFNGREKDGTLLLVYGPGYDAHVARDGAFDPEWAGTEQMVEQVKKAHAAAGGTNVRMVFAEAEAADAARELLTANGVTGVEVVVVPLA
>NZ_CP041763.1|WP_132993101.1|561042_561561_-|nuclear-transport-factor-2-family-protein
MTPSFTAEELDAAFAQFQKTVAEVAEHRDWDAWADMFSEDAEYIEHAYGTMHGREEIRPWINKTMNEFPGSHMTGYPSLWHVTDPSTNRVICEVDNPMRDPGDGSQFTATNITILTYAGDGLWSCEEDVYNPMKFGIMARKWCDRAEQLGTLDDEARQWMETVGKMFTSRKK
>NZ_CP041763.1|WP_132993111.1|575027_575630_-|CoA-pyrophosphatase
MVTRADVQGRLGAFEVRSIFPGPDTRSAAVVILVAPCHGHRGIWLTRRPAGMSRHSAQFALPGGRLDPGETPHEAALRELHEEMGIKLGAETIIGDLDDYRTRSGYVISPTVAWIDEEIEPTPNPDEVEHVFHIGLGELAEAAPVFETIAESERPVMALPLLGRLIHAPTAALMYQFTAVALRGDDIRVADYEQPLFAWR
>NZ_CP041763.1|WP_132993112.1|575781_576342_+|YceI-family-protein
MSNTATVTPTELTAGTWTIDPVHSTVGFAVRHLMVSKVRGSFDTFTGAIEIAEDGTPSVEATIDVKSITTNNAQRDEHIRSADFFDAEQFPTATFKSTSVEADGDDYKLTGDFTLKGVTKPVTMDMEFNGVNPGMGQGPVAGFEARTVLNRKDFGIDIDMPLETGGSVVGDKITIVLEIEAGQAQA
>NZ_CP041763.1|WP_132993113.1|576440_578180_+|adenylate/guanylate-cyclase-domain-containing-protein
MRGRHAATAQRAADWAERRRRIRFFGGMLDELGYDRAAVELRELDEGTRRRFAKRGLIGAGVIVGVAKILIGFETFVAALLAFNGGTLNLHTAPDYPADMGMVLIGLLVGTVISVVASIAFLLPQYRWFIRADPTDKIREWEVRSVPRKLVVADLFGWVAALVVYAGLSEQRGVFVLAVAGAFGLAAITSGSLTYLFGESSSRPLAILALHGDSVDGVLHSVRARLFVVWMVSSAVPMIGLLLINLGRGLDWLPPVAGTVDWTSVLLAVVALTSGVRVVGLVDRAITGPLKEMREVIEAARIGDFGRRVAVYDASEIGILQAGLNSMLDGLVERERMRDIFSRHVGDRVAKLALEQDGELVGTNTDVAVIFVDITGSTAFAADRDPRETAVVLNAFFSIVGDVVDRHDGFINKFEGDAALMIFGAPTSLDDPALAALAAARELGSELGEKLPLEWGMGVSFGQVFAGNIGARNRYEYTVIGDPVNEAARLSDRAKEGYAPVYASRAAVEAAADEEGECWSRVDRVVLRGRSHHTEVYAATDLLVRSEPPSLGSVLADLVKFALPAMPGDRTSRTPTKES
>NZ_CP041763.1|WP_132993114.1|578182_579067_+|SDR-family-NAD(P)-dependent-oxidoreductase
MAGWETRDIPAQDGRRFIITGANSGLGAATATAVAAAGGEVTLACRNVAKAQSVADRIGAPAKVAELDLSDLASVRAFADTVDGADVLINNAGVMGIPHGRTVDGFEMQMGTNHLGHFALTALLLPKISERIVSLSSIAHRMAQPYADDLNWEKRTYNRRIAYGDSKFANLLFGLELASRLEAVGSSTRSSIAHPGYSSTPLMGRSETWFDHVMRLGNVLHVGQSPERGALPVLFAATSPDARNGVYYGPRGLGEFLGTPDEASMRKAAGDQALRDRLWAESERLTGIDFPVSE
>NZ_CP041763.1|WP_132993115.1|579306_579936_+|alpha-ketoglutarate-dependent-dioxygenase-AlkB
MTTGLQASLFDAGTDEPALAPLRTAVRRTDLSDGAWVDFRPGWMQGSVDVFDTLHTSVPWRAEERRMYDTTLPVPRLMAHYLQEDALPHRLLDDARDALSDHYGDVLPGGFATAGLCLYRDGADSVAWHGDRIGRGRSHDTLVAILSLGAPRPLLLRPRGGGPSRKFVLGSGDLLVMGGSCQRTWDHAVPKVHGAGPRISVQFRPAGVW
>NZ_CP041763.1|WP_132993116.1|579951_581106_-|pyridoxal-phosphate-dependent-aminotransferase
MPPVTRLRPFTSTIFAEMSALAVEHDAVNLGQGFPDTDGPETMLDAARDAISGGRNQYPPGIGIPELREAVSEHQRDHYSLDYDPADQVLITVGATEAIAGAILGLVEPGREVVMIEPYYDAYAAAVALAGGVRRTAPLVADGDGFVLDRDALAAAFGPNTAAVVVNSPHNPTGTVLSDDDLAEIARLTIEHDVVAITDEVYEHLIFDGREHRPLATFPGMPGRTLRISSAAKTFHVTGWKVGWISGPAELVAAARAAKQYLTYVGSGPFQPAVAHALRHEMPWVQADAAKLQSKRDLLSKALADAGFRVHRSEGTYFVCADPRPLGIADGAAFCRELPARIGVAAVPVSAFVDHPDEWRHLVRFAFAKRDDTIAEAAQRLRLL
>NZ_CP041763.1|WP_132993117.1|581321_582956_-|DEAD/DEAH-box-helicase
MTDGPLIVQSDKTLLLEVDHPKAAETRAAIAPFAELERAPEHIHTYRVTPLALWNARAAGHDAEQVVDALVSHSRYPVPQPLLVDIVDTMGRFGRLQLVKHPAHGLTLVSLDRAVLEEILRHKKVAPMLGARIDDDTVQVHQSERGRLKQVLLKVGWPAEDLAGYVDGEAHPIDLMQDDWSLRDYQELAADSFWAGGSGVVVLPCGAGKTMVGAAAMAKARATTLILVTNTVAGRQWKRELIARTSLTEDEIGEYSGERKEVRPVTIATYQVMTRKTKGEYKNLDLFDSRDWGLIVYDEVHLLPAPVFRMTADLQSRRRLGLTATLVREDGREGDVFSLIGPKRYDAPWKDIEAQGWIAPADCVEVRVTMTDDERLQYAVAEADAKYKLCSTAHSKLSVVKTILDNHRGSPTLVIGAYIDQLEELGQALDCPVIQGSTRNAEREKLFEAFRRGELSTLVVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPKADGGQAHFYSVVSRDSLDADYAAHRQRFLAEQGYAYRIIDADDI
>NZ_CP041763.1|WP_132993118.1|583132_585469_-|helicase-associated-domain-containing-protein
MSPDHPLRSSADALASRSDEQLVALLVRRPDLASPPPRGTGVLAQRAMSASSVSLAGEGLDLLSVAILEAFLDAAAGSFHHDLLGPVSRDAIVSRLGRRALRTEVDARLTDLADLALIWPDGSSTGKKPSSWVAGVHLPAALPWRAFHLLGPLARVDAADISDRIDALDDRPRELLTTLSRGPALGRSRDAAPDADPQAPVPRLLDVGLLARVDEQTVELPPQVGQILRSEPPLVSVRLREPSPTDAAATPRFGNTSLDAAGAGEALELLRHSGEILDALGEAPAAVLRAGGMGVRELRRLAKTTGLQVTRVGLIVELLAACKLIGAGIPESVDVLAGDEVFAPTGTSDGWIRHDPERRWASLATAWLDLPRRPWQIGETDRDGAVIGALAAESFDASAPVGRRTVLAPLTELDDASPVTTESLTALLGWRHPRQLRRLTSRTVGETLREATELGLVAHGSLTRVGRALLTRDPDDEETTADLLTAMDAALPEPIDYFLVQADFTVTVPGPLTPNLAERLTLVADLESGGAASVYRVTESSVRRALDAGSTASELAALFSEHSKTPVPQSLTYLIDDVARRHGQLRVGVASSFIRCDDAAMLTGVMRSDAAHDLSLRALAPTVAVSPAPLRDVIDRLRASGFTPAGEDSTGALVDLRSRGARVAARGSGSPRAHRRGRIGPGQASTVVARMRTADRADGPVSSTAASSGAGETTSALIQLALQTGRRLRIGYVDAQGGASRHVVRARSMAAGQLVADEEAGEEHIRFALHRITRVELL
>NZ_CP041763.1|WP_132993119.1|585538_585727_+|hypothetical-protein
MMDVAKKNAYVDNGWPEEAGDEHAVTELLAHLSGALSPFGDTQFPLPADDLPYVHSKTVVNR
>NZ_CP041763.1|WP_132993120.1|585867_586518_-|transglycosylase-family-protein
MTGRHAKQTTTNTKTFAKIAMTSAVLGGLGGGAALLGNGQASAATDAEWNAVAQCESGGDWSINTGNGYQGGLQFSSSTWSAHGGDQYAPSADQATREQQIAVAERVLANQGKGAWPVCGTGLSGATERSAPSATPQNDDAQEQAPQQQGEKKFDLSEAEDAKNSDDVKTQVGEALDDAGVSPEVKGAWDAAKNSGYDLTPDQVKMFNENKGLVSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1188675 : 1225140

Mycobacterium_phage(12.5%)

protease,integrase,capsid

attL 1188500:1188525|attR 1197367:1197392

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1188500:1188525	attL	NA	NA	NA	NA
WP_143965380.1\|1188675_1189809_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9SFC1	Mycobacterium_phage	9.0e-64	39.5
WP_143965381.1\|1190896_1192009_+	AAA family ATPase	NA	NA	NA	NA
WP_143965382.1\|1192231_1192705_+	hypothetical protein	NA	NA	NA	NA
WP_143965383.1\|1192701_1192902_+	hypothetical protein	NA	NA	NA	NA
WP_143965384.1\|1192980_1193274_+	hypothetical protein	NA	NA	NA	NA
WP_143965385.1\|1193388_1193610_+	hypothetical protein	NA	NA	NA	NA
WP_143965386.1\|1193779_1194061_+	hypothetical protein	NA	NA	NA	NA
WP_143965387.1\|1194053_1194533_+	hypothetical protein	NA	NA	NA	NA
WP_143965388.1\|1194665_1195517_+\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_143965389.1\|1196712_1197096_-	hypothetical protein	NA	NA	NA	NA
WP_143965390.1\|1197516_1199577_+	copper resistance protein CopD	NA	NA	NA	NA
1197367:1197392	attR	NA	NA	NA	NA
WP_132993827.1\|1199583_1199904_-	TIGR02611 family protein	NA	NA	NA	NA
WP_132993720.1\|1200344_1202018_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	9.5e-46	27.4
WP_143965391.1\|1202084_1206587_+	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_132993718.1\|1206612_1207095_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_132993826.1\|1207124_1207802_+	hypothetical protein	NA	NA	NA	NA
WP_143965392.1\|1207823_1209449_-	DUF3459 domain-containing protein	NA	NA	NA	NA
WP_132993716.1\|1209471_1209864_-	globin	NA	NA	NA	NA
WP_132993715.1\|1210020_1210269_+	hypothetical protein	NA	NA	NA	NA
WP_143965393.1\|1210255_1210723_+	DUF5130 family protein	NA	NA	NA	NA
WP_143965394.1\|1210738_1212340_-	AMP-binding protein	NA	NA	NA	NA
WP_143965395.1\|1212361_1214947_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	7.3e-45	33.3
WP_132993711.1\|1215003_1215507_-	hypothetical protein	NA	NA	NA	NA
WP_143965396.1\|1215583_1216192_+	DsbA family protein	NA	NA	NA	NA
WP_143965397.1\|1216188_1217211_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_143965398.1\|1217225_1217705_+	ribose-5-phosphate isomerase	NA	NA	NA	NA
WP_132993707.1\|1217719_1218514_+	Fpg/Nei family DNA glycosylase	A0A1V0CNR6	Kaumoebavirus	1.6e-11	25.6
WP_143965399.1\|1218577_1219492_+	PE-PPE domain-containing protein	A0A1C9EHZ6	Gordonia_phage	2.3e-09	32.7
WP_132993705.1\|1219584_1220295_-	L,D-transpeptidase	NA	NA	NA	NA
WP_143965400.1\|1220757_1222176_+	trigger factor	NA	NA	NA	NA
WP_132993704.1\|1222438_1223017_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.5e-38	46.9
WP_132993703.1\|1223067_1223748_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A248SJ97	Salicola_phage	3.5e-31	39.6
WP_132993702.1\|1223862_1225140_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.1e-142	60.8

DBSCAN-SWA_2

2255400 : 2264119

Yellowstone_lake_phycodnavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143965625.1\|2255400_2258316_+	DEAD/DEAH box helicase family protein	A0A0P0YMN2	Yellowstone_lake_phycodnavirus	1.8e-39	27.9
WP_143965626.1\|2258312_2259098_+	hypothetical protein	NA	NA	NA	NA
WP_143965627.1\|2259156_2260152_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A160DHK0	Gordonia_phage	7.7e-152	84.3
WP_132991813.1\|2260208_2262404_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.1e-211	51.7
WP_143965628.1\|2262430_2262919_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	Q4Z9B0	Staphylococcus_phage	3.5e-09	30.4
WP_132991815.1\|2262929_2263163_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.7e-22	65.8
WP_132991816.1\|2263561_2264119_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	9.3e-06	31.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041763

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection