CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041266	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R6	0 crisprs	NA	0	0	0	0
NZ_CP041269	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R4, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	0 crisprs	RT	0	0	1	0
NZ_CP041261	Enterococcus faecium strain VVEswe-R chromosome, complete genome	1 crisprs	DEDDh,cas2,DinG,cas3,RT,csa3,cas14j	0	0	12	1
NZ_CP041267	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R7	0 crisprs	NA	0	0	0	0
NZ_CP041268	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R8	0 crisprs	NA	0	0	0	0
NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	2 crisprs	cas14j	1	3	2	0
NZ_CP041265	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R5, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	1 crisprs	RT,c2c10_CAS-V-U3,cas14j	0	2	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8648 : 34562

Streptococcus_phage(61.9%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_146419990.1\|8648_9302_-	VanR-ABDEGLN family response regulator transcription factor	W8CYM9	Bacillus_phage	7.5e-31	35.8
WP_001015311.1\|9343_10024_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_106913803.1\|11070_11166_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_002311817.1\|11468_11714_-	hypothetical protein	NA	NA	NA	NA
WP_002328852.1\|12200_12881_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	99.1
WP_000527318.1\|13175_13385_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	1.4e-31	98.6
WP_000301765.1\|13401_13674_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_001284311.1\|13675_14539_+	toxin zeta	NA	NA	NA	NA
WP_001038796.1\|14801_15539_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	2.4e-134	99.6
WP_031929417.1\|15663_15747_-	23S rRNA methyltransferase attenuator leader peptide ErmL	NA	NA	NA	NA
WP_001096887.1\|16288_17083_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_002297218.1\|17671_18967_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_002324522.1\|19067_19976_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002347175.1\|19978_20227_-	hypothetical protein	A0A1B0RXL7	Streptococcus_phage	9.5e-27	96.1
WP_060810973.1\|20223_21132_-	aminoglycoside 6-adenylyltransferase	E4ZFP8	Streptococcus_phage	1.1e-176	99.7
WP_060810974.1\|21164_21902_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	3.8e-140	99.6
WP_002303392.1\|21882_22752_-	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	5.7e-151	90.3
WP_002303393.1\|22766_22991_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001015311.1\|25185_25866_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000357244.1\|26114_26633_+	YfbU family protein	NA	NA	NA	NA
WP_000774078.1\|26639_27152_+	hypothetical protein	NA	NA	NA	NA
WP_002288897.1\|27422_28046_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-13	30.1
WP_001015311.1\|28141_28822_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000599739.1\|29007_29613_+	cell filamentation protein	NA	NA	NA	NA
WP_002303206.1\|29628_30201_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_073120187.1\|30673_31246_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_086953888.1\|31346_32509_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002322130.1\|32549_32804_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.1e-09	50.0
WP_000199136.1\|32914_33169_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_001196543.1\|33361_33637_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|33608_34562_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041264

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

32548 : 63474

Streptococcus_phage(53.85%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297404.1\|32548_33799_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_060797393.1\|34208_36581_+	hypothetical protein	B5SP25	Lactococcus_phage	2.9e-11	29.2
WP_060809967.1\|36641_38102_+	toprim domain-containing protein	NA	NA	NA	NA
WP_002305772.1\|38112_40317_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	6.1e-117	50.7
WP_002303309.1\|40332_40482_+	hypothetical protein	NA	NA	NA	NA
WP_002303311.1\|40557_41151_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_002303312.1\|41163_42063_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002303313.1\|42065_42551_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	5.8e-44	59.3
WP_002316074.1\|42691_42895_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295623.1\|42969_43230_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002347218.1\|43666_43873_+	hypothetical protein	NA	NA	NA	NA
WP_002296238.1\|43872_44124_+	hypothetical protein	NA	NA	NA	NA
WP_002300851.1\|44138_44576_+	hypothetical protein	NA	NA	NA	NA
WP_002303117.1\|44568_45276_+	hypothetical protein	NA	NA	NA	NA
WP_001120991.1\|45656_45836_+	hypothetical protein	NA	NA	NA	NA
WP_000388479.1\|45966_46236_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000588503.1\|46228_46486_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002347142.1\|46944_47100_+	hypothetical protein	NA	NA	NA	NA
WP_001809248.1\|47123_47948_+	hypothetical protein	NA	NA	NA	NA
WP_001261742.1\|48112_48727_-	recombinase family protein	M9Q1K0	Clostridium_phage	3.8e-16	30.9
WP_002303116.1\|48964_49387_+	hypothetical protein	NA	NA	NA	NA
WP_002299573.1\|49396_49600_+	hypothetical protein	NA	NA	NA	NA
WP_002299575.1\|49811_50396_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.9e-43	51.7
WP_060811353.1\|51539_53402_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.3e-37	27.6
WP_060811354.1\|53483_54779_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	5.8e-91	42.4
WP_002303114.1\|54771_55122_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|55385_56681_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_060475447.1\|56706_57381_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-116	99.0
WP_002347151.1\|57434_57653_-	hypothetical protein	NA	NA	NA	NA
WP_002303415.1\|57700_57973_-	hypothetical protein	NA	NA	NA	NA
WP_002303414.1\|57962_58172_-	hypothetical protein	NA	NA	NA	NA
WP_002349053.1\|58302_58623_-	hypothetical protein	NA	NA	NA	NA
WP_002303412.1\|58885_59194_-	hypothetical protein	NA	NA	NA	NA
WP_002347150.1\|59367_59736_-	hypothetical protein	NA	NA	NA	NA
WP_002347149.1\|59849_60665_-	replication initiation protein	NA	NA	NA	NA
WP_001015311.1\|60748_61429_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000026576.1\|61800_62091_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|62295_63474_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP041262

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041262_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041262_1

431-558

Orphan

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP041262_1

>merge|NZ_CP041262|1|431-558|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP041262|1|1|431-558|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041262.2\|WP_002311524.1\|3674_3908_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041262.2\|WP_060805017.1\|7799_8561_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041262.2\|WP_096157791.1\|7031_7784_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP041262.2\|WP_002311521.1\|2832_3174_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP041262.2\|WP_002311523.1\|3192_3483_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041262.2\|WP_002313095.1\|4313_4985_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP041262.2\|WP_002302867.1\|8573_8834_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041262.2\|WP_002305225.1\|8830_10921_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|375475
NZ_CP041262.2\|WP_060805018.1\|5037_7017_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP041262.2\|WP_002322486.1\|1881_2214_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP041262.2\|WP_002305225.1\|8830_10921_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|375475	pfam17998, AgI_II_C2, Cell surface antigen I/II C2 terminal domain. This is the second domain (C2) located in the C-terminal region found in antigen I/II type adhesin protein AspA from S. pyogenes. Together with C3, these two domains form an elongated structure, each domain adopts the DEv-IgG fold. Similar to the classical IgG folds, it is comprised of two major antiparallel beta-sheets, designated ABED and CFG. For the C2-domain, there are two additional strands on the CFG sheet. Furthermore, sheets ABED and CFG are interconnected by several cross-connecting loops and one alpha-helix (DH1). The side chains of D982 and N996 in the C2-domain are involved in hydrogen bonding with the side chains of R1264 and N1295 in the C3 domain. Main chain hydrogen bonding can also be observed between S992 in C2 and N1189/G1191 in C3, furthermore stabilizing the interaction between the domains. The C2 domain contains one bound metal ion, modeled as Ca2+, and both the C2- and C3-domains are stabilized by conserved isopeptide bonds, which connect the beta-sheets of the central DEv-IgG motifs.Other members of this family include Major cell-surface adhesin PAc from Streptococcus mutans and SspB from Streptococcus gordonii.	1.12097e-15
NZ_CP041262.2\|WP_060805018.1\|5037_7017_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.35074e-30
NZ_CP041262.2\|WP_096157791.1\|7031_7784_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.30847e-58
NZ_CP041262.2\|WP_002311521.1\|2832_3174_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	8.60138e-49
NZ_CP041262.2\|WP_002313095.1\|4313_4985_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	4.30589e-43

>NZ_CP041262.2|WP_002322486.1|1881_2214_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP041262.2|WP_002311521.1|2832_3174_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALNEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP041262.2|WP_002311523.1|3192_3483_+|hypothetical-protein
MKFFEVKSPYYYALIAAKNEEECAELYEQVVTDIENREEFIRCLHELNRNEAIQEDAKKISEETLQPIGMEEATKDIFTIIDEQKSCVLSIDSTLV
>NZ_CP041262.2|WP_002311524.1|3674_3908_+|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWREHNGIKDLKPARPVIRRKKLKK
>NZ_CP041262.2|WP_002313095.1|4313_4985_+|class-A-sortase
MKKWLFGFLGVALIVFCSVFGYVSYQKHEGEVFKQNIEKKMPIDQINEHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQAFAQIQIPALGLTLPIFKGANQYTLSLGAATYFYEDAEMRKGNYVLAGHNMEIPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP041262.2|WP_060805018.1|5037_7017_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDVDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQALPREDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLESAEFAAKNAEGKYYGGLVDTDKNGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP041262.2|WP_096157791.1|7031_7784_+|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTILSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLEPNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKKQKLSWKWLLGSTVFLSVMIIGSLFVYKKKK
>NZ_CP041262.2|WP_060805017.1|7799_8561_+|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGQKLEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKDRVKKLFSDQLKLVSNGKTKTIDQQTGVFEFSIEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNGEFLKDVWIYPKSEASQPKEEVKKIVSTGVKKNFFENCWDFVTHLFSRD
>NZ_CP041262.2|WP_002302867.1|8573_8834_+|hypothetical-protein
MKLIKLLLFNFSCLTAVFLYCGLLFSKLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG
>NZ_CP041262.2|WP_002305225.1|8830_10921_+|isopeptide-forming-domain-containing-fimbrial-protein
MNFKHSWTRRLKYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKNIRYPSFQKEYGETNLVLEGVTTNTKVNIDYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIVYHSTQMNVQLVATYEDGSPVQFSGDTFISFNSLNPAGGKSTDLKGEYAHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKLTQADNDFNNLHDKLGDPKFGQGTVSFKISEANPTFVIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKVNRLGVDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSGEVTYDKTKHQVKYAAKADTLKNRMKYNGETYELVINVKVNELANQNSVAKNQGTSIINKVEKDTNIITVYFPKIPVKEVQQNGKDVNGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDAASDHYKQFSIQDPIEARLTYKEGSAQVIDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPLQSEKNIDNQAVVAVDNVSNKTNVVTIGVDPNLPQVIVPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041262_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041262_2

161103-161213

Orphan

Consensus_repeat	Method
ACAACTCATCAGTCCTTATTGACAAAGAGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041262_2

>merge|NZ_CP041262|2|161103-161213|CRISPRCasFinder
ACAACTCATCAGTCCTTATTGACAAAGAGCCAAAAATCTGAGCCAGAATGAGGTTCATTCTGACCCAGATTTGATTTTGTACAACCCATCAGTCCTTATTGACAAAGAGCC

>NZ_CP041262|2|2|161103-161213|CRISPRCasFinder
ACAACTCATCAGTCCTTATTGACAAAGAGCC	AAAAATCTGAGCCAGAATGAGGTTCATTCTGACCCAGATTTGATTTTGT
ACAACCCATCAGTCCTTATTGACAAAGAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041262.2\|WP_002299921.1\|161548_161821_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP041262.2\|WP_002299926.1\|164192_165008_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP041262.2\|WP_002299919.1\|161229_161559_-\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	unknown	unknown	gnl\|CDD\|367091
NZ_CP041262.2\|WP_010729384.1\|170060_171260_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP041262.2\|WP_002298085.1\|171389_172766_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP041262.2\|WP_002299925.1\|163052_164177_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226359
NZ_CP041262.2\|WP_002304880.1\|149507_151421_-\|beta-N-acetylhexosaminidase	unknown	unknown	gnl\|CDD\|119335
NZ_CP041262.2\|WP_002299928.1\|165954_167244_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270451
NZ_CP041262.2\|WP_014748799.1\|164997_165888_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP041262.2\|WP_002289655.1\|153608_154520_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP041262.2\|WP_002302980.1\|157250_157979_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP041262.2\|WP_010729380.1\|152112_153585_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|378792
NZ_CP041262.2\|WP_002304874.1\|154531_155470_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
NZ_CP041262.2\|WP_002288608.1\|144740_146402_-\|hyaluronate-lyase	unknown	unknown	gnl\|CDD\|369423
NZ_CP041262.2\|WP_010729383.1\|168592_170071_-\|IS1182-like-element-ISEfa7-family-transposase	unknown	unknown	gnl\|CDD\|372705
NZ_CP041262.2\|WP_002299923.1\|162271_163075_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP041262.2\|WP_060799438.1\|158361_159636_-\|ISL3-like-element-IS1476-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP041262.2\|WP_002304878.1\|151450_152062_-\|DUF624-domain-containing-protein	unknown	unknown	gnl\|CDD\|227865
NZ_CP041262.2\|WP_002305865.1\|146398_149380_-\|glycoside-hydrolase-family-42	unknown	unknown	gnl\|CDD\|236673
NZ_CP041262.2\|WP_002340467.1\|155698_157273_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|225519

Protein	Function_ID	Function_description	E-value
NZ_CP041262.2\|WP_002299921.1\|161548_161821_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	1.707e-09
NZ_CP041262.2\|WP_002299926.1\|164192_165008_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	5.58481e-60
NZ_CP041262.2\|WP_002299919.1\|161229_161559_-\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	gnl\|CDD\|367091	pfam02452, PemK_toxin, PemK-like, MazF-like toxin of type II toxin-antitoxin system. PemK is a growth inhibitor in E. coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. This family represents the toxin molecule of a typical bacterial toxin-antitoxin system pairing. The family includes a number of different toxins, such as MazF, Kid, PemK, ChpA, ChpB and ChpAK.	4.93358e-05
NZ_CP041262.2\|WP_010729384.1\|170060_171260_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	2.01754e-94
NZ_CP041262.2\|WP_002298085.1\|171389_172766_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	2.85445e-08
NZ_CP041262.2\|WP_002299925.1\|163052_164177_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226359	COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].	3.79026e-145
NZ_CP041262.2\|WP_002304880.1\|149507_151421_-\|beta-N-acetylhexosaminidase	gnl\|CDD\|119335	cd06565, GH20_GcnA-like, Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.	2.01164e-107
NZ_CP041262.2\|WP_002299928.1\|165954_167244_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.58433e-91
NZ_CP041262.2\|WP_014748799.1\|164997_165888_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	7.41919e-68
NZ_CP041262.2\|WP_002289655.1\|153608_154520_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	8.97107e-67
NZ_CP041262.2\|WP_002302980.1\|157250_157979_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.70971e-30
NZ_CP041262.2\|WP_010729380.1\|152112_153585_-\|extracellular-solute-binding-protein	gnl\|CDD\|378792	pfam12010, DUF3502, Domain of unknown function (DUF3502). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 140 amino acids in length. This domain is found associated with pfam01547.	1.92358e-39
NZ_CP041262.2\|WP_002304874.1\|154531_155470_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	4.81909e-137
NZ_CP041262.2\|WP_002288608.1\|144740_146402_-\|hyaluronate-lyase	gnl\|CDD\|369423	pfam07555, NAGidase, beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.	1.97685e-130
NZ_CP041262.2\|WP_010729383.1\|168592_170071_-\|IS1182-like-element-ISEfa7-family-transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	6.01396e-33
NZ_CP041262.2\|WP_002299923.1\|162271_163075_-\|metallophosphoesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	2.04936e-28
NZ_CP041262.2\|WP_060799438.1\|158361_159636_-\|ISL3-like-element-IS1476-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.18589e-76
NZ_CP041262.2\|WP_002304878.1\|151450_152062_-\|DUF624-domain-containing-protein	gnl\|CDD\|227865	COG5578, COG5578, Predicted integral membrane protein [Function unknown].	1.7022e-07
NZ_CP041262.2\|WP_002305865.1\|146398_149380_-\|glycoside-hydrolase-family-42	gnl\|CDD\|236673	PRK10340, ebgA, cryptic beta-D-galactosidase subunit alpha; Reviewed.	0
NZ_CP041262.2\|WP_002340467.1\|155698_157273_+\|histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	1.26773e-32

>NZ_CP041262.2|WP_060799438.1|158361_159636_-|ISL3-like-element-IS1476-family-transposase
MDNHTRKLLGLTDKHLFFDEEWLIEKEYKGVQAQFIKGKLDDSPSYCEHCRSVRIIRNGSYTTRTQILKVKEKLTILELKRTRFLCHDCGRTFSAKTDLVDEHHQLTKELKQAILMELYENQSRKLIAKKYFVSDGTVTRILREATKHYQSRMNFLPTVLCMDEFKSMKSVSGSMSFICVDGTTHQLFTILEDRRLYKLTQYFLHFPRKARLKVKYLVMDMNASYCQLLKTVFPNAEIVTDRFHIVQHINRSFNQLRVQIMNRFRTSHSENQKKYRRLKRYWKLLLKDSTTWEPLKRHYHRLFKRPISQTEIVDELLSYNEELRTAYHFCQLLRYYFVKRGTEGFQETLKTISSTLPQSFKKKFTIFHRYQSGISNAFKVSHSNGVTEGLNNKIKLIKRIAFGYRNFYNFRARIYLQQGLIFEN
>NZ_CP041262.2|WP_002302980.1|157250_157979_+|AraC-family-transcriptional-regulator
MLRIAIVDDDCTIVEGIRHYLLKKVPDIIIDHCYTDGDEAFKNLQNQRFDLLITDITMGKISGLELIESLQQTSNRYFTSIVISAHQNFQYAKKGIDLSIKSYITKPIDFPYLVKLVQEEKMRKSAANQNSLTDDSFNESIQQVIDYVQNNYSEKLTLKDVATQFHYHPAYLGRAFKKETGYSFHDYLLDFRIKRASALLKDTFLSIDEISQKVGIDHVSYFSVLFKKTTGHSPSNYRKKLL
>NZ_CP041262.2|WP_002340467.1|155698_157273_+|histidine-kinase
MKNDLSKVIMRFTYILIFFITLLACFTLFFSYINVIEKEKNQNLQNIQQITHYMETYNRILSGIVTEIYQNYDFQENLNDYYLSSPAEYMEDILSKDRSPTYLVDNLKKLVQDDEVKNISISLDYEKYLSAYAPTKNEKISFIRSLSFISEDMPDATLILDVSINALKKSLFPTHYNYSLSNGIDSVNLSEDISPSKWKKTQQIAIGNHTLQVYENPNYSSQTLLGLAIMIFLLMSLFILAIHQLLNRSFRNYIQQYQEIITSLNHSSTGDYKSINIENKVGDLKEIAMHINQFYLDNATYQKTLYENNWLKQEAKYAALQYQIEPHFLFNNLEFIRMTAILNDDEEISDSIYLLSKLYRNNTYQPDIIDLKEELINIDLSLQLHQRRYRHNFDYQLIDHIDQLMLPKLSLQPFVENYIKHGFDSSKKENRLTVYATETTNHYVLKIVENGKGMDQDKLEHIQQKLNDDIPYSENIGISNSFRRIKHLYPGDTRFVIESQLHVGTTITIKIQKGGNMHVENCNC
>NZ_CP041262.2|WP_002304874.1|154531_155470_-|sugar-ABC-transporter-permease
MKLKKGLLGNLKKNRALFIMLLPGALWLFIFCYIPMFGVVIAFKDFRISSRGFFTSLFNSPWVGWENFKYLFASQDAWIITRNTVVYNVVGILLSTFCTVSLAIILSQMANKRLLKKMQTFMIFPNFLSWVVISYFVYAFLSTDKGLINILLSNFGVEPINWYSEPKYWPFIIVFTSLWKGVGYGSIIYYASIMGIDTSYYEAALVDGASKWQQIRNVVLPHLRSIIVIMLILSVGSIFRADFGLFYQLPRNSGALYDVTNVLDTYVYRGLMNSGDIGMSTAAGLYQSSVGFVLILITNKIVNKLDPSSALF
>NZ_CP041262.2|WP_002289655.1|153608_154520_-|carbohydrate-ABC-transporter-permease
MISKLKRQMYFSLPVERFFTILLILFTLSCIFPFIFVIVISLTDEKALQLNGYELLPAQWSTDAYQYLIQDGGQLLRSLGVTIMITVIGTLITVFMTGTYAYVLSRASFPYRKFFTFYLFFTMLFAGGMVPSYLVMTKMLGLKNTIWALILPLAFSPYNVIILRTFFKKSIPESIIESAKMDGCSEFRVFFQIVLPLAIPGVATIGLFSSLGYWNDWFNALLYIDTNKLIPLQYLLMKIQNSMEFLANNNDITLAQQQAIQNSLPQESTRMAMVVVATLPIAIVYPFFQKYFVQGLTIGGVKE
>NZ_CP041262.2|WP_010729380.1|152112_153585_-|extracellular-solute-binding-protein
MKKNMQKYLIGGASVLTLGLLGACGSSNGEANNETGTTKVTWYQVGEEPKDFDEVMTKVNEKLKEEINVELDMRLIPDGDYQQKLGVMINSGEEYDICFVNGTDYVNYGNKGAFISLNDHLDKELKDYAAELNEGFIEGGAINGETYGLPVNNDIATTEYWTFNKDLVDQYQLDVENVEGVETLAPVLEKFAEKNTDTNITPIGMTRTSVCIPYDNIIGGGVPLAVAFEGDTQTVVNTYETPEMMTYLKAMHEFYKKGYILKDAATVTTDPFRIDSKNWFLGRNSSGYQPLAQKKLEALAGHGLILKPAGKAFKTTGFARVAMHAVSASSKHPEAALKLLNYVNTNQEVADLMVYGIEGKHYDRNEDGSITLTNSDDYYQGAWALVNTYLVSKTSPITEESKKLEEESKKFQNEAPMSPILGFSFDASDFRTEIASVQNIVSQYEVLLSSGTVDPEQYVPELLEKLEKAGLDKIQASAQEQYDEWRKSNK
>NZ_CP041262.2|WP_002304878.1|151450_152062_-|DUF624-domain-containing-protein
MNENKWTKGFNWVFQLLLLNFTYFILICLGFGILGFFPATIALIAGVVNRKKYGLQESVKFMSKIYKKNFVRYNLYCWSATLLLAGNITTIWLCWQQSAPLFYLLSTLLSVITLFLVFAMLNWVVIKSLGLWMMGDRLIDYLLFTATMLPTVVMQGLVLGIYFRILMILPVIFLFGGTAVTVILISKLTERALAKLPCQIQSH
>NZ_CP041262.2|WP_002304880.1|149507_151421_-|beta-N-acetylhexosaminidase
MKLTDKQVANIAFIQQLEIPLTQKDEEQIDLIFTDTKANVRQIKITKNEQQRICLSYSHEDLLYRGLFICLPRFLAQGGEMPYIEETSIIETSYSLDASRNGVMNKETLKKFISYLALMGYNTLYIYTEDTYEVEDLPYFGYLRGAYTKEEVNEIVEFASGFGIEVVPSIQTLAHLTQFLKWYAQQELMDDQNTLLIGEEKVYAAIEKMIIACKEMYQTERIHLGMDEAYQAGLGRYLSLYGYCDRTTLMIQHMDRVLSIVDKYKMKPMIWSDFIYKLLDETGKDRYYNPDFKLKALAAKGLPAGLTYVHWDYGSDEVSSYEKVIDNHLKFCDIDHYVLASGAHIWGRLAPNHGKTEAIVSAAVKASKNKGVRSVMLTTWGDEGQETEHWHSLIGALKLADYVYSEEEWNDFEEIYDRLLGTGSYQLMSELRYFDEVDTITNNNLQMASVSKLLLWQDPLVGIYDFHVAAHNKIATRTIGTYYHELAQKLDMNKNWNPKQPILTTIRQRYILLAEILAQKAELGIYLQHCCLVEDLAGLMELANRCEALANRVNELASIHEIIWYQTYKTYGWEVLEQRYAALAHRLKTVARRIKNHLQGQDALEELLEERLPFCQYQVPLEISGFNYRQSSVSGYN
>NZ_CP041262.2|WP_002305865.1|146398_149380_-|glycoside-hydrolase-family-42
MLSDYYQNLSVISVNTEPLRNYYIPYASKEEAKQELEREKTSQFIDLNGTWDFQYYPSVQQLPENFFQEAFTESYDRISVPGVWQTEGFDLPQYINVSYPIPFDPPYVPNDTPCGVYRRQFQIEQTDARFYLNLEGADSNCFVWINRNFVGYDQVSHSTSEFDVTKYLQVGVNEIQILVMKWCDGTYFEDQDKWRMSGLFRPVYLLQRPTMHLTSYQLRTLTDPKKGSGTLMVSFQRFTPIEVSLPISYELFHPDGRLIAKGECYSEQQINLDVEDCLFWTAETPKLYTLLLTCNGEYFKEKVGFRALTIKNRKLLLNGTPIKLYGVNYHDVNQQGTPVMTREQLRADLLLMKKLNVNTVRTAHYPKSPDFYELADEIGLYVINEADLECHGVVNLYDTEANYQLIANDPTFEKPIMDRVIRSILPYQNRSSIIMWSMGNESGYGVNFEKAQALARKLDDSRLIHNERSIEPVIDQVNDFSNLDVISQMYPPLEDVHRHCQRSDTEKPFFMCEYSHAMGNGPGDLKTYFDLIQQYDSFLGGCVWEWTDHAINRGTLETPSYLYGGDFGEKYHDGNFCVDGLLTPDRQLTVGALEYRNIHSPIQLIAVDEELQEVTLSNITAFTAGSAFNLSLEWYIDGKKTVYEVMNPFILEPGKSCSLPITVPTTIHGAHTVAVSLSVYKNDELYGQQQLFLKKEKMRLPRTAHHNDAPQISVKGTELIIKGESFIYIYQLAKAAFTSVKINQKELLERPTQFSIWRAPTDNDRNLVNKWKAAGYAEMSLEIRKKDWKFVDDHLLIETSYRGVIPGLQPIFTMHIQLKINGAGVINQKVSVEKNPIFPDFPRFGMDWPLNDTFSKVSYCGYGPYESYPDKHYAAMFGIYEMEIEEFDQPYIKPQEYGNRWQCDWVSIKNHQGSTMTVYGNSNFSALPYSQAQLTEKSHHYELIKENRTWFNLSYKQNGIGSHSCGPYLEDRFRFMEDTFDWNIVITFKGENR
>NZ_CP041262.2|WP_002288608.1|144740_146402_-|hyaluronate-lyase
MKETKINQVKKKLSRYQEVVYRNHCLKWSKNKLNVRFNGLFYRFEQLEEVWKPVTNFQSCPVQLINDPKETYDLCITHLYNQHLKNDGFYLKVTNDNQLTIESANLRGFQYAMEALLESFFSVGDQLLLPELILKHEPSVKIRGIIEGFYGIPWTHEMRLSLFSYMKDNQLNTFMYAPKDDELLRKKWRELYDAQELDKFKELLSAAEASNIDFWYLISPGNDIDITCEEDIQVLLKKLEQLIELGVFQFGLLMDDIDYQLKGAAKRRFREPAFAHAYLVNRVEEYLSTRLSNHELVICPTEYDNRHGSRYLATLSQEIPEQLPFFWTGPSTLAASISTEELQEMASVYQRPMLIWDNIPVNDYLEDKELLFMSPYENRTPNLSKERYQVTGVVSNPMAQLEASKFTINSMANYLWNCERFDPLETWTSVVEKVVGSKLQPAYLTLTNAFPNHYTSSLLSDEELLLAKDPEWVTKEMAALVQAVKWIQQEQHTSRLRTELEPWLQAITESWTFWQEWQLKKDPKEAEEWLAKKKTHRIGRDLVTAHLEQIIKS
>NZ_CP041262.2|WP_002299919.1|161229_161559_-|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin
MNTNDIATVYVAFTAAEGGKRRPVYILKNGLDTISFLSITSKYHTKSDKIKLKYVEIRDWKQAGLKKESWIDVGTLNELPKNNKKVKWKKIGELSPSDLQRLEERMEEL
>NZ_CP041262.2|WP_002299921.1|161548_161821_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MEKMAKLQISMDEKLKNEAESIIDELGMSPKTAVTVFYKQIVEQGKIPFSIELSEKSKRIHNIQRLAEKLPVQKLDTDEKIEEWFNEDEY
>NZ_CP041262.2|WP_002299923.1|162271_163075_-|metallophosphoesterase
MRFLHLSDIHFRENYQTNLFTAELFPTIKNPQLALEKLLQELSLTVYDFILLTGDLVHEGGISDYQVLRKMLDQYFPTTPYYFCRGNHDRRSVFFEGMSVESNETGEYIHCTNQNGLRIISLDSAQDTQHEGKISIGQMIQLQEWLGTPAEKGTILLVHHPLSWEDPSIVTEVPEGFAELIAESDILGIFVGHIHQGSSAEFAGKKQFMAESLSFGVDEYPDYSLFTNRTGFTSGSLIDGKIFTYQHYLTPHQIEIGRMKKPITGNH
>NZ_CP041262.2|WP_002299925.1|163052_164177_-|ABC-transporter-ATP-binding-protein
MGETLELRNIGKKYGEHTILKEIDLAVAAGERIVLLGPSGSGKSTLLRMIAGLEKITSGELFLGTQLANKLPCGEREIAMVFQNYALYPHMTVKENIIFALRANKIKTADIQHRLEEALKMLGLTPYQDRLPKDLSGGQRQRVALARAVVKRSNYFLLDEPLSNLDVRLRLDARKELVKIHQRYKQTFVYVTHDQIEAMTLADRIVLLNEGRIQMIDTPKNVYTKPKNTFTANFIGSPGMNIMPVTYDQGTLKVASQFLTLNPAWQKQLLQVSGSLYLGIRPEHVTFSKETSDLHGQVKYRELLGQSYAYTVKVDGIEMIVLNEKPTWQIGDAVNLRIEPERMHFFDYQTQENLGYPDYFIEERGNSHALFASL
>NZ_CP041262.2|WP_002299926.1|164192_165008_-|carbohydrate-ABC-transporter-permease
MKIKRWLPHLLFMFIIIIIIYPLLFIMANSFKPLKDAYQTITSLIPQPFTLENFCYLFENLPIIKITRNTFFIATIITVVKLGVAFFAAYSFTYCRIKGKKIWYFIIIGTMFIPFTVAMIPNYLLIAKLNLIDTTWGVIIPQFADAMGIFLLTQTMREIPVSLLDVAALDNIKQTTVMSKIVFPLTRHAITSTGIWFFITSWNEYVWPVLILRTVDNYTLPLAMQTYISSEGGTNFTVAMAISLITMFVPLVLYAIFQKYIIGTFVSAGIK
>NZ_CP041262.2|WP_014748799.1|164997_165888_-|sugar-ABC-transporter-permease
MRRLSEMKRYVGYLYLAPAIILLGVFVFYPLIYTIYLSFFDWNMVAPTKEFVGFANYVKVLTDPVFHKVLKNTLSYTVLFVLLSCVFPYITSFLLGIVIEKGQNLYKPLFFIPAVISLVVAGMVFTWILNPVSGPIAVLLGNFGLRLPMWMNLQGWVIAVIAGITAWKVFGYNFIVIFAAIVGIDQEMIEAAKLDRVPIWRIFFTIVLPMSSSTGLYLLVMTIVQGLQYVFTPIKIITRGGPNNGSANVIYYAYQKAFEMYKVGESSAISVLTLLIFAVFLGVIFKFVEKGVYYEN
>NZ_CP041262.2|WP_002299928.1|165954_167244_-|ABC-transporter-substrate-binding-protein
MLKKNLVIGVVSVLSVISLAACGSGNTKTTKKSEGRVTIEYWHVNADTLGGKTVNELVDKYNQSQDKVKVVAKYNPDMYKGLMQNLQASVASKEIPDVVQVGWAFKDYFAENFKYTNPQSLVEEVDPDNADYFKDHFLDNIMALSEKDGKQVGIPYSISNPVLYLNQDILKAAGLDENGPKTWEEVQTFSKIIKEKTGKYGVYIQEPADNWAQQAILESNGASVIKDGKATFASKDGIAAYELYQRMVKDQTALHTTWEQGVQSFIDGNVAMVYTTIAQRDNIQKNSTFTAKAVESPSWEGKKVKLPAGGAMLAVTSQTDKKKEATWDFLKYLYSVESLAKWTEGTGYLPPRKDVADAQNGLKAFLAENQMMIPAIDQMDKMVSWSSFPGDAGLEAEQKLLDMRDKILSGNSVNETMKATQKEINELLK
>NZ_CP041262.2|WP_010729383.1|168592_170071_-|IS1182-like-element-ISEfa7-family-transposase
MMSKNNTNGRNQFAMLTIDDLVPQDHLVRKIDAALDFEFIYPIVEATYSDLGRPSIDPVILIKLVFIQYLFGIRSMRQTIKEVDTNVAYRWFLGYSFEEKIPHFSTFGKNYVRRFRETTVFEDIFAYILEQAVKAGFVTEDNLYLDSTHIKANANKHKFTKEMTHDEAKAYQDELEDEINRQRIEAGKRPFTLDLEKEVKLKERKISKADPESGYYVKGEREKQFAYSAHTSCDDNGFILSTIITPGNIHDSQVAFQLVKQSKRLFPEINCVVADAGYKTPKFVHFLTHLNLRPCLPYSRPKGKKGLLSKNEFLYDEYFDCYICPQDQMLAFSTVTREGYREYKSNPKECVNCPLLNQCTISKNHQRVITRHVWGDLMDEVEHLRLTDLNKSIYKKRKQTIERIFADAKEKHGMRWTKYRGLEKVATHTMLVFAAMNLKKLATWLWKGKEPLFFCSKIRNEVDKKLFQARVTSLEQLLSTVWLSVRTAFFVG
>NZ_CP041262.2|WP_010729384.1|170060_171260_-|IS256-family-transposase
MARKKRNPDAEKLAESILNTYQPESVEDMQDVLKDVFGPLFEKMLQGELNNHLGYDAHSKEPKKHDNRRNGYGNKTLKTSFGKVNIDVPRDREASFEPELIPNRKRDVSDIEGKVLSMYARGMSQCDIAATVEDIYGFDISHEMISDITDAVLPELEEWQARPLAKCYAFLFVDCMYVTLRENYEAKEYAVYTILGYDLKGNKEILGLWLNQTESKNRWMQVFDELKVRGVEDVFFISMDGVSGLKEGAKAIFPSVIVQRCIVHLVRNALRYLPSKDYKEVCRDMKKFYSASSLNAAHAAFDSFQNRWSHYSGAVDVCKRNFSHVEQLFDYGSAIRKIMYTTNAVESIHSSFRKVTKKGVFSNENAQTVDKVHFMDDVYSLFFYNRFMKTNARSDSYDV
>NZ_CP041262.2|WP_002298085.1|171389_172766_-|ABC-transporter-permease
MIKNAFAYVTRKSLKSLIIILVILSMSTLSLISLSIKDATDRASKETFANITNSFSMEINRQVNPGTPRGGGNVKGEDIKKISQTDSIDSYVKRINSVADLVDYDIIETQETLANQSPERAKNFKRTVMLTGVNDSTKETKFVSEAYKLVEGKHLENEDKNKILMHKDLAEKNNLKVGDKIKIKSNLFDADNEKGADETVEVEIKGLFDGHNSGGVSAAQELYENTLITDIHTAAKVYGNTEDTAVYQDATFFVKGDKNLDSVIKDLGKLDINWREYNLIKSSSNYPALQQSISGIYSISNKLFFGSLIFAGVVVSLLLFLWMNARKKEIAVLLSLGISKLEIFGQFLIEMVFISIPAFVGSYFLAQYTADKLGNNILNKVTGDIAKQIAKQSASSQLGGGAEAEGFNKTLSSLDINVLPKFMIYVVIFMSLVLLVSLIISSFNILRRNPKELLIDNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041261.2	972942-972990	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041261.2	1078924-1078972	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041261.2	1904901-1904949	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041261.2	2091283-2091331	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041261.2	2221199-2221247	1.0

1. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to position: 972942-972990, mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

2. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to position: 1078924-1078972, mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

3. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to position: 1904901-1904949, mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

4. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to position: 2091283-2091331, mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

5. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to position: 2221199-2221247, mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP041262_1	1.2\|517\|19\|NZ_CP041262\|CRISPRCasFinder	517-535	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	35213-35261	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	123652-123700	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	66828-66876	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	104985-105033	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	78680-78728	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	283832-283880	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	137862-137910	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	165282-165330	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	50091-50139	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	113793-113841	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	86194-86242	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	124351-124399	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	198687-198735	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	166839-166887	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	63601-63649	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	72020-72068	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	106157-106205	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	115954-116002	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	134655-134703	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	163339-163387	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	197227-197275	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	136841-136889	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	42427-42475	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	19022-19070	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	93441-93489	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	46767-46815	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	131598-131646	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	186283-186331	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	161134-161182	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	246309-246357	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	150540-150588	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	190785-190833	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	206029-206077	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	146273-146321	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	174960-175008	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	234671-234719	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	9125-9173	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	36545-36593	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	134941-134989	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	143830-143878	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	143830-143878	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	128577-128625	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	258724-258772	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	143830-143878	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	142348-142396	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	160403-160451	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	128548-128596	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP011831	Enterococcus faecium strain UW8175 plasmid unnamed3, complete sequence	4973-5021	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	161422-161470	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	69747-69795	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040708	Enterococcus faecium strain HOU503 plasmid p2	31122-31170	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	161143-161191	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135312	Enterococcus faecium isolate E7240 plasmid 6	5002-5050	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	67597-67645	0	1.0
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	173552-173600	0	1.0
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	76478-76526	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	10393-10441	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	132639-132687	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	98599-98647	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	172149-172197	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	182285-182333	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	182285-182333	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	182285-182333	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	180738-180786	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_022051	Listeria monocytogenes strain J1926 plasmid, complete sequence	52552-52600	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	CP044431	Listeria monocytogenes strain FDA00006667 plasmid pCFSAN038814, complete sequence	23238-23286	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_022046	Listeria monocytogenes strain J1776 plasmid, complete sequence	52489-52537	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_022047	Listeria monocytogenes strain J1817 plasmid, complete sequence	1480-1528	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP053631	Listeria monocytogenes strain OB040119 plasmid pOB040119, complete sequence	31470-31518	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	136025-136073	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP053629	Listeria monocytogenes strain OB030029 plasmid pOB030029, complete sequence	31470-31518	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	66651-66699	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	79818-79866	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP053633	Listeria monocytogenes strain OB050226 plasmid pOB050226, complete sequence	31466-31514	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	124760-124808	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	18303-18351	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	85370-85418	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP049776	Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence	37842-37890	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP028836	Enterococcus faecalis strain FC plasmid unnamed1, complete sequence	89201-89249	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP014254	Listeria monocytogenes strain CFSAN023459 plasmid CFSAN023459_02, complete sequence	26159-26207	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	MK465703	Enterococcus faecium strain E505 plasmid pE505-1, complete sequence	84337-84385	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	CP044433	Listeria monocytogenes strain FDA00009448 plasmid pCFSAN038814, complete sequence	51169-51217	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	162359-162407	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	MH830363	Enterococcus faecalis plasmid p1, complete sequence	24251-24299	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	166890-166938	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	154727-154775	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	165995-166043	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	112981-113029	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	120922-120970	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	85336-85384	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	149345-149393	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	129785-129833	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	87597-87645	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	117398-117446	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	141967-142015	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	32001-32049	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	157378-157426	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP042214	Enterococcus faecalis strain L15 plasmid pL15, complete sequence	17965-18013	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	387-435	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	121330-121378	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	12063-12111	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP030044	Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence	15367-15415	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	122420-122468	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	93389-93437	2	0.959
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	45234-45282	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	146393-146441	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	126407-126455	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	9433-9481	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	133834-133882	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	102486-102534	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	304508-304556	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	126389-126437	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	55512-55560	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	55512-55560	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	55512-55560	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	53998-54046	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	60951-60999	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	142763-142811	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	150442-150490	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	70483-70531	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	80039-80087	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	156507-156555	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	156888-156936	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	81943-81991	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	135524-135572	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	153364-153412	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	147706-147754	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	60121-60169	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	47082-47130	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	115007-115055	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP011283	Enterococcus faecium strain E39 plasmid p2, complete sequence	47542-47590	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	LT603681	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 4	20001-20049	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	40446-40494	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP027519	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence	9889-9937	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP027509	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed3, complete sequence	29323-29371	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	77436-77484	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135239	Enterococcus faecium isolate E7067 plasmid 5	16350-16398	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	25866-25914	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019210	Enterococcus faecium strain 2014-VREF-41 plasmid p41-2, complete sequence	43578-43626	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135484	Enterococcus faecium isolate E4456 plasmid 3	38417-38465	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	79623-79671	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135230	Enterococcus faecium isolate E7025 plasmid 5	41121-41169	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135353	Enterococcus faecium isolate E8014 plasmid 3	23916-23964	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	58115-58163	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	56425-56473	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	82023-82071	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	119174-119222	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	197127-197175	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040742	Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence	112757-112805	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023426	Enterococcus faecium strain K60-39 plasmid pTT39_p3, complete sequence	18127-18175	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP023426	Enterococcus faecium strain K60-39 plasmid pTT39_p3, complete sequence	6673-6721	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	15950-15998	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019995	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-3	29098-29146	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	42558-42606	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	77094-77142	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	181861-181909	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP047631	Lactococcus raffinolactis strain Lr_18_12S plasmid pLraf_18_12S_1, complete sequence	31078-31126	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018131	Enterococcus faecium strain A_020709_82 plasmid unnamed3, complete sequence	19491-19539	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP016166	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence	2743-2791	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP016166	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence	2887-2935	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP016166	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence	2282-2330	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	66269-66317	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	86569-86617	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	48559-48607	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	167773-167821	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	39739-39787	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	56684-56732	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041269	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R4, complete sequence	18970-19018	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP018072	Enterococcus faecium strain VRE001 plasmid unnamed2, complete sequence	25876-25924	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	54605-54653	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP027500	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed3, complete sequence	26457-26505	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	135109-135157	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	47313-47361	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135247	Enterococcus faecium isolate E6988 plasmid 5	44695-44743	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	130864-130912	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	122030-122078	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019990	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-2, complete sequence	3623-3671	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	56425-56473	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135327	Enterococcus faecium isolate E7654 plasmid 4	30903-30951	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	161992-162040	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135320	Enterococcus faecium isolate E7663 plasmid 4	19500-19548	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	117490-117538	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	121364-121412	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	56683-56731	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP041279	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S4	19013-19061	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	13337-13385	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP019972	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-2 sequence	123377-123425	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LR135311	Enterococcus faecium isolate E7240 plasmid 5	3359-3407	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	66621-66669	3	0.939
NZ_CP041262_2	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	125721-125769	4	0.918
NZ_CP041262_1	1.1\|454\|40\|NZ_CP041262\|CRISPRCasFinder	454-493	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|517|19|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

231. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

232. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

233. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

234. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

235. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

236. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

237. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

238. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

239. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

240. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

241. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

242. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

243. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

244. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

245. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

246. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

247. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

248. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

249. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

250. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

251. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

252. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

253. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

254. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

255. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

256. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

257. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

258. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

259. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

260. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

261. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

262. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

263. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

264. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

265. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

266. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

267. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

268. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

269. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

270. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

271. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

272. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

273. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

274. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

275. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

276. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

277. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011831 (Enterococcus faecium strain UW8175 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

278. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

279. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

280. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040708 (Enterococcus faecium strain HOU503 plasmid p2) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

281. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

282. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135312 (Enterococcus faecium isolate E7240 plasmid 6) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

283. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

284. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

285. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

286. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

287. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

288. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

289. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgacccagatttgattttgc	Protospacer
******************* ****************************.

290. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

291. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgacccagatttgattttgc	Protospacer
******************* ****************************.

292. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

293. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

294. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

295. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

296. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

297. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

298. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_022051 (Listeria monocytogenes strain J1926 plasmid, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

299. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to CP044431 (Listeria monocytogenes strain FDA00006667 plasmid pCFSAN038814, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

300. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_022046 (Listeria monocytogenes strain J1776 plasmid, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

301. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_022047 (Listeria monocytogenes strain J1817 plasmid, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

302. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP053631 (Listeria monocytogenes strain OB040119 plasmid pOB040119, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

303. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

304. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP053629 (Listeria monocytogenes strain OB030029 plasmid pOB030029, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

305. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

306. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

307. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP053633 (Listeria monocytogenes strain OB050226 plasmid pOB050226, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

308. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgacccagatttgattttgc	Protospacer
******************* ****************************.

309. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

310. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

311. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP049776 (Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

312. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP028836 (Enterococcus faecalis strain FC plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

313. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP014254 (Listeria monocytogenes strain CFSAN023459 plasmid CFSAN023459_02, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

314. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to MK465703 (Enterococcus faecium strain E505 plasmid pE505-1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

315. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to CP044433 (Listeria monocytogenes strain FDA00009448 plasmid pCFSAN038814, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

316. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

317. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to MH830363 (Enterococcus faecalis plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

318. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

319. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

320. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

321. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

322. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

323. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

324. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

325. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

326. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

327. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

328. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

329. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

330. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

331. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP042214 (Enterococcus faecalis strain L15 plasmid pL15, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

332. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

333. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

334. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

335. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP030044 (Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

336. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

337. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 2, identity: 0.959

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgattttgc	Protospacer
*************************.**********************.

338. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

339. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

340. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

341. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

342. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

343. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

344. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

345. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

346. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

347. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

348. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

349. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

350. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

351. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

352. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

353. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgacccagatttgatttcgc	Protospacer
******************* **************************.*.

354. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

355. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

356. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

357. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

358. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

359. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

360. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

361. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

362. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

363. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttaatttttc	Protospacer
*****************************************.***** .

364. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP011283 (Enterococcus faecium strain E39 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

365. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to LT603681 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 4) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

366. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP020486 (Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

367. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027519 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

368. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027509 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

369. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

370. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135239 (Enterococcus faecium isolate E7067 plasmid 5) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

371. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

372. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019210 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

373. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135484 (Enterococcus faecium isolate E4456 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

374. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

375. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135230 (Enterococcus faecium isolate E7025 plasmid 5) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

376. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135353 (Enterococcus faecium isolate E8014 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

377. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

378. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

379. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

380. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

381. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

382. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040742 (Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

383. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023426 (Enterococcus faecium strain K60-39 plasmid pTT39_p3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

384. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP023426 (Enterococcus faecium strain K60-39 plasmid pTT39_p3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

385. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

386. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019995 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

387. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

388. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

389. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

390. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP047631 (Lactococcus raffinolactis strain Lr_18_12S plasmid pLraf_18_12S_1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagattttattttgc	Protospacer
*************************.*************** ******.

391. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018131 (Enterococcus faecium strain A_020709_82 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

392. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP016166 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

393. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP016166 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

394. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP016166 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

395. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

396. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

397. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

398. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

399. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

400. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

401. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041269 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R4, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

402. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP018072 (Enterococcus faecium strain VRE001 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

403. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

404. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP027500 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

405. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

406. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

407. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135247 (Enterococcus faecium isolate E6988 plasmid 5) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

408. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

409. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

410. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019990 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-2, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

411. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

412. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135327 (Enterococcus faecium isolate E7654 plasmid 4) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

413. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

414. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135320 (Enterococcus faecium isolate E7663 plasmid 4) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

415. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

416. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

417. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

418. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041279 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S4) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

419. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

420. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP019972 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-2 sequence) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

421. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LR135311 (Enterococcus faecium isolate E7240 plasmid 5) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

422. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 3, identity: 0.939

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgtggttcattctgactcagatttgattttgc	Protospacer
******************* *************.**************.

423. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 4, identity: 0.918

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcgttctgacccagatttgatttgca	Protospacer
*************************.********************

424. spacer 1.1|454|40|NZ_CP041262|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25323 : 59460

Streptococcus_phage(20.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060811263.1\|25323_26283_+\|transposase	IS30-like element IS6770 family transposase	W5R8L2	Staphylococcus_phage	3.0e-36	36.1
WP_002311552.1\|27081_27504_+	hypothetical protein	NA	NA	NA	NA
WP_033583488.1\|27523_29116_+	hypothetical protein	NA	NA	NA	NA
WP_002316755.1\|29371_29566_+	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|29701_30952_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002311557.1\|31361_33734_+	hypothetical protein	B5SP25	Lactococcus_phage	1.1e-10	28.9
WP_146419978.1\|33794_35255_+	toprim domain-containing protein	NA	NA	NA	NA
WP_146419980.1\|35265_37470_+	DNA topoisomerase 3	A0A1X9I6W8	Streptococcus_phage	1.6e-117	51.3
WP_002295632.1\|37485_37635_+	hypothetical protein	NA	NA	NA	NA
WP_002295629.1\|37715_38312_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_002340481.1\|38324_39224_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002295625.1\|39732_39990_+	hypothetical protein	NA	NA	NA	NA
WP_002311565.1\|40148_40283_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295623.1\|40425_40686_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002295619.1\|41134_41341_+	hypothetical protein	NA	NA	NA	NA
WP_002293542.1\|41340_41592_+	hypothetical protein	NA	NA	NA	NA
WP_002311567.1\|41607_42045_+	hypothetical protein	NA	NA	NA	NA
WP_060804903.1\|42480_42669_+	hypothetical protein	NA	NA	NA	NA
WP_002314432.1\|42726_42993_+	hypothetical protein	NA	NA	NA	NA
WP_002340480.1\|43002_43236_+	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_002335346.1\|43578_43761_+	hypothetical protein	NA	NA	NA	NA
WP_002340479.1\|43750_43972_+	hypothetical protein	NA	NA	NA	NA
WP_086953888.1\|44012_45174_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002290556.1\|45965_46733_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002290555.1\|47220_47646_+	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_002290554.1\|47662_48178_+	galactose-6-phosphate isomerase subunit LacB	A0A222YX14	Synechococcus_phage	3.3e-05	36.0
WP_002340477.1\|48188_49121_+	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_002290551.1\|49123_50104_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002290550.1\|50131_50449_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002340476.1\|50448_52155_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002290548.1\|52296_53703_+	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	3.6e-46	29.0
WP_002305107.1\|53725_53998_+	DUF3884 family protein	NA	NA	NA	NA
WP_002303235.1\|54018_54918_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_086956687.1\|55389_56552_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_000997695.1\|57248_58427_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002295743.1\|58551_59460_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

65887 : 127288

Bacillus_phage(22.73%)

integrase,transposase

attL 64821:64837|attR 119785:119801

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
64821:64837	attL	NA	NA	NA	NA
WP_002300843.1\|65887_67408_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.1e-48	31.6
WP_002305884.1\|67650_67836_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_002300846.1\|67819_68002_-	hypothetical protein	NA	NA	NA	NA
WP_002301839.1\|68955_69555_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.3e-29	36.1
WP_002322465.1\|69618_70218_+	bacteriophage abortive infection AbiH family protein	NA	NA	NA	NA
WP_002292418.1\|71233_72106_-	ROK family protein	NA	NA	NA	NA
WP_002293868.1\|72369_74316_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002302078.1\|74500_75940_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002302077.1\|75941_76904_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_086953894.1\|77073_78500_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|78742_79198_+\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_002289255.1\|79783_80014_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|80243_81062_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|81222_81912_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|81925_83428_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002300328.1\|83440_83917_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_086956687.1\|84414_85577_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002287870.1\|86694_87213_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002301591.1\|89288_90374_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_000222572.1\|90481_91435_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002301126.1\|91565_92816_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298736.1\|92834_93761_-	PEP phosphonomutase	NA	NA	NA	NA
WP_002301128.1\|93839_94835_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002301130.1\|94850_96020_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002301131.1\|96035_96770_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_086953888.1\|97540_98703_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002301811.1\|99271_100564_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.1e-32	41.0
WP_002313174.1\|100837_101098_-	hypothetical protein	NA	NA	NA	NA
WP_002346943.1\|101348_102527_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	4.0e-30	25.3
WP_065305666.1\|102878_103088_+\|transposase	IS3 family transposase	A0A0C5AEB1	Paenibacillus_phage	5.9e-14	61.7
WP_001015311.1\|103564_104245_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_025189010.1\|107522_107915_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	1.4e-69	96.9
WP_002303110.1\|111206_112244_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	7.1e-07	28.5
WP_002387940.1\|112240_112753_-\|transposase	transposase	NA	NA	NA	NA
WP_002319817.1\|113420_114101_-\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_002303113.1\|114645_115197_+	DUF334 domain-containing protein	NA	NA	NA	NA
WP_002319817.1\|115664_116345_+\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_002321606.1\|116604_117210_+	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-19	33.2
WP_000824191.1\|117254_117422_-	hypothetical protein	NA	NA	NA	NA
WP_000366408.1\|117455_117755_-	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|117795_118413_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_002304891.1\|118737_119133_-	hypothetical protein	NA	NA	NA	NA
WP_000344083.1\|119212_121564_-	DUF1906 domain-containing protein	NA	NA	NA	NA
119785:119801	attR	NA	NA	NA	NA
WP_000718009.1\|121688_122378_-	hypothetical protein	NA	NA	NA	NA
WP_000751236.1\|122391_122844_-	hypothetical protein	NA	NA	NA	NA
WP_002325565.1\|122974_123655_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-126	99.1
WP_002300494.1\|123756_125076_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|125072_125726_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_010729371.1\|126013_127288_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.2e-56	36.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP041261

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041261_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041261_1

2400794-2400903

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041261_1

>merge|NZ_CP041261|1|2400794-2400903|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP041261|1|1|2400794-2400903|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041261.2\|WP_002294588.1\|2399796_2400165_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP041261.2\|WP_002303469.1\|2389381_2391541_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP041261.2\|WP_002303471.1\|2397717_2398920_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP041261.2\|WP_002291634.1\|2400217_2400721_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP041261.2\|WP_002294587.1\|2401130_2401820_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP041261.2\|WP_002294577.1\|2407642_2408287_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP041261.2\|WP_002290558.1\|2395994_2397527_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP041261.2\|WP_002287792.1\|2391590_2392556_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP041261.2\|WP_002291638.1\|2401923_2402346_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP041261.2\|WP_002294593.1\|2392644_2393784_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP041261.2\|WP_002289897.1\|2405524_2406430_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP041261.2\|WP_002294584.1\|2403369_2404242_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP041261.2\|WP_002294579.1\|2407134_2407305_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP041261.2\|WP_002294585.1\|2402688_2403357_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP041261.2\|WP_002287787.1\|2395059_2395761_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP041261.2\|WP_002287788.1\|2394092_2394806_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP041261.2\|WP_002294583.1\|2404332_2405352_-\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|240088
NZ_CP041261.2\|WP_002294580.1\|2406488_2407034_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP041261.2\|WP_002294578.1\|2407328_2407481_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP041261.2\|WP_002294589.1\|2399001_2399691_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475

Protein	Function_ID	Function_description	E-value
NZ_CP041261.2\|WP_002294588.1\|2399796_2400165_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP041261.2\|WP_002303469.1\|2389381_2391541_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP041261.2\|WP_002303471.1\|2397717_2398920_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7222e-69
NZ_CP041261.2\|WP_002291634.1\|2400217_2400721_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP041261.2\|WP_002294587.1\|2401130_2401820_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP041261.2\|WP_002294577.1\|2407642_2408287_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP041261.2\|WP_002290558.1\|2395994_2397527_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP041261.2\|WP_002287792.1\|2391590_2392556_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP041261.2\|WP_002291638.1\|2401923_2402346_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP041261.2\|WP_002294593.1\|2392644_2393784_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.46227e-61
NZ_CP041261.2\|WP_002289897.1\|2405524_2406430_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	9.73807e-81
NZ_CP041261.2\|WP_002294584.1\|2403369_2404242_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP041261.2\|WP_002294579.1\|2407134_2407305_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP041261.2\|WP_002294585.1\|2402688_2403357_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP041261.2\|WP_002287787.1\|2395059_2395761_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP041261.2\|WP_002287788.1\|2394092_2394806_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP041261.2\|WP_002294583.1\|2404332_2405352_-\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP041261.2\|WP_002294580.1\|2406488_2407034_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP041261.2\|WP_002294578.1\|2407328_2407481_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP041261.2\|WP_002294589.1\|2399001_2399691_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	3.65546e-19

>NZ_CP041261.2|WP_002291634.1|2400217_2400721_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP041261.2|WP_002294588.1|2399796_2400165_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP041261.2|WP_002294589.1|2399001_2399691_-|TVP38/TMEM64-family-protein
MKKKIIRLILISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP041261.2|WP_002303471.1|2397717_2398920_-|MFS-transporter
MKSNEKKPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMAALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFMFMYFIGGAAGSLLGTTMWQQYGWLGVTVSGLVFQGCAFFFQTVVFKGKRNLENKK
>NZ_CP041261.2|WP_002290558.1|2395994_2397527_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP041261.2|WP_002287787.1|2395059_2395761_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP041261.2|WP_002287788.1|2394092_2394806_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP041261.2|WP_002294593.1|2392644_2393784_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAVFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP041261.2|WP_002287792.1|2391590_2392556_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP041261.2|WP_002303469.1|2389381_2391541_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFLSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYAMAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>NZ_CP041261.2|WP_002294587.1|2401130_2401820_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP041261.2|WP_002291638.1|2401923_2402346_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP041261.2|WP_002294585.1|2402688_2403357_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP041261.2|WP_002294584.1|2403369_2404242_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP041261.2|WP_002294583.1|2404332_2405352_-|alpha-hydroxy-acid-oxidizing-protein
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP041261.2|WP_002289897.1|2405524_2406430_-|alpha/beta-fold-hydrolase
MERKRCMTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP041261.2|WP_002294580.1|2406488_2407034_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP041261.2|WP_002294579.1|2407134_2407305_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP041261.2|WP_002294578.1|2407328_2407481_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP041261.2|WP_002294577.1|2407642_2408287_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

689695 : 698167

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|689695_690340_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|690354_690684_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_146419950.1\|690697_691636_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	8.6e-36	34.4
WP_002288073.1\|691671_692496_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|692488_692836_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|692904_693777_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|693885_695007_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|695060_695663_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|695977_698167_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_2

717252 : 755415

Enterococcus_phage(31.03%)

portal,holin,protease,terminase,head,tail,capsid,integrase,transposase

attL 717869:717904|attR 758705:758740

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289451.1\|717252_717597_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_002289452.1\|717609_717903_+	50S ribosomal protein L27	NA	NA	NA	NA
717869:717904	attL	NA	NA	NA	NA
WP_002301539.1\|717995_719144_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.0e-67	40.1
WP_002305409.1\|719155_719467_-	hypothetical protein	NA	NA	NA	NA
WP_002321996.1\|719519_719915_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002305405.1\|719950_720295_-	helix-turn-helix transcriptional regulator	A0A126GGL0	Streptococcus_phage	1.2e-24	52.6
WP_002349274.1\|720595_720817_+	hypothetical protein	NA	NA	NA	NA
WP_002305403.1\|720943_721720_+	phage antirepressor KilAC domain-containing protein	B2ZYU5	Staphylococcus_phage	2.8e-72	54.8
WP_010729259.1\|721722_721911_+	helix-turn-helix transcriptional regulator	D2IZW2	Enterococcus_phage	8.8e-09	50.9
WP_002349273.1\|721912_722197_+	hypothetical protein	NA	NA	NA	NA
WP_002305400.1\|722217_722406_+	hypothetical protein	D2IZW5	Enterococcus_phage	7.4e-08	60.3
WP_002305399.1\|722731_722971_+	hypothetical protein	NA	NA	NA	NA
WP_002305398.1\|722976_723663_+	hypothetical protein	C9E2N1	Enterococcus_phage	2.6e-90	71.4
WP_002305397.1\|723665_724496_+	phage replisome organizer N-terminal domain-containing protein	C9E2N2	Enterococcus_phage	1.5e-52	43.9
WP_002305396.1\|724512_725364_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.2e-25	28.7
WP_002305394.1\|725360_725720_+	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	3.1e-18	48.3
WP_002290675.1\|725734_725896_+	hypothetical protein	NA	NA	NA	NA
WP_002305393.1\|725892_726198_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|726197_726554_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002322165.1\|726540_726759_+	hypothetical protein	NA	NA	NA	NA
WP_002305391.1\|726943_727411_+	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
WP_002349267.1\|727685_727922_+	hypothetical protein	NA	NA	NA	NA
WP_002305389.1\|727945_728287_+	hypothetical protein	NA	NA	NA	NA
WP_002305388.1\|728279_728471_-	YegP family protein	NA	NA	NA	NA
WP_002305387.1\|728680_729328_+	hypothetical protein	NA	NA	NA	NA
WP_002305386.1\|729587_729932_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.0e-26	58.1
WP_002296599.1\|729936_730218_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|730320_730635_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|730612_732307_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|732326_733505_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|733467_734154_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|734153_735314_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_010729262.1\|735323_736199_+	hypothetical protein	D2IYX3	Enterococcus_phage	1.6e-129	73.9
WP_002286523.1\|736195_736507_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|736496_736850_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|736839_737241_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|737233_737638_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002297404.1\|737773_739024_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305379.1\|739432_740038_+	hypothetical protein	Q8W5Z9	Listeria_phage	1.1e-33	41.6
WP_002286510.1\|740057_740420_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|740422_740605_+	hypothetical protein	NA	NA	NA	NA
WP_002305374.1\|740621_744041_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	8.7e-78	41.5
WP_002305373.1\|744091_744829_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002305372.1\|744838_747130_+\|tail	phage tail protein	A0A1D3SNL1	Enterococcus_phage	1.7e-90	30.2
WP_010729263.1\|747153_749256_+	hypothetical protein	A0A0M4RT83	Enterococcus_phage	1.3e-63	39.0
WP_002290627.1\|749272_749422_+	hypothetical protein	NA	NA	NA	NA
WP_002286491.1\|749418_749865_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|749866_750004_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|750041_750335_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|750331_750556_+\|holin	phage holin	NA	NA	NA	NA
WP_002286484.1\|750552_751578_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|752517_753679_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002302440.1\|754113_755415_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
758705:758740	attR	NA	NA	NA	NA

DBSCAN-SWA_3

792013 : 892873

115

Enterococcus_phage(11.36%)

portal,holin,protease,terminase,head,tRNA,plate,tail,capsid,integrase,transposase

attL 841285:841303|attR 877253:877271

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|792013_794812_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|794860_796387_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|796401_797049_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|797232_797562_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|797738_798467_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|798482_799496_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|799495_800773_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|800835_803538_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|803689_804007_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|804036_804357_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|804464_805925_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|805992_806214_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|806244_806427_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|806426_806840_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|806962_808144_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286676.1\|808214_808379_-	hypothetical protein	NA	NA	NA	NA
WP_002286587.1\|808674_809814_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002303012.1\|810112_810748_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|810860_811496_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|811529_811991_-	SHOCT domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296613.1\|812120_812552_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|812569_812890_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|813188_813965_+	phage antirepressor KilAC domain-containing protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|813979_814183_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|814198_814537_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296610.1\|814523_814703_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|814745_815216_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|815302_816001_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|816178_816520_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|816512_817184_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286553.1\|817189_817876_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286552.1\|817878_818628_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002304429.1\|818639_818909_+	hypothetical protein	NA	NA	NA	NA
WP_002296607.1\|818914_819079_+	hypothetical protein	NA	NA	NA	NA
WP_002303016.1\|819071_819371_+	hypothetical protein	NA	NA	NA	NA
WP_002303017.1\|819370_819673_+	hypothetical protein	D2IZY1	Enterococcus_phage	2.8e-33	70.7
WP_002303018.1\|819712_820078_+	hypothetical protein	NA	NA	NA	NA
WP_002303019.1\|820567_820708_+	hypothetical protein	NA	NA	NA	NA
WP_002303020.1\|820704_820893_+	hypothetical protein	NA	NA	NA	NA
WP_002347162.1\|820900_821095_+	hypothetical protein	NA	NA	NA	NA
WP_002303022.1\|821127_821340_-	hypothetical protein	NA	NA	NA	NA
WP_002303023.1\|821464_821668_+	hypothetical protein	NA	NA	NA	NA
WP_002303024.1\|821664_821937_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.5e-20	61.6
WP_002303025.1\|821937_822123_+	hypothetical protein	NA	NA	NA	NA
WP_123838300.1\|822109_822457_+	hypothetical protein	NA	NA	NA	NA
WP_002303026.1\|822416_822893_+	DUF1492 domain-containing protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.2e-27	50.8
WP_002349221.1\|823038_823767_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	1.2e-58	52.4
WP_002303029.1\|823814_824093_+	hypothetical protein	NA	NA	NA	NA
WP_002303030.1\|824094_824481_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	1.9e-10	36.7
WP_002304435.1\|824477_824858_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	4.7e-41	64.0
WP_002303032.1\|824969_825422_+	hypothetical protein	A0A2H4JFK0	uncultured_Caudovirales_phage	6.8e-47	66.2
WP_002303033.1\|825418_827146_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	6.9e-265	73.3
WP_002304437.1\|827209_828397_+\|portal	phage portal protein	A0A1B2APW5	Phage_Wrath	1.3e-142	65.5
WP_002303035.1\|828368_828938_+\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	3.6e-69	71.7
WP_002303037.1\|828950_830315_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	2.2e-125	69.1
WP_002303039.1\|830316_830598_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	4.7e-22	62.7
WP_002303041.1\|830575_830902_+\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	2.9e-23	53.4
WP_002303043.1\|830891_831230_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	9.6e-22	45.9
WP_002303045.1\|831219_831585_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002303047.1\|831591_832218_+\|tail	tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	5.7e-28	34.5
WP_002303049.1\|832217_832682_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	1.4e-15	38.9
WP_002303051.1\|832876_835186_+\|tail	phage tail tape measure protein	Q8W5Z7	Listeria_phage	5.5e-84	50.1
WP_002349218.1\|835197_835902_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002347164.1\|835898_838658_+\|tail	phage tail protein	D7RWE0	Brochothrix_phage	1.6e-50	55.7
WP_002350776.1\|838670_839579_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
WP_002301866.1\|839578_840196_+	hypothetical protein	NA	NA	NA	NA
WP_002301867.1\|840199_840649_+	hypothetical protein	NA	NA	NA	NA
WP_002305897.1\|840648_841143_+	hypothetical protein	NA	NA	NA	NA
WP_002347165.1\|841156_841588_+	hypothetical protein	NA	NA	NA	NA
841285:841303	attL	NA	NA	NA	NA
WP_002303475.1\|841589_841727_+	XkdX family protein	NA	NA	NA	NA
WP_002303476.1\|841763_842057_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|842053_842278_+\|holin	phage holin	NA	NA	NA	NA
WP_002303477.1\|842274_843294_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
WP_002302747.1\|844070_844370_-	hypothetical protein	NA	NA	NA	NA
WP_002302745.1\|844375_844606_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|844855_845056_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002296840.1\|845372_846560_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002286469.1\|846834_848067_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|848321_848891_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286465.1\|849068_849509_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|849666_850431_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|850462_851386_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|851461_852601_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|852593_853394_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|853393_854221_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|854198_854933_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|855032_855899_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|855912_856485_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002294532.1\|856506_857535_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286428.1\|857632_858484_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002302719.1\|858517_860551_+	hypothetical protein	NA	NA	NA	NA
WP_002289081.1\|862083_862890_+	ABC transporter permease	NA	NA	NA	NA
WP_002289079.1\|862901_864122_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
WP_002289078.1\|864111_865698_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002289076.1\|865736_867875_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002289074.1\|868242_869226_-	serine hydrolase	NA	NA	NA	NA
WP_002302725.1\|869603_870995_+	sugar transferase	NA	NA	NA	NA
WP_002289071.1\|871010_872051_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-07	35.3
WP_002289069.1\|872069_873155_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_002289068.1\|873187_874150_+	glycosyl transferase	NA	NA	NA	NA
WP_002347167.1\|874142_875576_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_002302730.1\|875572_876643_+	hypothetical protein	NA	NA	NA	NA
WP_002292875.1\|876629_878051_+	oligosaccharide flippase family protein	NA	NA	NA	NA
877253:877271	attR	NA	NA	NA	NA
WP_002289359.1\|878063_879071_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.2e-40	35.9
WP_002292874.1\|879082_880087_+	N-acetylneuraminate synthase	NA	NA	NA	NA
WP_002289362.1\|880083_881232_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
WP_002289363.1\|881204_881882_+	acetyltransferase	NA	NA	NA	NA
WP_002326811.1\|881871_883014_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L0G1	Tupanvirus	2.4e-24	27.9
WP_002289366.1\|883026_884004_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002289368.1\|884003_884912_+	dehydrogenase	NA	NA	NA	NA
WP_002289370.1\|884912_885665_+	acylneuraminate cytidylyltransferase family protein	NA	NA	NA	NA
WP_002289372.1\|885669_886617_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.8e-50	37.7
WP_002296623.1\|886790_888086_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002286097.1\|888574_889528_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002301399.1\|891913_892873_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8

DBSCAN-SWA_4

1163975 : 1173036

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288023.1\|1163975_1165271_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002297115.1\|1165450_1165828_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1166083_1166812_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1166811_1167066_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1167067_1167739_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1167739_1169962_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1169946_1171386_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288011.1\|1171408_1172461_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1172457_1173036_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_5

1451889 : 1503972

Streptococcus_phage(28.57%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002347126.1\|1451889_1453425_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	3.3e-125	48.2
WP_002295142.1\|1453648_1454020_+	hypothetical protein	NA	NA	NA	NA
WP_002291278.1\|1454275_1454518_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002296679.1\|1454549_1455452_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002291274.1\|1455464_1455653_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002296677.1\|1455666_1456230_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002300977.1\|1456267_1457161_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.2e-59	46.0
WP_002303839.1\|1457238_1458162_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002296672.1\|1458210_1458561_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002296671.1\|1458593_1459496_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002296670.1\|1459488_1460346_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
WP_002296669.1\|1460679_1461489_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002296667.1\|1461528_1462026_+	cysteine hydrolase	NA	NA	NA	NA
WP_002321681.1\|1462670_1462994_+	hypothetical protein	NA	NA	NA	NA
WP_002296665.1\|1463157_1463412_+	hypothetical protein	NA	NA	NA	NA
WP_002296663.1\|1463481_1463727_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296662.1\|1463802_1464168_+	hypothetical protein	NA	NA	NA	NA
WP_002303842.1\|1464228_1464792_-	hypothetical protein	NA	NA	NA	NA
WP_002302440.1\|1467877_1469179_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002293303.1\|1469339_1469540_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3
WP_002296658.1\|1469935_1470085_+	hypothetical protein	NA	NA	NA	NA
WP_002296656.1\|1470291_1471005_-	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
WP_002296654.1\|1470997_1472083_-	mannonate dehydratase	NA	NA	NA	NA
WP_002296653.1\|1472099_1472543_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002321678.1\|1472576_1472930_-	hypothetical protein	NA	NA	NA	NA
WP_002296650.1\|1473041_1473443_-	hypothetical protein	NA	NA	NA	NA
WP_002296648.1\|1473479_1473989_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_146419957.1\|1474010_1474868_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002296646.1\|1474885_1475719_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002303106.1\|1475732_1476530_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_002321677.1\|1476562_1476847_-	alcohol dehydrogenase	NA	NA	NA	NA
WP_002296641.1\|1476843_1477845_-	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0
WP_002321675.1\|1477846_1478914_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.9e-53	35.3
WP_002296639.1\|1478912_1479761_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_000202380.1\|1480196_1481516_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002296638.1\|1482090_1482297_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296637.1\|1482498_1483500_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002311095.1\|1483504_1485418_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_002296634.1\|1485585_1486092_-	cysteine hydrolase	NA	NA	NA	NA
WP_002296633.1\|1486251_1486692_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002296632.1\|1486717_1487875_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002296631.1\|1487877_1488234_-	hypothetical protein	NA	NA	NA	NA
WP_002296629.1\|1488531_1489506_-	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_002296628.1\|1489701_1490541_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|1490725_1491613_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_002311093.1\|1492206_1492902_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|1492885_1493284_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002297404.1\|1493692_1494943_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296760.1\|1495084_1496080_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002289423.1\|1496097_1496652_-	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289422.1\|1496639_1497131_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289421.1\|1497123_1498992_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|1499010_1499811_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289418.1\|1500034_1500250_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002303864.1\|1500388_1500874_+	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|1501329_1501743_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_000997695.1\|1502793_1503972_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1668107 : 1677267

Streptococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002341493.1\|1668107_1668314_-	excisionase	A0A1S5SF07	Streptococcus_phage	1.1e-25	87.3
WP_010729705.1\|1668306_1669449_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.5e-63	35.4
WP_008788621.1\|1669960_1670596_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001814923.1\|1671071_1671188_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000691736.1\|1671203_1673123_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_000336323.1\|1673241_1673409_+	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_001227347.1\|1673468_1673822_-	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_022278534.1\|1674325_1674745_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_025481129.1\|1674770_1674977_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002296523.1\|1675204_1675378_-	hypothetical protein	NA	NA	NA	NA
WP_158003447.1\|1675353_1676019_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002289374.1\|1676100_1677267_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.9e-24	25.7

DBSCAN-SWA_7

1695310 : 1804922

109

Streptococcus_phage(19.23%)

integrase,tRNA,protease,transposase

attL 1791628:1791643|attR 1802363:1802378

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297218.1\|1695310_1696606_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288513.1\|1696800_1697148_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002288511.1\|1697174_1699481_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
WP_002288509.1\|1699493_1699805_-	YlxQ-related RNA-binding protein	NA	NA	NA	NA
WP_002288501.1\|1699801_1700095_-	YlxR family protein	NA	NA	NA	NA
WP_002288500.1\|1700116_1701292_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002288499.1\|1701314_1701788_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_002288497.1\|1701932_1706291_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.9e-21	40.8
WP_002294137.1\|1706502_1708212_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002294136.1\|1708279_1709548_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294135.1\|1709708_1710509_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|1710505_1711318_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002297404.1\|1711726_1712977_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002293875.1\|1713295_1713853_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|1713855_1714578_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|1714713_1715595_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|1715693_1716476_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|1716834_1717314_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326698.1\|1717530_1718622_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002326699.1\|1718614_1718743_+	hypothetical protein	NA	NA	NA	NA
WP_002288430.1\|1718746_1719292_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002288432.1\|1719745_1721437_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288434.1\|1721856_1722804_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|1722918_1723938_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|1724028_1725258_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|1725718_1726420_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002301319.1\|1727028_1728045_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288445.1\|1728041_1728506_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288446.1\|1728512_1729055_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|1729038_1729863_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|1729951_1730932_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|1730955_1732440_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|1732451_1733441_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1733688_1733856_+	DUF3042 family protein	NA	NA	NA	NA
WP_010729586.1\|1733917_1735729_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1735725_1736091_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1736253_1736649_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1736666_1737629_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1737628_1737841_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|1737861_1738560_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1738579_1739122_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002301321.1\|1739253_1740258_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1740254_1741244_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|1741240_1742047_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1742212_1743169_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1743245_1743764_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1743851_1744001_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1744228_1744675_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002305724.1\|1744869_1746765_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002303934.1\|1747089_1748064_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002296332.1\|1748629_1749196_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002296334.1\|1749451_1750783_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1750748_1751099_+	hypothetical protein	NA	NA	NA	NA
WP_002296337.1\|1751610_1751955_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002301399.1\|1752220_1753180_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287776.1\|1753369_1753966_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|1754089_1755889_+	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1756166_1756379_-	hypothetical protein	NA	NA	NA	NA
WP_002293931.1\|1756840_1756990_+	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|1757242_1758202_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002295743.1\|1758414_1759323_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002288573.1\|1759371_1759758_+	YxeA family protein	NA	NA	NA	NA
WP_002288574.1\|1760065_1761412_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002288575.1\|1761523_1762873_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288576.1\|1762989_1764243_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288577.1\|1764313_1764799_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002305727.1\|1764821_1765580_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|1765595_1766774_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002303943.1\|1767003_1769124_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002296838.1\|1769346_1770072_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1770061_1770571_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1770640_1772089_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288590.1\|1772088_1772805_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|1772785_1773136_-	SdpI family protein	NA	NA	NA	NA
WP_002288592.1\|1773279_1774053_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002297218.1\|1774717_1776013_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002302293.1\|1776331_1776634_+	hypothetical protein	NA	NA	NA	NA
WP_002323892.1\|1777777_1778092_-	hypothetical protein	NA	NA	NA	NA
WP_033613710.1\|1778184_1779387_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|1779723_1779963_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1780324_1780585_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1780769_1781267_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1781396_1782107_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1782119_1783784_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|1783988_1784651_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|1784660_1785476_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1785737_1786181_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|1786314_1786653_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288986.1\|1786640_1787018_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002288985.1\|1787241_1788435_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|1788600_1789023_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002321037.1\|1789417_1789612_+	hypothetical protein	NA	NA	NA	NA
WP_002288983.1\|1789608_1790103_+	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|1790264_1791437_-	class C sortase	NA	NA	NA	NA
1791628:1791643	attL	NA	NA	NA	NA
WP_002288981.1\|1791642_1792458_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288979.1\|1792607_1793054_-	cell wall anchor	NA	NA	NA	NA
WP_158003446.1\|1793050_1794055_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002352916.1\|1794094_1794424_-	hypothetical protein	NA	NA	NA	NA
WP_002305732.1\|1794549_1796877_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288970.1\|1797719_1798013_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002288969.1\|1798415_1799594_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
WP_002300928.1\|1799697_1800012_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288966.1\|1800118_1800334_+	hypothetical protein	NA	NA	NA	NA
WP_002288964.1\|1800633_1800876_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288962.1\|1800862_1801291_-	hypothetical protein	NA	NA	NA	NA
WP_002296127.1\|1801442_1802990_-\|transposase	IS66 family transposase	NA	NA	NA	NA
1802363:1802378	attR	NA	NA	NA	NA
WP_002287659.1\|1803091_1803445_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|1803434_1803629_-	hypothetical protein	NA	NA	NA	NA
WP_086953888.1\|1803759_1804922_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3

DBSCAN-SWA_8

1818270 : 1852603

Streptococcus_phage(70.59%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086956705.1\|1818270_1819433_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5
WP_002305710.1\|1819525_1820035_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002325884.1\|1820373_1821327_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_077828749.1\|1821279_1821516_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002305709.1\|1821935_1823057_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_002321361.1\|1823384_1824794_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002289053.1\|1824790_1825519_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
WP_146419960.1\|1825646_1826558_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	8.3e-60	42.2
WP_002289057.1\|1826574_1827582_-	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
WP_002305708.1\|1827578_1829708_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.8e-182	60.3
WP_002296840.1\|1830008_1831196_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002349083.1\|1831288_1832107_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	2.0e-118	81.0
WP_002298631.1\|1832240_1834067_-	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	3.7e-11	26.8
WP_010729754.1\|1834464_1835373_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002288938.1\|1837349_1837739_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
WP_002305705.1\|1837788_1838685_-	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
WP_002288935.1\|1838687_1840535_-	PHP domain-containing protein	NA	NA	NA	NA
WP_002288934.1\|1840631_1841132_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
WP_002298822.1\|1841144_1841366_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002305703.1\|1841370_1841508_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286934.1\|1841504_1842689_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
WP_002286933.1\|1842944_1843199_-	hypothetical protein	NA	NA	NA	NA
WP_002286932.1\|1843223_1844366_-	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
WP_002349191.1\|1844425_1845778_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.8e-162	64.4
WP_002286928.1\|1845848_1846193_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_002286926.1\|1846202_1846577_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
WP_002286925.1\|1846589_1846904_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
WP_002305699.1\|1847017_1850245_-	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002286921.1\|1850323_1850986_-	hypothetical protein	NA	NA	NA	NA
WP_002286913.1\|1851358_1851706_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293717.1\|1851841_1852603_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA

DBSCAN-SWA_9

2088687 : 2182221

102

Enterococcus_phage(26.47%)

portal,holin,terminase,plate,tRNA,tail,capsid,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303350.1\|2088687_2089647_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002295061.1\|2091382_2092486_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_002295059.1\|2092707_2093178_-	DUF4809 family protein	NA	NA	NA	NA
WP_000202380.1\|2093434_2094754_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002302982.1\|2095194_2096835_+	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_002302984.1\|2096988_2098311_+	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_002295053.1\|2098372_2098804_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002302985.1\|2098867_2099704_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_002295049.1\|2099893_2100196_-	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_002290886.1\|2100221_2100653_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_002290885.1\|2100649_2100916_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_002290883.1\|2101169_2101895_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_002289867.1\|2102447_2103200_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_002289868.1\|2103215_2103695_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_002296509.1\|2103945_2105526_-	ABC transporter	NA	NA	NA	NA
WP_060811100.1\|2105518_2106262_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.2e-28	30.4
WP_060811099.1\|2106437_2107214_-	response regulator transcription factor	NA	NA	NA	NA
WP_002287743.1\|2107461_2108298_-	TIGR03943 family protein	NA	NA	NA	NA
WP_002287744.1\|2108308_2109238_-	permease	NA	NA	NA	NA
WP_002287745.1\|2109429_2109783_+	thioredoxin family protein	NA	NA	NA	NA
WP_002287746.1\|2109856_2110513_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287747.1\|2110738_2112673_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-58	31.9
WP_002321414.1\|2112758_2113982_-	glycoside hydrolase family 88 protein	NA	NA	NA	NA
WP_002321415.1\|2113975_2115874_-	DUF2264 domain-containing protein	NA	NA	NA	NA
WP_002287753.1\|2115867_2116986_-	glycoside hydrolase family 88 protein	NA	NA	NA	NA
WP_002302991.1\|2117068_2117902_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002287755.1\|2117894_2118812_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002287756.1\|2118834_2119014_-	hypothetical protein	NA	NA	NA	NA
WP_002287757.1\|2119038_2120163_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002296511.1\|2120345_2121254_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287759.1\|2121394_2123008_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000222572.1\|2123658_2124612_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002289406.1\|2124645_2125875_-	GTPase HflX	NA	NA	NA	NA
WP_002289405.1\|2125876_2126794_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_002289404.1\|2126797_2127535_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.3e-12	40.0
WP_002289403.1\|2127625_2128153_-	hypothetical protein	NA	NA	NA	NA
WP_002289402.1\|2128332_2128926_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.9e-55	55.6
WP_002289401.1\|2129029_2129515_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_002296291.1\|2129667_2129865_-	hypothetical protein	NA	NA	NA	NA
WP_002289400.1\|2129959_2131720_-	multidrug efflux ABC transporter subunit EfrB	W8CYL7	Bacillus_phage	2.5e-52	28.6
WP_002296290.1\|2131716_2133447_-	multidrug efflux ABC transporter subunit EfrA	W8CYL7	Bacillus_phage	2.1e-43	27.6
WP_002287947.1\|2133839_2134052_+	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_002287948.1\|2134053_2135733_+	ribonuclease J	NA	NA	NA	NA
WP_002294067.1\|2135986_2136187_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.7e-21	71.2
WP_010726559.1\|2137141_2138152_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	9.8e-62	66.7
WP_010726558.1\|2138148_2138568_-\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	5.0e-44	68.7
WP_002302750.1\|2138637_2138778_-	XkdX family protein	A0A2H4JD72	uncultured_Caudovirales_phage	1.1e-08	54.8
WP_002332774.1\|2138770_2139118_-	hypothetical protein	NA	NA	NA	NA
WP_002305897.1\|2139131_2139626_-	hypothetical protein	NA	NA	NA	NA
WP_002301867.1\|2139625_2140075_-	hypothetical protein	NA	NA	NA	NA
WP_002301866.1\|2140078_2140696_-	hypothetical protein	NA	NA	NA	NA
WP_002350776.1\|2140695_2141604_-\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
WP_002347081.1\|2141616_2144379_-\|tail	phage tail protein	Q9AZX5	Lactococcus_phage	6.0e-138	39.1
WP_002303299.1\|2144375_2145116_-\|tail	tail protein	NA	NA	NA	NA
WP_002305859.1\|2145105_2147895_-	tape measure protein	D7RWD8	Brochothrix_phage	8.4e-71	40.2
WP_002303297.1\|2148136_2148478_-	hypothetical protein	NA	NA	NA	NA
WP_002303295.1\|2148477_2149086_-\|tail	tail protein	NA	NA	NA	NA
WP_002298045.1\|2149086_2149464_-	hypothetical protein	NA	NA	NA	NA
WP_002298046.1\|2149465_2149861_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002298048.1\|2149853_2150225_-	hypothetical protein	NA	NA	NA	NA
WP_002298050.1\|2150224_2150566_-	hypothetical protein	NA	NA	NA	NA
WP_002311614.1\|2150577_2150793_-	hypothetical protein	NA	NA	NA	NA
WP_002312521.1\|2150815_2151706_-	DUF5309 domain-containing protein	NA	NA	NA	NA
WP_002312520.1\|2151720_2152344_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_002304492.1\|2152470_2152788_-	hypothetical protein	NA	NA	NA	NA
WP_033582200.1\|2152789_2153668_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_002343932.1\|2153747_2155283_-\|portal	phage portal protein	NA	NA	NA	NA
WP_002304486.1\|2155294_2156713_-\|terminase	phage terminase large subunit	A0A090EUA8	Clostridium_phage	2.5e-124	51.5
WP_002304484.1\|2156690_2157119_-	hypothetical protein	A0A1P8BMH5	Lactococcus_phage	2.6e-40	63.1
WP_002311618.1\|2157136_2157361_-	hypothetical protein	NA	NA	NA	NA
WP_002304480.1\|2157911_2158298_-	hypothetical protein	O34053	Streptococcus_phage	1.9e-29	55.2
WP_002322045.1\|2158310_2158724_-	autolysin	C9E2P5	Enterococcus_phage	2.5e-56	80.3
WP_002286693.1\|2158800_2159097_-	hypothetical protein	NA	NA	NA	NA
WP_002304475.1\|2159093_2159297_-	hypothetical protein	NA	NA	NA	NA
WP_002304474.1\|2159303_2159534_-	hypothetical protein	A0A0S2MYD2	Enterococcus_phage	8.8e-11	50.7
WP_002304473.1\|2159530_2159842_-	hypothetical protein	A0A0D3MVS9	Staphylococcus_phage	5.3e-27	58.0
WP_002304472.1\|2159980_2160796_-	prohibitin family protein	A0A288TXV9	Enterococcus_phage	1.8e-82	69.4
WP_002350868.1\|2160792_2161119_-	hypothetical protein	NA	NA	NA	NA
WP_002292988.1\|2161115_2161277_-	hypothetical protein	NA	NA	NA	NA
WP_002304469.1\|2161291_2161651_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	6.8e-18	47.5
WP_002304468.1\|2161647_2162499_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	3.0e-27	30.2
WP_002303278.1\|2162513_2163314_-	hypothetical protein	B4XYS6	Lactobacillus_phage	8.9e-58	54.5
WP_002303277.1\|2163356_2164247_-	recombinase RecT	D2IYT9	Enterococcus_phage	6.2e-137	84.5
WP_002303275.1\|2164248_2165190_-	YqaJ viral recombinase family protein	D2IZK1	Enterococcus_phage	2.7e-146	78.9
WP_002303273.1\|2165422_2165758_-	hypothetical protein	NA	NA	NA	NA
WP_002299325.1\|2166024_2166249_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.2e-27	81.1
WP_002303270.1\|2166245_2166401_-	hypothetical protein	NA	NA	NA	NA
WP_002299038.1\|2166557_2166713_-	hypothetical protein	NA	NA	NA	NA
WP_002304464.1\|2166784_2167015_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	4.4e-10	49.3
WP_002303268.1\|2167011_2167170_-	hypothetical protein	NA	NA	NA	NA
WP_002303266.1\|2167182_2167449_-	helix-turn-helix transcriptional regulator	A0A1W6JP54	Staphylococcus_phage	5.4e-12	52.7
WP_002303265.1\|2167648_2168353_+	LexA family transcriptional regulator	D7RWF2	Brochothrix_phage	6.2e-39	42.4
WP_002303264.1\|2168439_2169729_+	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	5.6e-46	74.0
WP_002303263.1\|2169794_2171147_+	recombinase family protein	D2IZV7	Enterococcus_phage	1.7e-133	55.3
WP_002304462.1\|2171041_2171713_-	DNA repair protein RadC	NA	NA	NA	NA
WP_002287951.1\|2171767_2172421_-	HAD family phosphatase	NA	NA	NA	NA
WP_002294071.1\|2172410_2173724_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287953.1\|2174033_2176679_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002287954.1\|2177071_2177719_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287955.1\|2178291_2179503_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_002287956.1\|2179518_2180661_-	cysteine desulfurase	NA	NA	NA	NA
WP_002297218.1\|2180925_2182221_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_10

2193446 : 2265935

Streptococcus_phage(37.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086953888.1\|2193446_2194608_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002302440.1\|2194999_2196301_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002287172.1\|2202282_2202645_-	hypothetical protein	NA	NA	NA	NA
WP_002287231.1\|2202718_2203099_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_002311494.1\|2203162_2204356_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002287167.1\|2204432_2205017_-	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	2.0e-27	43.4
WP_002297404.1\|2205425_2206676_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002287165.1\|2207000_2207999_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	2.6e-30	54.1
WP_002287163.1\|2208110_2208620_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.5e-39	56.1
WP_002302440.1\|2208798_2210100_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_146419963.1\|2210135_2210810_-	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_002287159.1\|2210811_2211576_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_002287156.1\|2211583_2212261_-	YutD family protein	NA	NA	NA	NA
WP_002287155.1\|2212297_2213683_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_002287154.1\|2213999_2214515_-\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_002305494.1\|2214621_2215479_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002287147.1\|2215559_2215895_-	hypothetical protein	NA	NA	NA	NA
WP_002287145.1\|2215961_2217332_-	RsmF rRNA methyltransferase first C-terminal domain-containing protein	NA	NA	NA	NA
WP_002287143.1\|2217409_2217946_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002287140.1\|2218254_2219736_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297185.1\|2219900_2221196_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002287139.1\|2221360_2222068_-	zinc metallopeptidase	NA	NA	NA	NA
WP_002287137.1\|2222146_2222485_-	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_002287135.1\|2222595_2223558_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_002287134.1\|2223572_2224904_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002287133.1\|2224911_2225592_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_002287132.1\|2225810_2226290_-\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_002287130.1\|2226416_2228096_-	ribonuclease J	NA	NA	NA	NA
WP_010729408.1\|2228643_2230146_+	ABC transporter permease	NA	NA	NA	NA
WP_002287128.1\|2230158_2230821_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-21	34.7
WP_002287127.1\|2230921_2231125_-	CsbD family protein	NA	NA	NA	NA
WP_002287126.1\|2231235_2232420_-	beta-aspartyl-peptidase	NA	NA	NA	NA
WP_002294022.1\|2232576_2234316_-	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
WP_002287124.1\|2235088_2235703_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002294021.1\|2236308_2236686_-	hypothetical protein	NA	NA	NA	NA
WP_002287122.1\|2236985_2237867_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.3e-73	50.3
WP_002297404.1\|2238276_2239527_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002287121.1\|2239692_2240712_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_002287119.1\|2241344_2242349_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002287118.1\|2242361_2243411_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002287116.1\|2243427_2244249_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002287115.1\|2244235_2245015_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002287114.1\|2245031_2245502_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002287112.1\|2245513_2245933_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_002287111.1\|2246013_2248791_-	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002294014.1\|2248981_2249206_+	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|2249863_2251183_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002294013.1\|2251668_2253384_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-50	28.3
WP_002289511.1\|2253386_2255150_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-44	30.2
WP_002289509.1\|2255189_2255726_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_002289508.1\|2256048_2256471_-	methylglyoxal synthase	NA	NA	NA	NA
WP_002289507.1\|2256679_2257789_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	1.2e-20	33.0
WP_002294011.1\|2257912_2258542_-	hypothetical protein	NA	NA	NA	NA
WP_002294004.1\|2258992_2259877_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_002305490.1\|2259869_2260439_-	ribonuclease M5	NA	NA	NA	NA
WP_002294001.1\|2260431_2261208_-	TatD family hydrolase	NA	NA	NA	NA
WP_002294000.1\|2261362_2262685_-	amino acid permease	NA	NA	NA	NA
WP_002293998.1\|2262859_2263447_+	hypothetical protein	NA	NA	NA	NA
WP_002289325.1\|2263925_2265935_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.4e-96	38.3

DBSCAN-SWA_11

2513613 : 2592569

Bacillus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297218.1\|2513613_2514909_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002294493.1\|2515063_2515747_+	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
WP_002285996.1\|2515748_2516585_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_010729265.1\|2516595_2518350_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-39	26.4
WP_002285994.1\|2518625_2518967_-	YlbF family regulator	A0A1X9I5Y8	Streptococcus_phage	1.3e-10	34.9
WP_002294492.1\|2519034_2521206_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_002348711.1\|2521374_2522274_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002285988.1\|2522344_2523202_-	ROK family protein	NA	NA	NA	NA
WP_002285985.1\|2523186_2525889_-	alpha-mannosidase	NA	NA	NA	NA
WP_002294491.1\|2525901_2527191_-	glycoside hydrolase family 125 protein	NA	NA	NA	NA
WP_002302559.1\|2527340_2528387_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002302560.1\|2528388_2530542_+	glycoside hydrolase family 92 protein	NA	NA	NA	NA
WP_002304851.1\|2531014_2532466_-	response regulator transcription factor	NA	NA	NA	NA
WP_002285976.1\|2532462_2534187_-	sensor histidine kinase	NA	NA	NA	NA
WP_002285975.1\|2534179_2534794_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002285974.1\|2535138_2536596_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002285972.1\|2536636_2537557_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002285971.1\|2537568_2538516_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002285969.1\|2538994_2539714_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_002285966.1\|2539762_2541409_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002285964.1\|2541587_2542178_+	YitT family protein	NA	NA	NA	NA
WP_002294486.1\|2542269_2543775_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	NA	NA	NA	NA
WP_002285961.1\|2543858_2545211_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_002285960.1\|2545210_2545729_-	hypothetical protein	NA	NA	NA	NA
WP_002285954.1\|2545744_2546071_-	PTS cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002285949.1\|2546083_2548063_-	BglG family transcription antiterminator	NA	NA	NA	NA
WP_002285948.1\|2548083_2548398_-	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
WP_002285944.1\|2548565_2548859_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_002321621.1\|2548936_2550049_-	FUSC family protein	NA	NA	NA	NA
WP_002297280.1\|2550201_2550426_+	hypothetical protein	NA	NA	NA	NA
WP_002285932.1\|2550435_2550615_+\|transposase	transposase	NA	NA	NA	NA
WP_104674935.1\|2550808_2550979_+\|transposase	transposase	NA	NA	NA	NA
WP_002303189.1\|2557547_2558309_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002302440.1\|2558407_2559709_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002285920.1\|2559909_2561631_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-37	28.0
WP_146419965.1\|2561645_2563430_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.5e-46	28.0
WP_002285917.1\|2563810_2565364_-	glycosyl hydrolase	NA	NA	NA	NA
WP_002285916.1\|2565711_2568126_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
WP_002301403.1\|2568552_2570571_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	5.8e-13	39.6
WP_002285911.1\|2570940_2571597_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002285909.1\|2571596_2572553_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
WP_002285906.1\|2572552_2573119_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
WP_002303072.1\|2573323_2575093_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-54	29.5
WP_002285883.1\|2575095_2576808_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
WP_002303070.1\|2576922_2577591_+	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_002295567.1\|2577657_2578446_-	esterase family protein	NA	NA	NA	NA
WP_002295566.1\|2578528_2580001_-	MFS transporter	NA	NA	NA	NA
WP_002289731.1\|2580130_2581324_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
WP_002297218.1\|2581657_2582953_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002297218.1\|2591273_2592569_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9

DBSCAN-SWA_12

2721058 : 2737953

Streptococcus_phage(92.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297366.1\|2721058_2721373_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
WP_002297365.1\|2721385_2721760_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002297364.1\|2721769_2722105_+	hypothetical protein	NA	NA	NA	NA
WP_010729284.1\|2722187_2723528_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	1.5e-163	65.2
WP_002297358.1\|2723605_2724280_+	zeta toxin family protein	NA	NA	NA	NA
WP_002297357.1\|2724272_2724437_+	hypothetical protein	NA	NA	NA	NA
WP_002321810.1\|2724512_2724947_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
WP_002297356.1\|2724947_2725655_+	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
WP_002297354.1\|2725644_2725935_+	hypothetical protein	NA	NA	NA	NA
WP_002297353.1\|2726193_2727378_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002317225.1\|2727374_2727512_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|2728256_2730167_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033658092.1\|2730270_2730495_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002297350.1\|2730507_2731011_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_002297349.1\|2731070_2731460_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_010729283.1\|2731446_2733894_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.9
WP_002297347.1\|2733898_2736022_+	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_002297346.1\|2736018_2737023_+	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297345.1\|2737041_2737953_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0

Anti-CRISPR protein detection

Acr_ID: NZ_CP041261.2|WP_002303268.1|2167011_2167170_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP041261.2|WP_002303268.1|2167011_2167170_-|hypothetical-protein

2167011_2167170_-

52 aa aa

2088687-2182221

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP041262_2	Orphan	2.1\|161134\|49\|NZ_CP041262\|CRISPRCasFinder	161134-161182	49	2091283-2091331	0

1. spacer 2.1|161134|49|NZ_CP041262|CRISPRCasFinder matches to NZ_CP041261 position: 2091283-2091331, mismatch: 0

aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	CRISPR spacer
aaaaatctgagccagaatgaggttcattctgacccagatttgattttgt	Protospacer
*************************************************

5. NZ_CP041263

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041263_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041263_1

11530-11688

Unclear

Consensus_repeat	Method
AATTTGAGAAACATGCTGTTTTATATGGTTCTAAAAC	PILER-CR

2 spacers

RT,c2c10_CAS-V-U3

The CRISPR arrays of NZ_CP041263_1

>merge|NZ_CP041263|1|11530-11688|PILER-CR
CATGTTGTTTTATATGGTTCTAAAGCAGGAACGCCATCAATTAATTTAAAGTACTCATTTGAGAAACATGCTGTTTTATATGGTTCTAAAACAAACTGCTAGCAATTTCCCTTATCCTAAAAATTTGAGAAACATGCTGTTTTATATGGTTCTAAAACC

>NZ_CP041263|1|1|11530-11688|PILER-CR
CATGTTGTTTTATATGGTTCTAAAGCAGGAACGCCATCAATTA	ATTTAAAGTACTCATTTGAGAAACATG
CTGTTTTATATGGTTCTAAAACAAACTGCTAGCAATTTCCCTT	ATCCTAAAAATTTGAGAAACATGCTGTTT
TATATGGTTCTAAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041263.2\|WP_002320750.1\|1450_1690_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_154080629.1\|15512_15680_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_010730973.1\|18964_19840_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_002347492.1\|13442_13814_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_002320754.1\|3110_3878_-\|JAB-domain-containing-protein	unknown	unknown	gnl\|CDD\|163702
NZ_CP041263.2\|WP_002347493.1\|13864_15493_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369600
NZ_CP041263.2\|WP_002320756.1\|4843_5404_-\|SLATT-domain-containing-protein	unknown	unknown	gnl\|CDD\|380134
NZ_CP041263.2\|WP_002347491.1\|13157_13358_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_002347494.1\|15716_16406_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_060810395.1\|5423_6245_-\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|375587
NZ_CP041263.2\|WP_002350689.1\|11797_13024_-\|hypothetical-protein	c2c10_CAS-V-U3	-	unknown
NZ_CP041263.2\|WP_042957259.1\|6935_8231_-\|Y-family-DNA-polymerase	unknown	unknown	gnl\|CDD\|176454
NZ_CP041263.2\|WP_002347528.1\|6595_6943_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_002350598.1\|1709_1958_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_002320752.1\|1972_2539_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_060811353.1\|8312_10175_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP041263.2\|WP_002320753.1\|2539_3085_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_002321530.1\|16660_16981_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_010730971.1\|17013_18132_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041263.2\|WP_010730972.1\|18160_18955_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP041263.2\|WP_002320756.1\|4843_5404_-\|SLATT-domain-containing-protein	gnl\|CDD\|380134	pfam18186, SLATT_4, SMODS and SLOG-associating 2TM effector domain family 4. The SLATT domain contains two transmembrane helices. SLATT domains are generally predicted to function as pore-forming effectors in a class of conflict systems which are reliant on the production of second messenger nucleotide or nucleotide derivatives. SLATT domains are predicted to initiate cell suicide responses upon their activation. This SLATT family is often coupled to the SMODS nucleotide synthetase and is sometimes further embedded in other conflict systems like CRISPR/Cas or R-M systems.	1.4006e-74
NZ_CP041263.2\|WP_002320754.1\|3110_3878_-\|JAB-domain-containing-protein	gnl\|CDD\|163702	cd08071, MPN_DUF2466, Mov34/MPN/PAD-1 family. Mov34 DUF2466 (also known as DNA repair protein RadC) domain of unknown function contains the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity. However, to date, the name RadC has been misleading and no function has been determined.	1.95049e-43
NZ_CP041263.2\|WP_060811353.1\|8312_10175_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	2.45093e-119
NZ_CP041263.2\|WP_002347493.1\|13864_15493_-\|hypothetical-protein	gnl\|CDD\|369600	pfam07926, TPR_MLP1_2, TPR/MLP1/MLP2-like protein. The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.	0.000119521
NZ_CP041263.2\|WP_060810395.1\|5423_6245_-\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|375587	pfam18144, SMODS, Second Messenger Oligonucleotide or Dinucleotide Synthetase domain. Nucleotide synthetase enzyme of the DNA polymerase beta superfamily. Experimental studies have demonstrated cGAMP synthetase activity in the Vibrio cholerae DncV protein, a member of the SMODS family. The diversity inherent to the SMODS family suggests members of the family could generate a range of nucleotides, cyclic and/or linear. The nucleotide second messengers generated by the SMODS domains are predicted to activate effectors in a class of conflict systems reliant on the production and sensing of the nucleotide second messengers.	3.07078e-40
NZ_CP041263.2\|WP_042957259.1\|6935_8231_-\|Y-family-DNA-polymerase	gnl\|CDD\|176454	cd01700, PolY_Pol_V_umuC, umuC subunit of DNA Polymerase V. umuC subunit of Pol V. Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.	3.03907e-113

>NZ_CP041263.2|WP_060811353.1|8312_10175_-|group-II-intron-reverse-transcriptase/maturase
MENVSASHSIRHMEYYGMIDSFDNLYKESRDDHIFNNLMEIVTSPNNILLAYRNIKGNSGSVSPGVDNKNIDDLKEIPNADFIRIVQGKFSEYKPQPVKRVEIPKPNGKNRPLGIPTIWDRIVQQCLLQVLEPIMEAKFHDKNYGFRPNRSAHHALAQAVRLAQLSKLTFVVDIDIEGFFDNVNHSKLIKQLWTLGIQDRWLLGVIRAMLKAPIIHKDGRIEHPKKGTPQGGILSPLLANVVLNELDWWISSQWETHPTRHNYDCYQANQGYWNKGNKYRALRRSKLKEIYIVRYADDFKIFCRRRSDADNIFIATKLWLKERLKLDISLEKSKVVNLKKKKSEFLGFTMKLVRKRKTFVIETHMCPKAMKKVSDNLIKQIKVIQHTPTKEDLQKQLVKYNSMVIGIHQYYRRATHISVDCPKINQRIRIIIKNRLDVKKNGSPPSDFVKKNYARSKQLRWINGYPMIPLGFVKHSHTSLPKMGICKYTPEGRVLIHKYLTFPIDIINQLMNMNNPDESIEFRDNRVSKYSAQRGRCRVTKELLELEDIYCHRIIPKNLGGKDNFQNLVIIHQNIHQLIHENDRTRASLLITKMRITGAQLEIINQFRKKAQKCELSLNL
>NZ_CP041263.2|WP_042957259.1|6935_8231_-|Y-family-DNA-polymerase
MEIISKDYLSLSSVECIERNLDPMTTPLIVMSRSDNTGSGLTLASSPTAKKKYHITNVSRATDLPYPLPKELHIVPPRMNLYIKKNMEVNQIFRKYVADEDLLIYSIDESILKVTKSLNLFTSSGTRSERRRELAKIIKDEIQKETGLIATVGIGDNPLLAKLALDNEAKSSKEFIAEWTYETVPEKIWKINEMTDFWGIGSRMKKRLNHMGIMSIEDLANWNPYTIKSQLGVIGLQLYFHTNGIDRTDIAIPPEPTKEKSYGNSQVLPKDYTRREEVELVVKEMAEQVAIRIRQHNCKTGCVRLAIGTSILEEKSGFSHQMKIPITDNTKELQNYCLFLFNKFYEGQEVRHIGVTYSRLVYTDSLQLDLFSDPRKKIAEENLDRIIDKIRQKYGFTAIIHASSMLEGARSITRSTLIGGHAGGLGGLHND
>NZ_CP041263.2|WP_002347528.1|6595_6943_-|hypothetical-protein
MIEYNDRGRLKWSGFYLSDHTERINADNVQRANHNLAKEQMTTEEIAKILRTAVIKNRPVCIQKEERNAEGYYPDDVVGKIIGYDELGVFVEEEKVHYDEIRNVSFSELLKWSQI
>NZ_CP041263.2|WP_060810395.1|5423_6245_-|nucleotidyltransferase-domain-containing-protein
MGLLVPRANTYTIPLTKRQLIAERYQRITRAINREFWNSESDTAHSLYVGSYGRGTAISTSDIDIIVELPMAEFDRFKNYLSNGPSKLLQVIKNAFQEILPNSDIRADGQVVKINFHDGIKFEIVPAFNEKDYWGESKGFIYPDSNMGGNWKATNPKKEQEAMKLKNTKSNNLLYATCKHFRHVRDTEFTSYHLSGIVIDSFVYEAMGNWKFVENNSGGQNISSVSYETALLEYYNSHKVMGGLNLYSPGSNQFVNSDSSIICLEKVLKKIAL
>NZ_CP041263.2|WP_002320756.1|4843_5404_-|SLATT-domain-containing-protein
MGDEKKRLEVQLREAYGRVTYTYTTHLKQADNIISDNKILRCLQIGLSALTTGGVLSTIITDNSELTFVAGLCSTISLGLNLYFKNFDLAEEAKNHQIVADKLWLIREEYVSLLTDLNRLSVEDIVKKRDQLMNETHEAYKNAPKTNSKSYESAQKALKSEEEQFFTEEELDKMLPEHLRKKSSKY
>NZ_CP041263.2|WP_002320754.1|3110_3878_-|JAB-domain-containing-protein
MRDRILEVNQEMVNKLTNISGNYEKYDGTLLDNYIFHDTQNIRIGRSKPRAFILIKEKYLNEWNSTYEMVMTDNFEKVLDFRNALLGSDMGNSSLESIEVENKTENEGEGLIKNVLKIEQKYISEDRSFYRVTSSVGLANFATNLIGNNASESLLVMCLNTKNEVIAYSEVFKGGINQSVAIPREIFQLALLNNSAKIAVSHNHPSGYEFPSENDKSFTTNLKNAGKTIGIELLDHIIVTSKNTSYYSFQENGSL
>NZ_CP041263.2|WP_002320753.1|2539_3085_-|hypothetical-protein
MGERTQALITVKYGNSKTKASVSIHYQWGYGRYMLMDVLNQGIYLINKAYDLRDKSREELAKGIFDRSTGVINFVTYESGVSAYDETGFGGRYEPYQETIEDVMKFSDNNDGYAHLEMVFDENGFSLDDKTRLRLFDFEGQQIGLNKFCESGKEFATKDFIKGYRLLLENYGINLEEESVK
>NZ_CP041263.2|WP_002320752.1|1972_2539_-|hypothetical-protein
MFEKRKDQFPNLEAKSQKVIDGEMIELFQKSYGTIETTASCKYYFQGKRNTFKGFADSDEELAKKIIDWLVSSEHVAREDTVRTTINGEVLTGTRCVCCNHEFVEDEGCYRINEYGDFICQSCHEIEFPTERSWFEYMLQDYEMEKENGEVVFCTKEELSKRSDDEIEDWCVWLVGADDCVAYYTTAE
>NZ_CP041263.2|WP_002350598.1|1709_1958_-|hypothetical-protein
MEGMDFLDHEDLVDFGYTWKGMVGISRSLANAFYERNYAVYVLYDDDTESLVDEEYKLDLENVLYGIEKEDLAKYIFSWLGQ
>NZ_CP041263.2|WP_002320750.1|1450_1690_-|hypothetical-protein
MTKFKSKGMQWCSYYYVGNDEDLLRKTQRKGYPDKILKQIGYYMPEERIEKEFCEVLFDSEQLLVLLTQNKLICQFENN
>NZ_CP041263.2|WP_002350689.1|11797_13024_-|hypothetical-protein
MIFYMFININEVLKLTTITMTKKIEVYVDGSQEERDSFFDFFWKNSREYVKALNLVYKQLMFEELIKDAIKEMDQGYAEREESIQNRIEKLAYTDPIDQKKLDKAKAELSKLRNEKNKEAREILTQAIGLKSQTRTRDVAKKLDFDFGDFVDSANMKASKDFGNDFIGIVTGQRTPRIYKNRNKYGLLPFRGRDIKIHKDDKFYIYLPKGFRFKVNLGSKPRKARDVASVLQHIMDGDYKLNQSNLIFDGRKLFFNLTISFEKSYNEMEFKKGNELIVNFADLCSGECLINDKSVMSFGDSQYIRNFKSKILAMKSKEQSRGVFSKGGHGRKRKLDQDRWEAIKKRESNFVKTYNNQCSAKIVKTAIRNKAQIIRIIEPDKAYGEWAYYQLKEQLVNKGKRYGIEVRS
>NZ_CP041263.2|WP_002347491.1|13157_13358_-|hypothetical-protein
MLKRIAWDKDNKTDIELKEYKYNYFSRCIDRKLLFKKEGLEFSFDEDEFEKLVMDWRKNLLDTVQF
>NZ_CP041263.2|WP_002347492.1|13442_13814_-|hypothetical-protein
MRELTLSSKELEKKTALLNEIFSADCIIQSLKESSFSKLTDQEKISYMLSLDNLGTKYDESASSDKLLIELVSSLSSFGKMKRFNVILEIFAWLIPSFIWFFYIFIVESELIAKVSLGLLIPI
>NZ_CP041263.2|WP_002347493.1|13864_15493_-|hypothetical-protein
MPEIEGIFSPKIGKKQLDFSSFPSVNRDYNLGDEVQILNIDFKELDFAVAVSNKPKALERVKKIYQENDQNIKNMIKKYRRDNSKVEDVLFNGTAKHDLNVYMALGVALYCNSINQTDILVNIVRNSYQKILKISSETNPYYAMKYLGDNLLNDKKLMHNTEELLSNLAAINFLFKTGSEDYFIDNVLKGAYGTAFYPLYNMKQHKAEQKDNKLEIKKMKELLGIGFVKPNSKVTIASLATTNNDGKIVNGFDDSDIDILSKSYFSLYGDFADLMGIDSYLVNNFEIKGSELNDIVYFVLISLYAIDQNTEYRQIDYLLVFYSLLYQFVLTRLFKNAKEELILNSDYEIAKQIASIRKENKSEVIKLRKELSIASKENGRLESLVKSAKKEEELLKQEIKELKGIRKELEQLRFENKVLKQLQEQEHRQSLNGKTEEPSLSEMIAYLKHKNILLVGGHVNFQNKLTELLPNIKMFDVSENNGKILKNLNTCDAIFLYTDYLNHGLYYRVMSEISNKDKIFYLDNHVNMNLTIKRIYDLLSLI
>NZ_CP041263.2|WP_154080629.1|15512_15680_-|hypothetical-protein
MVNEVETLLASFFENGHVNDEWRKEEPKRVNAYIARLKRFIDKYKENSDKFSKDK
>NZ_CP041263.2|WP_002347494.1|15716_16406_-|hypothetical-protein
MRTHYIYLEDKIVDEIPAKSREQARKLFIEKYKEINGDSEVPKVVVTVRKRQTKKRSTFHVSPDIYNLIERHRSEDNISISQYIATVIDELISGKYDYAFDFEGEKDYKSVAVFQSDFEKLKNYAGRRNVNFARLLEEFYSEELGVGNEYKRETYAKLSHKLSQALKEVTEVKAELDAKLEEVKKYQTERKNNMKNQVEFDEQKEFEKARKRYNKIMNELSYEHLTVHE
>NZ_CP041263.2|WP_002321530.1|16660_16981_-|hypothetical-protein
MKKKIVEGNVGVIILKDSTDYAKSMALKDEKVARMDKDLVEFLMDDTERLKGDQFLSLMKDKGLNTYGLFDYKKLAIEWVKEGEIFFIEEWEGTENLVLHQYLLKA
>NZ_CP041263.2|WP_010730971.1|17013_18132_-|hypothetical-protein
MGNNSIYTPEMQNKIKRLVGLGWMTRGKLDSFSTIKYLLMDIYRQNKQTGIHFLGYDKPEDAPFFVPSSAYRASTSGSMYNLDLFEEGAKMIEYDFNEAYSRIMRNYPLPSNTYLKAKYNTDQAILRAINRPKVRPYENLKTYMFFLVNFEGTAKEGTYANPKSQSMFADYGENPKTANEPIWLSEIELTLILDYYDIKEMEVLDSHTFLTKKGLLKEYFERIEPLKTDPDTLKLYKNLRTKVFGAIGQKSLREGETSTFDKYSMYNRAYSSMVAGVFRDRMVRYEQKYVHSAYGLLKIRTDGLYFRSEVPEFEELYKLGVVKKKVHTISKEEVEKALEFKNKGFENKGSFGKSKDEVKGVVIDDDFEFDFD
>NZ_CP041263.2|WP_010730972.1|18160_18955_-|hypothetical-protein
MVAKKNTLKEASEKYQDMKRRGLIPKDKKGIWREFVKEVSSDRSGGDFVGRYTAKGYSRRLRITVEYGTNESATELKQRYLDTRREASKKYDDFKSRGLIPKKKKGIWREFFKEEDSNRNKGDFIGRYTAKGYTKNLGIKVEYGTGESSWELRNRYLNTLLEKYKAELLELFDVNDFIEMAEKYGHEEGFMINDIMVIDNFTDLLALAKKARDLRETQMYLFRNKNGRNRRTESSEIEDYYDAFTHDLGAFVDEISGVMNKYRV
>NZ_CP041263.2|WP_010730973.1|18964_19840_-|hypothetical-protein
MTTNKRWSELVQNTVKKVMPDGYHFNYIQCSQTTESIYFSILNENRLYYFRVSSHHRKKREDNVTTFLSGKYNGFKELSEAIGEYLKSNRFVRISDKHILILLLYLNNSFKLFWRDDTFYYIENGMDIYSGINGILKHYIKALLRYGVLYQEDLSNQIKISNSGKSLLAKYKKLLSPIYKGIDMEAVNSETLFNLVVDEKFANEFFKSKKIERLNNLFPENAIKAYVDNNKSRLYNWFIPKRLRGKIKIGDQVKVINLNHTKIVTVTELYIAEKEDITKMKPVIKILDNKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11554-11580	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	11093-11119	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	11243-11269	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	8059-8085	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	6270-6296	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	16746-16772	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2476-2502	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040238	Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence	20567-20593	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8436-8462	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LT598665	Enterococcus faecium isolate Ef_aus00233 plasmid 3	2727-2753	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	136823-136849	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85401-85427	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	123909-123935	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78222-78248	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	136753-136781	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	85331-85359	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	123773-123801	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	123839-123867	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	78152-78180	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	11622-11650	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	11161-11189	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	11311-11339	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	8127-8155	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	6338-6366	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	2544-2572	0	1.0
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	8504-8532	0	1.0
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	55975-56001	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	98743-98769	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	52170-52196	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	60987-61013	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	43270-43296	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	6156-6182	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	4729-4755	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	4824-4850	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	4729-4755	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	4824-4850	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	71713-71739	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	183283-183309	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	39536-39562	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	90524-90550	1	0.963
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	4824-4850	1	0.963
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP020486	Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence	1021-1049	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP027519	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence	18674-18702	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135342	Enterococcus faecium isolate E7356 plasmid 4	28090-28118	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135295	Enterococcus faecium isolate E7237 plasmid 3	4029-4057	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NC_010880	Enterococcus faecium plasmid pEF1, complete sequence	14007-14035	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135346	Enterococcus faecium isolate E8202 plasmid 3	16824-16852	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135353	Enterococcus faecium isolate E8014 plasmid 3	32701-32729	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR134110	Enterococcus faecium isolate E6043 plasmid 6	8201-8229	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP018067	Enterococcus faecium strain E1 plasmid pE1_29, complete sequence	7322-7350	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135300	Enterococcus faecium isolate E7429 plasmid 4	10919-10947	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135491	Enterococcus faecium isolate E8414 plasmid 4	27218-27246	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135366	Enterococcus faecium isolate E8195 plasmid 3	20506-20534	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135403	Enterococcus faecium isolate E8377 plasmid 3	8916-8944	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135396	Enterococcus faecium isolate E8290 plasmid 3	54027-54055	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_LR135387	Enterococcus faecium isolate E7933 plasmid 4	27113-27141	1	0.966
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP044276	Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence	9617-9645	1	0.966
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	215525-215551	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	46724-46750	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	104416-104442	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	90076-90102	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	287699-287725	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	352514-352540	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	115577-115603	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	12155-12181	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	75627-75653	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	6849-6875	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	47723-47749	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	5681-5707	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135261	Enterococcus faecium isolate E4457 plasmid 4	37694-37720	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041258	Enterococcus faecium strain 515 plasmid p27, complete sequence	75809-75835	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135477	Enterococcus faecium isolate E8423 plasmid 3	6957-6983	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	48702-48728	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	86386-86412	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	97410-97436	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	42200-42226	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	8505-8531	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	92660-92686	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	47621-47647	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	29110-29136	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	35528-35554	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	44723-44749	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	11094-11120	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	43129-43155	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	164276-164302	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP011283	Enterococcus faecium strain E39 plasmid p2, complete sequence	6439-6465	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	6759-6785	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	20787-20813	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	4729-4755	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	15135-15161	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	102250-102276	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	4841-4867	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	8498-8524	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	8381-8407	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	4748-4774	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	4841-4867	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	4749-4775	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135289	Enterococcus faecium isolate E7199 plasmid 3	12899-12925	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	4373-4399	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	157897-157923	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	4452-4478	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	4749-4775	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	62597-62623	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	6264-6290	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	4452-4478	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	8497-8523	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135238	Enterococcus faecium isolate E7067 plasmid 4	4730-4756	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	7119-7145	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	59578-59604	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	6710-6736	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	6759-6785	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	4373-4399	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	5439-5465	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	4452-4478	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135207	Enterococcus faecium isolate E7171 plasmid 5	4729-4755	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	5497-5523	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	4729-4755	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	8779-8805	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	10388-10414	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	4841-4867	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	6343-6369	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	6425-6451	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	4373-4399	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	4373-4399	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	206637-206663	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	23849-23875	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	8497-8523	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	10092-10118	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	8497-8523	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	45026-45052	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	7876-7902	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	7712-7738	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	6732-6758	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	6155-6181	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	29953-29979	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	29953-29979	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	6155-6181	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	6155-6181	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	5497-5523	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	6156-6182	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	6264-6290	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	5439-5465	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	4729-4755	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	4840-4866	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	118213-118239	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135309	Enterococcus faecium isolate E7240 plasmid 3	40230-40256	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	4841-4867	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	1650-1676	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	29953-29979	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	4730-4756	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	29953-29979	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	65573-65599	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	9113-9139	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	15135-15161	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	37707-37733	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	29953-29979	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	29953-29979	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	6714-6740	2	0.926
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	355-381	3	0.889
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_LR135205	Enterococcus faecium isolate E7171 plasmid 3	30104-30130	3	0.889
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	181277-181303	3	0.889
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NZ_CP016165	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence	50324-50350	3	0.889
NZ_CP041263_1	1.1\|11573\|27\|NZ_CP041263\|PILER-CR	11573-11599	27	NC_022883	Enterococcus mundtii QU 25 plasmid pQY082, complete sequence	33166-33192	4	0.852
NZ_CP041263_1	1.2\|11643\|29\|NZ_CP041263\|PILER-CR	11643-11671	29	NZ_CP026693	Nostoc sp. 'Lobaria pulmonaria (5183) cyanobiont' strain 5183 plasmid pNLP1, complete sequence	109882-109910	7	0.759

1. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

2. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

3. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

4. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

5. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

6. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

7. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

8. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040238 (Enterococcus faecium strain VB3025 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

9. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

10. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LT598665 (Enterococcus faecium isolate Ef_aus00233 plasmid 3) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

11. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

12. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

13. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

14. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

gcaggaacgccatcaattaatttaaag	CRISPR spacer
gcaggaacgccatcaattaatttaaag	Protospacer
***************************

15. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

16. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

17. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

18. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

19. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

20. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

21. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

22. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

23. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

24. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

25. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

26. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 0, identity: 1.0

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactgctagcaatttcccttatcctaaa	Protospacer
*****************************

27. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

28. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

29. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

30. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

31. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

32. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

33. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

34. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

35. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

36. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

37. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

38. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

39. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

40. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

41. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 1, identity: 0.963

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcaattaatttaaag	Protospacer
 **************************

42. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP020486 (Enterococcus faecium strain CFSAN059070 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

43. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP027519 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

44. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135342 (Enterococcus faecium isolate E7356 plasmid 4) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

45. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135295 (Enterococcus faecium isolate E7237 plasmid 3) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

46. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NC_010880 (Enterococcus faecium plasmid pEF1, complete sequence) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

47. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135346 (Enterococcus faecium isolate E8202 plasmid 3) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

48. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135353 (Enterococcus faecium isolate E8014 plasmid 3) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

49. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR134110 (Enterococcus faecium isolate E6043 plasmid 6) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

50. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP018067 (Enterococcus faecium strain E1 plasmid pE1_29, complete sequence) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

51. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135300 (Enterococcus faecium isolate E7429 plasmid 4) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

52. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135491 (Enterococcus faecium isolate E8414 plasmid 4) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

53. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135366 (Enterococcus faecium isolate E8195 plasmid 3) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

54. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135403 (Enterococcus faecium isolate E8377 plasmid 3) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

55. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135396 (Enterococcus faecium isolate E8290 plasmid 3) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

56. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_LR135387 (Enterococcus faecium isolate E7933 plasmid 4) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

57. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP044276 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-2, complete sequence) position: , mismatch: 1, identity: 0.966

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactactagcaatttcccttatcctaaa	Protospacer
*****.***********************

58. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

59. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

60. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

61. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

62. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

63. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

64. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

65. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

66. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

67. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

68. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

69. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

70. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135261 (Enterococcus faecium isolate E4457 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

71. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041258 (Enterococcus faecium strain 515 plasmid p27, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

72. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135477 (Enterococcus faecium isolate E8423 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

73. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

74. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

75. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

76. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

77. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

78. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

79. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

80. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

81. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

82. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

83. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

84. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

85. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

86. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP011283 (Enterococcus faecium strain E39 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

87. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

88. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

89. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

90. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

91. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

92. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

93. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

94. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

95. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

96. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

97. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

98. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

99. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

100. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

101. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

102. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

103. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135289 (Enterococcus faecium isolate E7199 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

104. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

105. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

106. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

107. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

108. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

109. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

110. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

111. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

112. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

113. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135238 (Enterococcus faecium isolate E7067 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

114. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

115. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

116. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

117. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

118. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

119. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

120. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

121. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

122. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

123. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

124. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135207 (Enterococcus faecium isolate E7171 plasmid 5) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

125. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

126. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

127. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

128. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

129. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

130. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

131. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

132. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

133. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

134. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

135. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

136. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

137. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

138. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

139. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

140. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

141. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

142. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

143. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

144. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

145. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

146. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

147. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

148. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

149. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

150. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

151. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

152. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

153. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

154. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

155. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

156. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

157. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

158. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

159. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

160. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

161. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

162. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

163. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

164. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

165. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

166. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

167. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

168. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135309 (Enterococcus faecium isolate E7240 plasmid 3) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

169. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

170. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

171. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

172. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

173. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

174. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

175. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

176. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

177. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

178. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

179. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

180. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

181. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 2, identity: 0.926

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatttaaag	Protospacer
 *************.************

182. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 3, identity: 0.889

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatctaaag	Protospacer
 *************.******.*****

183. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_LR135205 (Enterococcus faecium isolate E7171 plasmid 3) position: , mismatch: 3, identity: 0.889

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacaccattaattaatttaaag	Protospacer
 *******.****.*************

184. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatctaaag	Protospacer
 *************.******.*****

185. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NZ_CP016165 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p2, complete sequence) position: , mismatch: 3, identity: 0.889

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgattaatctaaag	Protospacer
 *************.******.*****

186. spacer 1.1|11573|27|NZ_CP041263|PILER-CR matches to NC_022883 (Enterococcus mundtii QU 25 plasmid pQY082, complete sequence) position: , mismatch: 4, identity: 0.852

gcaggaacgccatcaattaatttaaag	CRISPR spacer
tcaggaacgccatcgatcaatttaaaa	Protospacer
 *************.**.********.

187. spacer 1.2|11643|29|NZ_CP041263|PILER-CR matches to NZ_CP026693 (Nostoc sp. 'Lobaria pulmonaria (5183) cyanobiont' strain 5183 plasmid pNLP1, complete sequence) position: , mismatch: 7, identity: 0.759

aaactgctagcaatttcccttatcctaaa	CRISPR spacer
aaactggtagcaatttcccctatcagtgc	Protospacer
****** ************.****   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27508 : 78034

Staphylococcus_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016922336.1\|27508_28108_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002320853.1\|29164_29794_-	hypothetical protein	NA	NA	NA	NA
WP_002320854.1\|29790_31167_-	cell division protein FtsK	G1FGP1	Mycobacterium_phage	3.8e-48	42.2
WP_002320855.1\|31246_32509_-	hypothetical protein	NA	NA	NA	NA
WP_002320856.1\|32521_32869_-	hypothetical protein	NA	NA	NA	NA
WP_010729859.1\|32888_33758_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_002320858.1\|33989_34796_-	hypothetical protein	NA	NA	NA	NA
WP_010730977.1\|34883_35684_-	hypothetical protein	U5PTP5	Bacillus_phage	9.3e-07	36.3
WP_002350582.1\|36022_37132_-	class C sortase	NA	NA	NA	NA
WP_002350583.1\|37121_37985_-	class C sortase	NA	NA	NA	NA
WP_002350584.1\|38053_39889_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002347449.1\|39937_42328_-	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_025478707.1\|42595_43843_-	C39 family peptidase	NA	NA	NA	NA
WP_002347447.1\|44235_44652_+	hypothetical protein	NA	NA	NA	NA
WP_002347446.1\|44668_45406_-	hypothetical protein	NA	NA	NA	NA
WP_002347445.1\|45827_46391_-	hypothetical protein	NA	NA	NA	NA
WP_002321012.1\|46377_46905_-	hypothetical protein	NA	NA	NA	NA
WP_002352866.1\|46927_48265_-	CHAP domain-containing protein	Q859L3	Staphylococcus_phage	6.5e-37	54.0
WP_002347443.1\|48384_48864_+	hypothetical protein	NA	NA	NA	NA
WP_002347440.1\|49213_49531_-	hypothetical protein	NA	NA	NA	NA
WP_002347439.1\|49641_49824_-	hypothetical protein	NA	NA	NA	NA
WP_010730980.1\|49860_50661_-	hypothetical protein	NA	NA	NA	NA
WP_060804948.1\|51212_51521_-	hypothetical protein	NA	NA	NA	NA
WP_002347720.1\|51682_52213_-	hypothetical protein	NA	NA	NA	NA
WP_002347509.1\|52228_52594_-	hypothetical protein	NA	NA	NA	NA
WP_002347508.1\|52599_53343_-	hypothetical protein	NA	NA	NA	NA
WP_002347507.1\|53473_54196_-	hypothetical protein	NA	NA	NA	NA
WP_002347506.1\|54201_54447_-	hypothetical protein	NA	NA	NA	NA
WP_002347505.1\|54457_55042_-	hypothetical protein	NA	NA	NA	NA
WP_000195429.1\|55385_56558_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_080441776.1\|56747_58079_+	hypothetical protein	NA	NA	NA	NA
WP_010729677.1\|58335_58671_-	hypothetical protein	NA	NA	NA	NA
WP_002323589.1\|58877_60026_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
WP_002287522.1\|60042_60447_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002320766.1\|60956_62927_-	hypothetical protein	NA	NA	NA	NA
WP_002320767.1\|62941_63808_-	hypothetical protein	NA	NA	NA	NA
WP_002320768.1\|63797_64031_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002347429.1\|64042_66199_-	hypothetical protein	NA	NA	NA	NA
WP_002347431.1\|66549_66888_-	hypothetical protein	NA	NA	NA	NA
WP_010729680.1\|67287_70929_-	hypothetical protein	NA	NA	NA	NA
WP_010729681.1\|70931_72881_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2I7REQ1	Vibrio_phage	2.3e-30	24.7
WP_010729682.1\|72922_73981_-	hypothetical protein	NA	NA	NA	NA
WP_002320776.1\|74099_74555_-	hypothetical protein	NA	NA	NA	NA
WP_010729683.1\|75139_75943_-	replication initiation protein	NA	NA	NA	NA
WP_000997695.1\|76855_78034_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage