CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP030245	Lactobacillus plantarum strain Y44 plasmid pY44-1, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP030244	Lactobacillus plantarum strain Y44 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4470 : 12194

Enterococcus_phage(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080009511.1\|4470_6639_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.8e-255	60.5
WP_013356287.1\|6745_7672_+	ribonucleoside-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	2.0e-37	32.4
WP_033098914.1\|7686_8637_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	5.5e-99	54.6
WP_114602643.1\|8764_9577_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	2.5e-15	29.0
WP_013356284.1\|9690_10323_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	4.7e-14	33.2
WP_013356283.1\|10409_11312_+	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
WP_087613290.1\|11419_12194_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP030244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP030244_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP030244_1

2738848-2738933

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP030244_1

>merge|NZ_CP030244|1|2738848-2738933|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP030244|1|1|2738848-2738933|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP030244.1\|WP_003642350.1\|2740836_2741631_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP030244.1\|WP_003642351.1\|2741627_2742626_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP030244.1\|WP_003642344.1\|2732909_2733947_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP030244.1\|WP_013355933.1\|2737354_2738833_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP030244.1\|WP_003642342.1\|2731329_2732058_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP030244.1\|WP_003643401.1\|2743862_2744375_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP030244.1\|WP_003642355.1\|2745542_2746289_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP030244.1\|WP_003642357.1\|2747070_2747907_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP030244.1\|WP_013355935.1\|2742622_2743618_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP030244.1\|WP_003643403.1\|2746305_2746812_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP030244.1\|WP_011102040.1\|2732216_2732783_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP030244.1\|WP_013355080.1\|2730302_2731226_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP030244.1\|WP_003642346.1\|2734881_2735835_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP030244.1\|WP_003642345.1\|2734095_2734662_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP030244.1\|WP_013355936.1\|2744355_2745249_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP030244.1\|WP_003643398.1\|2738950_2739550_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP030244.1\|WP_013355931.1\|2736346_2736538_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030244.1\|WP_011102039.1\|2729773_2730139_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP030244.1\|WP_013355932.1\|2736784_2737024_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP030244.1\|WP_080009506.1\|2739670_2740600_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558

Protein	Function_ID	Function_description	E-value
NZ_CP030244.1\|WP_013355935.1\|2742622_2743618_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.35687e-78
NZ_CP030244.1\|WP_003642351.1\|2741627_2742626_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.03952e-81
NZ_CP030244.1\|WP_003642344.1\|2732909_2733947_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP030244.1\|WP_013355933.1\|2737354_2738833_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.13969e-71
NZ_CP030244.1\|WP_003642342.1\|2731329_2732058_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP030244.1\|WP_003643401.1\|2743862_2744375_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP030244.1\|WP_003642355.1\|2745542_2746289_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP030244.1\|WP_003642357.1\|2747070_2747907_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
NZ_CP030244.1\|WP_003643403.1\|2746305_2746812_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58107e-53
NZ_CP030244.1\|WP_011102040.1\|2732216_2732783_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP030244.1\|WP_003642350.1\|2740836_2741631_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP030244.1\|WP_003642345.1\|2734095_2734662_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP030244.1\|WP_003643398.1\|2738950_2739550_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP030244.1\|WP_013355936.1\|2744355_2745249_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.70513e-130
NZ_CP030244.1\|WP_013355080.1\|2730302_2731226_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	7.33234e-76
NZ_CP030244.1\|WP_011102039.1\|2729773_2730139_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP030244.1\|WP_003642346.1\|2734881_2735835_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NZ_CP030244.1\|WP_080009506.1\|2739670_2740600_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.3412e-54

>NZ_CP030244.1|WP_013355933.1|2737354_2738833_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVVPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP030244.1|WP_013355932.1|2736784_2737024_-|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLLLEFVLLFVVKGSIDHYNQLPYDWFAYLTTLIHYFLGTFAFFGIILVIECVWNKFK
>NZ_CP030244.1|WP_013355931.1|2736346_2736538_+|hypothetical-protein
MAAFSEKQLKKAPITDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>NZ_CP030244.1|WP_003642346.1|2734881_2735835_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP030244.1|WP_003642345.1|2734095_2734662_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP030244.1|WP_003642344.1|2732909_2733947_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP030244.1|WP_011102040.1|2732216_2732783_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP030244.1|WP_003642342.1|2731329_2732058_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP030244.1|WP_013355080.1|2730302_2731226_-|IS30-family-transposase
MSTTILSFQNRVVIETLHNEGRSLRYIANYLGFSKTTIFNELHRLNSEYQAGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVHKWSPEQVAHVVGIAYKTVYNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNHGRSIEERPHKVETRQEFGHFEADTVLSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERRTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQINWYLNSRPLKCLNWHTPIEIFLLNLRH
>NZ_CP030244.1|WP_011102039.1|2729773_2730139_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP030244.1|WP_003643398.1|2738950_2739550_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP030244.1|WP_080009506.1|2739670_2740600_-|ABC-transporter-substrate-binding-protein
MTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILMGTSSAVANGKYAQYNKIVPSYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP030244.1|WP_003642350.1|2740836_2741631_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP030244.1|WP_003642351.1|2741627_2742626_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLAGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP030244.1|WP_013355935.1|2742622_2743618_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP030244.1|WP_003643401.1|2743862_2744375_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP030244.1|WP_013355936.1|2744355_2745249_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP030244.1|WP_003642355.1|2745542_2746289_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP030244.1|WP_003643403.1|2746305_2746812_-|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP030244.1|WP_003642357.1|2747070_2747907_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

319051 : 401026

Bacillus_virus(20.0%)

protease,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|319051_319615_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_013355171.1\|319808_320477_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_013355172.1\|320634_322140_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|322404_322773_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|322885_323395_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_013355174.1\|323425_324622_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|324731_325202_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|325220_325676_+	hypothetical protein	NA	NA	NA	NA
WP_013355176.1\|325779_326352_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_013355177.1\|326517_327438_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_013355178.1\|327574_328486_+	oxidoreductase	NA	NA	NA	NA
WP_003646442.1\|329232_329679_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|329916_331443_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|331443_332415_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|332492_333824_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|334289_335807_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|335821_337651_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|337665_338388_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_013355180.1\|338970_342654_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_041161944.1\|342655_344455_+	hypothetical protein	NA	NA	NA	NA
WP_003641948.1\|344451_345369_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|345412_345676_+	hypothetical protein	NA	NA	NA	NA
WP_003641950.1\|345787_346066_+	hypothetical protein	NA	NA	NA	NA
WP_003641952.1\|346445_346832_+	hypothetical protein	NA	NA	NA	NA
WP_003641953.1\|347057_347213_+	hypothetical protein	NA	NA	NA	NA
WP_003641955.1\|347545_347746_+	hypothetical protein	NA	NA	NA	NA
WP_114071742.1\|347675_347822_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_003641956.1\|347898_348306_+	hypothetical protein	NA	NA	NA	NA
WP_003641960.1\|349576_349852_+	hypothetical protein	NA	NA	NA	NA
WP_003641962.1\|350233_350851_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|350854_352009_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|352012_352804_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|352874_353747_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|353906_354722_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|355247_356624_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|356668_357853_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|358237_358441_+	hypothetical protein	NA	NA	NA	NA
WP_003643803.1\|358675_358828_-	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|358852_359521_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|359517_359691_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|359721_359889_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|360750_360951_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|361078_361246_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641976.1\|361363_362563_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|362593_363340_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641978.1\|363693_363882_+	hypothetical protein	NA	NA	NA	NA
WP_003641979.1\|364217_364364_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_011100998.1\|364554_365883_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_011100999.1\|365883_366627_+	response regulator transcription factor	NA	NA	NA	NA
WP_003641982.1\|366745_367489_+	response regulator transcription factor	NA	NA	NA	NA
WP_003646470.1\|367793_368567_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|368665_368824_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|368848_369019_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_013355184.1\|369285_371436_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	8.8e-44	27.7
WP_003641987.1\|371451_372828_+	HlyD family secretion protein	NA	NA	NA	NA
WP_003641990.1\|373674_374343_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|374429_375110_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641992.1\|375203_375890_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641993.1\|376027_376231_+	hypothetical protein	NA	NA	NA	NA
WP_033099005.1\|376325_378635_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003643814.1\|378893_379670_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|380108_381125_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|381532_382243_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|382315_383677_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|383683_383872_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|383861_384284_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|384506_385862_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|385879_387316_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003642003.1\|387436_388333_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|388482_389229_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003643818.1\|389341_390355_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642006.1\|390808_391942_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|391946_392741_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|392909_393827_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|393872_395147_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|395139_396099_+	hypothetical protein	NA	NA	NA	NA
WP_003642011.1\|396120_396825_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|396824_397667_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646492.1\|398263_398653_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|398974_401026_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

569535 : 578159

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355236.1\|569535_571233_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.0e-55	37.0
WP_003640956.1\|571254_571563_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|571578_572178_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|572192_572444_+	YaaL family protein	NA	NA	NA	NA
WP_011101140.1\|572841_573507_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|573503_573833_+	hypothetical protein	NA	NA	NA	NA
WP_013355238.1\|573849_574869_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|574893_575241_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_013355239.1\|575339_576236_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640969.1\|576239_577025_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|577163_578159_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5

DBSCAN-SWA_3

780988 : 789982

Staphylococcus_virus(28.57%)

transposase,integrase

attL 771731:771745|attR 797053:797067

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
771731:771745	attL	NA	NA	NA	NA
WP_013355290.1\|780988_782545_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.6e-17	29.8
WP_013355291.1\|782610_784302_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.1e-92	41.5
WP_013355292.1\|784483_785659_-\|integrase	tyrosine-type recombinase/integrase	A0A1X9I5C3	Streptococcus_phage	2.6e-37	30.5
WP_033098994.1\|785664_785850_-	hypothetical protein	NA	NA	NA	NA
WP_013355293.1\|785964_786831_-	KilA-N domain-containing protein	Q4ZC41	Staphylococcus_virus	8.1e-81	57.5
WP_049787978.1\|787089_788019_-	DUF4428 domain-containing protein	O48432	Lactobacillus_phage	3.1e-22	31.2
WP_080009498.1\|788055_789207_-	DUF4428 domain-containing protein	O48432	Lactobacillus_phage	4.2e-16	26.3
WP_013355295.1\|789640_789982_-	helix-turn-helix transcriptional regulator	A0A059T669	Listeria_phage	6.9e-20	53.9
797053:797067	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1255611 : 1268389

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355467.1\|1255611_1256850_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7
WP_013355468.1\|1256940_1257912_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
WP_003643099.1\|1258097_1259045_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_128531251.1\|1259005_1259191_-	hypothetical protein	NA	NA	NA	NA
WP_003643097.1\|1259387_1260002_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_022638021.1\|1260004_1262443_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_013355469.1\|1262530_1263091_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
WP_013355470.1\|1263161_1263602_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
WP_022638020.1\|1263697_1263835_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_079111783.1\|1263992_1265369_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
WP_021356352.1\|1265352_1266045_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_013355473.1\|1266754_1267420_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_013355474.1\|1267444_1268389_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	2.0e-72	45.5

DBSCAN-SWA_5

1756668 : 1840892

Lactobacillus_phage(80.0%)

terminase,holin,tail,tRNA,portal,transposase,integrase,protease,capsid,head

attL 1782244:1782261|attR 1848050:1848067

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640716.1\|1756668_1757592_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003640717.1\|1758069_1758591_-	shikimate kinase	NA	NA	NA	NA
WP_013355605.1\|1758593_1759691_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_013355606.1\|1759693_1760992_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003645964.1\|1761005_1761533_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_013355607.1\|1761541_1762711_-	chorismate synthase	NA	NA	NA	NA
WP_013355608.1\|1762703_1764158_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1764806_1765160_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_022637968.1\|1765182_1767759_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_013355610.1\|1767773_1768079_-	hypothetical protein	NA	NA	NA	NA
WP_003640726.1\|1768068_1768368_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1768412_1769630_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1769650_1770127_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1770422_1774736_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1775229_1776939_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_033098964.1\|1776978_1778256_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1778293_1779079_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1779094_1779874_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1779993_1780557_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1780558_1781281_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1781481_1782360_-	elongation factor Ts	NA	NA	NA	NA
1782244:1782261	attL	NA	NA	NA	NA
WP_003640739.1\|1782462_1783266_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1783490_1784213_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1784501_1785500_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1785584_1785890_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_013355612.1\|1785873_1786632_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1786743_1787379_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1787435_1787672_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1787769_1788009_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1788160_1788793_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089178220.1\|1788882_1789113_-	hypothetical protein	NA	NA	NA	NA
WP_003645631.1\|1789416_1790046_+	hypothetical protein	NA	NA	NA	NA
WP_013355614.1\|1790095_1791265_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1791300_1791693_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|1791856_1792249_+	hypothetical protein	NA	NA	NA	NA
WP_003640752.1\|1792694_1793636_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_013355616.1\|1794387_1794960_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644505.1\|1795111_1796296_-	LCP family protein	NA	NA	NA	NA
WP_003645638.1\|1796276_1797068_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_003644508.1\|1799227_1800439_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_013355618.1\|1801678_1802209_-\|holin	holin	E9LUS0	Lactobacillus_phage	6.3e-36	98.8
WP_003644510.1\|1802221_1802485_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_013355619.1\|1802484_1803657_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.2e-199	89.5
WP_013355620.1\|1803668_1804028_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	5.9e-46	80.7
WP_013355621.1\|1804176_1804428_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.4e-30	98.6
WP_013355622.1\|1804420_1806967_-\|tail	tail fiber protein	A0A2K9VDD0	Lactobacillus_phage	3.0e-248	80.6
WP_013355623.1\|1806983_1809398_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	91.3
WP_013355624.1\|1809466_1811239_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	7.9e-309	91.9
WP_013355625.1\|1811313_1816344_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	53.0
WP_003644519.1\|1816375_1816567_-	hypothetical protein	NA	NA	NA	NA
WP_003644520.1\|1816605_1816980_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
WP_003641402.1\|1817056_1817710_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.5e-111	94.0
WP_013355627.1\|1817725_1818106_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	4.5e-60	92.1
WP_013355628.1\|1818105_1818513_-	hypothetical protein	A0A2P0ZLE6	Lactobacillus_phage	2.9e-65	93.8
WP_016511016.1\|1818515_1818863_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	2.0e-43	73.0
WP_013355629.1\|1818852_1819185_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	3.4e-48	91.7
WP_013355630.1\|1819257_1820490_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.5e-210	92.6
WP_013355631.1\|1820489_1821245_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.5e-123	93.2
WP_013355632.1\|1821222_1822416_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.3e-222	98.0
WP_003644528.1\|1822418_1822613_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	7.4e-27	98.4
WP_013355633.1\|1822602_1824501_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.4
WP_016511011.1\|1824510_1824966_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	3.0e-79	96.7
WP_013355635.1\|1825155_1825407_-	hypothetical protein	NA	NA	NA	NA
WP_013355636.1\|1825424_1825694_-	hypothetical protein	NA	NA	NA	NA
WP_033098962.1\|1825699_1826212_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	4.0e-80	91.0
WP_033098961.1\|1826510_1827323_-	hypothetical protein	NA	NA	NA	NA
WP_013355640.1\|1827992_1828421_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	2.9e-63	82.4
WP_013355641.1\|1828695_1829004_-	hypothetical protein	E9LUN7	Lactobacillus_phage	3.2e-48	94.1
WP_013355642.1\|1829139_1829925_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.7e-144	98.1
WP_003644548.1\|1831271_1831532_-	hypothetical protein	NA	NA	NA	NA
WP_003644549.1\|1831589_1831946_+	hypothetical protein	NA	NA	NA	NA
WP_003644550.1\|1831942_1832146_-	hypothetical protein	NA	NA	NA	NA
WP_013355646.1\|1832156_1832909_-	phage repressor protein/antirepressor Ant	E9LUT0	Lactobacillus_phage	2.2e-58	96.5
WP_003644552.1\|1832921_1833137_-	hypothetical protein	NA	NA	NA	NA
WP_003641361.1\|1833393_1833720_+	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003641360.1\|1833750_1834140_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_013355648.1\|1834202_1835081_+	hypothetical protein	A0A2H4J549	uncultured_Caudovirales_phage	3.0e-06	34.8
WP_003644554.1\|1835095_1835296_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.2e-25	97.0
WP_003644555.1\|1835616_1835847_+	hypothetical protein	NA	NA	NA	NA
WP_016510999.1\|1836016_1836205_+	hypothetical protein	E9LUS5	Lactobacillus_phage	8.2e-23	91.9
WP_003644557.1\|1836637_1836895_+	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.0e-31	76.2
WP_013355650.1\|1837078_1837414_+	hypothetical protein	NA	NA	NA	NA
WP_013355651.1\|1837581_1838745_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	1.0e-62	37.1
WP_013355652.1\|1839063_1840254_-	NUDIX hydrolase	NA	NA	NA	NA
WP_080009501.1\|1840595_1840892_-\|transposase	IS3 family transposase	NA	NA	NA	NA
1848050:1848067	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2140175 : 2179098

Oenococcus_phage(40.62%)

terminase,holin,tail,portal,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355720.1\|2140175_2141078_+	hypothetical protein	A0A0B5CYL8	Listeria_phage	3.2e-80	51.4
WP_080009510.1\|2141125_2141284_-	LysM peptidoglycan-binding domain-containing protein	A0A0P0HRN9	Lactobacillus_phage	2.4e-07	61.7
WP_013355721.1\|2142001_2142385_-\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	7.1e-13	58.8
WP_013355722.1\|2142371_2142668_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	4.9e-38	75.5
WP_013355723.1\|2142668_2143784_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.7e-46	64.2
WP_003642832.1\|2143962_2144397_-	hypothetical protein	NA	NA	NA	NA
WP_003642831.1\|2144399_2144849_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.1e-24	40.5
WP_013355724.1\|2144855_2150021_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	2.1e-144	59.4
WP_099739626.1\|2150035_2150368_-	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
WP_013355726.1\|2150411_2156243_-\|tail	tail protein	V5URV5	Oenococcus_phage	5.0e-227	40.9
WP_031275283.1\|2156258_2156522_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_003642826.1\|2156629_2157028_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_099447638.1\|2157127_2157511_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_013355729.1\|2157612_2157978_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_013355730.1\|2157977_2158529_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	2.0e-64	62.3
WP_003642822.1\|2158530_2158878_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_013355731.1\|2158877_2159210_-	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642820.1\|2159221_2159398_-	hypothetical protein	NA	NA	NA	NA
WP_003642819.1\|2159410_2160433_-	hypothetical protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_013355732.1\|2160452_2160800_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
WP_013355733.1\|2160814_2161492_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
WP_013355734.1\|2161664_2161871_-	hypothetical protein	NA	NA	NA	NA
WP_003642815.1\|2161922_2162201_-	hypothetical protein	NA	NA	NA	NA
WP_013355736.1\|2162175_2163861_-	hypothetical protein	V5US81	Oenococcus_phage	6.5e-119	58.0
WP_024971552.1\|2164007_2164304_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_013355738.1\|2164233_2165742_-\|portal	phage portal protein	V5US18	Oenococcus_phage	1.8e-136	52.0
WP_033098955.1\|2165753_2166992_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	1.9e-139	61.3
WP_013355739.1\|2166981_2167509_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	4.5e-58	75.7
WP_013355741.1\|2168076_2168853_+	hypothetical protein	NA	NA	NA	NA
WP_033098953.1\|2169143_2169353_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_013355742.1\|2169349_2169517_-	BC1881 family protein	NA	NA	NA	NA
WP_003642805.1\|2169740_2170202_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_013355743.1\|2170412_2170793_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_013355744.1\|2170789_2171308_-	hypothetical protein	O03915	Lactobacillus_phage	4.5e-55	69.1
WP_011101096.1\|2171304_2171835_-	hypothetical protein	NA	NA	NA	NA
WP_013355745.1\|2171831_2172119_-	hypothetical protein	NA	NA	NA	NA
WP_033098952.1\|2172115_2173024_-	DnaD domain protein	NA	NA	NA	NA
WP_080009503.1\|2173102_2173975_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	2.8e-73	46.8
WP_013355748.1\|2173886_2174786_-	recombinase RecT	E9LUM3	Lactobacillus_phage	6.0e-63	47.7
WP_080009504.1\|2174782_2175169_-	hypothetical protein	NA	NA	NA	NA
WP_013355750.1\|2175301_2175472_-	hypothetical protein	NA	NA	NA	NA
WP_013355751.1\|2175539_2176052_-	transcriptional regulator	D6PST4	Lactobacillus_phage	1.4e-27	43.5
WP_013355752.1\|2176119_2176425_-	hypothetical protein	NA	NA	NA	NA
WP_011101086.1\|2176765_2176966_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101085.1\|2177112_2177349_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_013355753.1\|2177386_2177701_+	hypothetical protein	NA	NA	NA	NA
WP_033099030.1\|2177757_2178012_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013355754.1\|2178157_2178661_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.7e-22	42.6
WP_013355755.1\|2178675_2179098_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	3.0e-12	35.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP030245

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP030244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection