CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP042393	Leuconostoc citreum strain CBA3623 chromosome, complete genome	0 crisprs	DEDDh,cas3	0	8
NZ_CP042395	Leuconostoc citreum strain CBA3623 plasmid unnamed2, complete sequence	0 crisprs	csa3	0	0
NZ_CP042397	Leuconostoc citreum strain CBA3623 plasmid unnamed4, complete sequence	1 crisprs	NA	1	0
NZ_CP042398	Leuconostoc citreum strain CBA3623 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
NZ_CP042394	Leuconostoc citreum strain CBA3623 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP042396	Leuconostoc citreum strain CBA3623 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

67797 : 87502

Leuconostoc_phage(70.59%)

integrase,transposase

attL 68663:68677|attR 86965:86979

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147002083.1\|67797_68784_-	Abi family protein	A0A0N7IRA5	Lactobacillus_phage	3.2e-25	30.8
68663:68677	attL	NA	NA	NA	NA
WP_147002084.1\|68915_69305_-	hypothetical protein	NA	NA	NA	NA
WP_147002085.1\|69440_70262_-	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_147002086.1\|70755_71187_-	hypothetical protein	A0A097BYJ1	Leuconostoc_phage	3.1e-73	92.3
WP_147002087.1\|71187_71556_-	helix-turn-helix domain-containing protein	A0A097BYI9	Leuconostoc_phage	3.5e-41	75.4
WP_147002088.1\|71817_72081_+	hypothetical protein	A0A097BYE6	Leuconostoc_phage	1.6e-27	77.4
WP_147002089.1\|72181_72343_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_147002090.1\|72342_72555_+	hypothetical protein	NA	NA	NA	NA
WP_147002091.1\|72545_72779_+	hypothetical protein	A0A097BYJ6	Leuconostoc_phage	7.5e-26	67.4
WP_147002092.1\|72794_73073_+	hypothetical protein	NA	NA	NA	NA
WP_147002470.1\|73069_73390_+	Rrf2 family transcriptional regulator	A0A097BYF1	Leuconostoc_phage	1.5e-45	96.0
WP_147002093.1\|73392_73599_+	hypothetical protein	A0A097BYF2	Leuconostoc_phage	2.7e-27	91.2
WP_100665230.1\|73595_73778_+	hypothetical protein	A0A097BYL1	Leuconostoc_phage	2.6e-21	88.3
WP_147002094.1\|73780_74602_+	DNA replication protein	B3GVY7	Streptococcus_phage	1.8e-13	28.4
WP_147002095.1\|74588_76016_+	hypothetical protein	NA	NA	NA	NA
WP_147002096.1\|76344_76671_+	hypothetical protein	NA	NA	NA	NA
WP_147002097.1\|76681_77026_+	hypothetical protein	NA	NA	NA	NA
WP_147002098.1\|77169_77370_+	hypothetical protein	A0A097BYD9	Leuconostoc_phage	1.8e-28	86.4
WP_147002099.1\|77489_78611_+\|integrase	tyrosine-type recombinase/integrase	A0A097BYJ7	Leuconostoc_phage	3.8e-200	90.9
WP_147002471.1\|79101_80307_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.3e-100	48.5
WP_147002100.1\|80747_81287_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_004907448.1\|81512_82034_-	hypothetical protein	NA	NA	NA	NA
WP_004907445.1\|82234_82984_-	class I SAM-dependent methyltransferase	A0A097BYE1	Leuconostoc_phage	7.2e-102	74.1
WP_147002472.1\|83055_83568_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	5.8e-63	66.5
WP_004900243.1\|83627_84062_-	hypothetical protein	Q8LTR6	Lactococcus_phage	4.1e-25	43.0
WP_004907441.1\|84234_84999_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_147002101.1\|85110_85482_-	helix-turn-helix domain-containing protein	A0A097BYI9	Leuconostoc_phage	5.4e-26	52.8
WP_100665244.1\|85772_85967_+	hypothetical protein	NA	NA	NA	NA
WP_004907434.1\|86017_86311_+	hypothetical protein	NA	NA	NA	NA
WP_048801812.1\|86539_87502_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.1e-21	28.3
86965:86979	attR	NA	NA	NA	NA

DBSCAN-SWA_2

162967 : 173267

Streptococcus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004905154.1\|162967_165127_+	LTA synthase family protein	W6LM83	Streptococcus_phage	5.8e-136	43.4
WP_004900068.1\|165199_167206_+	excinuclease ABC subunit UvrB	A0A2K9VDA5	Lactobacillus_phage	5.2e-06	26.2
WP_004900066.1\|167325_170196_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.2e-284	52.5
WP_004900061.1\|170619_171594_+	YvcK family protein	A1IMD5	Streptococcus_phage	3.7e-82	48.8
WP_004905152.1\|171593_172538_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	6.2e-42	36.0
WP_004900057.1\|172664_173267_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.1e-47	52.8

DBSCAN-SWA_3

345242 : 355283

Streptococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147002163.1\|345242_347039_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.7e-54	30.2
WP_004904228.1\|347684_348776_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	6.4e-75	44.9
WP_004900387.1\|348772_349951_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	2.8e-84	41.8
WP_004900384.1\|349959_350448_+	phosphatidylglycerophosphatase A	A0A0A7DMW7	Lactobacillus_phage	3.7e-14	35.0
WP_004900382.1\|350571_351294_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_133286229.1\|351338_351791_-	flavodoxin	NA	NA	NA	NA
WP_004900379.1\|352042_352762_+	aquaporin family protein	M1H9L8	Acanthocystis_turfacea_Chlorella_virus	2.4e-22	31.8
WP_004908108.1\|353321_355283_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.4e-101	33.3

DBSCAN-SWA_4

572114 : 579710

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147002234.1\|572114_573158_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.4e-34	32.3
WP_147002235.1\|573142_573742_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	9.7e-25	35.4
WP_147002236.1\|573731_574934_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.8e-86	42.9
WP_004901658.1\|574957_575431_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.9e-31	46.8
WP_139988093.1\|575517_576714_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_099045024.1\|576792_577719_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_147002477.1\|577810_578416_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	4.8e-48	50.5
WP_147002237.1\|578405_579710_+	NADPH-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.4e-51	46.6

DBSCAN-SWA_5

615917 : 667955

unidentified_phage(31.25%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147002250.1\|615917_616838_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.4e-30	31.8
WP_147002251.1\|617331_617739_+	hypothetical protein	NA	NA	NA	NA
WP_013231590.1\|617846_619010_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.9e-22	27.9
WP_147002252.1\|619200_620523_+	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	2.4e-84	39.5
WP_013231592.1\|620549_620921_+	hypothetical protein	E3W8I0	Leuconostoc_phage	1.7e-11	36.3
WP_013231593.1\|620917_621172_+	hypothetical protein	NA	NA	NA	NA
WP_147002253.1\|621943_623194_-	3'-5' exonuclease	A0A0K2CPD3	Brevibacillus_phage	9.4e-06	34.0
WP_147002254.1\|623612_626687_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	2.1e-22	22.7
WP_147002255.1\|626686_628282_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.6e-122	47.2
WP_147002256.1\|628274_629453_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	8.3e-28	29.1
WP_147002257.1\|629533_629746_+	hypothetical protein	NA	NA	NA	NA
WP_147002258.1\|629926_630715_+	hypothetical protein	NA	NA	NA	NA
WP_147002259.1\|632065_633037_+	serine-rich aggregation substance UasX	NA	NA	NA	NA
WP_147002260.1\|633072_634020_+	conjugal transfer protein	NA	NA	NA	NA
WP_010390725.1\|634032_634260_+	hypothetical protein	NA	NA	NA	NA
WP_147002261.1\|634261_634627_+	hypothetical protein	NA	NA	NA	NA
WP_147002262.1\|634758_635349_+\|tRNA	alanyl-tRNA synthetase	NA	NA	NA	NA
WP_147002479.1\|635428_637420_+	hypothetical protein	NA	NA	NA	NA
WP_147002263.1\|637419_638595_+	CHAP domain-containing protein	NA	NA	NA	NA
WP_029510881.1\|638599_639124_+	hypothetical protein	NA	NA	NA	NA
WP_147002264.1\|639113_639680_+	hypothetical protein	NA	NA	NA	NA
WP_050892270.1\|639752_640157_+	thiol-disulfide isomerase	NA	NA	NA	NA
WP_147002265.1\|640156_642655_+	conjugal transfer protein	NA	NA	NA	NA
WP_050892255.1\|642647_642980_+	hypothetical protein	NA	NA	NA	NA
WP_099045054.1\|642979_643288_+	hypothetical protein	NA	NA	NA	NA
WP_010390709.1\|643291_644686_+	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	2.6e-41	28.9
WP_099044490.1\|644685_645033_+	hypothetical protein	NA	NA	NA	NA
WP_147002266.1\|644991_645909_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	8.4e-28	30.1
WP_146973100.1\|646133_646772_+	hypothetical protein	NA	NA	NA	NA
WP_010382145.1\|646856_647540_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.9e-29	33.2
WP_050892443.1\|647532_648864_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_039777466.1\|649148_649793_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_010382138.1\|649851_650091_+	hypothetical protein	NA	NA	NA	NA
WP_010382137.1\|650165_650510_+	hypothetical protein	NA	NA	NA	NA
WP_089998543.1\|650564_650813_+	hypothetical protein	NA	NA	NA	NA
WP_050892376.1\|652154_652451_+	hypothetical protein	NA	NA	NA	NA
WP_147002267.1\|652859_654530_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004912965.1\|654605_654866_+	hypothetical protein	NA	NA	NA	NA
WP_099044487.1\|654937_655348_+	hypothetical protein	NA	NA	NA	NA
WP_099044486.1\|655347_655719_+	hypothetical protein	NA	NA	NA	NA
WP_146973022.1\|655842_657102_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-25	29.7
WP_147002268.1\|657418_659377_+	hypothetical protein	NA	NA	NA	NA
WP_147002480.1\|659591_659891_+	hypothetical protein	NA	NA	NA	NA
WP_147002269.1\|659946_661920_+	hypothetical protein	NA	NA	NA	NA
WP_095652687.1\|661916_662525_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-19	35.6
WP_068852682.1\|662656_663412_+	hypothetical protein	NA	NA	NA	NA
WP_095652686.1\|663428_664019_+	AAA family ATPase	A0A2R8FG22	Brazilian_cedratvirus	6.0e-11	26.8
WP_147002270.1\|664164_665349_+	DUF3578 domain-containing protein	NA	NA	NA	NA
WP_147002250.1\|665392_666313_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.4e-30	31.8
WP_147002271.1\|667034_667955_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.3e-30	31.4

DBSCAN-SWA_6

685341 : 733751

Streptococcus_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147002272.1\|685341_686238_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.1e-46	39.2
WP_147002273.1\|686189_686690_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004902991.1\|686772_687258_-	hypothetical protein	NA	NA	NA	NA
WP_004906172.1\|687348_689499_-	hypothetical protein	NA	NA	NA	NA
WP_147002274.1\|689491_692536_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_147002275.1\|692522_694412_-	AAA domain-containing protein	A0A248SJW6	Salicola_phage	2.0e-71	32.8
WP_147002276.1\|694404_694884_-	hypothetical protein	NA	NA	NA	NA
WP_147002277.1\|694894_697147_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_004903004.1\|697143_697404_-	hypothetical protein	NA	NA	NA	NA
WP_004903008.1\|697861_698245_+	hypothetical protein	NA	NA	NA	NA
WP_004903009.1\|698255_698624_+	hypothetical protein	NA	NA	NA	NA
WP_004903011.1\|698630_699152_+	hypothetical protein	NA	NA	NA	NA
WP_004903014.1\|699211_699427_+	hypothetical protein	NA	NA	NA	NA
WP_004903016.1\|699426_699687_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	3.7e-21	54.7
WP_004903019.1\|700101_700332_+	hypothetical protein	NA	NA	NA	NA
WP_004903021.1\|700328_700775_+	hypothetical protein	NA	NA	NA	NA
WP_004903022.1\|700758_701082_+	hypothetical protein	NA	NA	NA	NA
WP_004903024.1\|701103_701322_+	hypothetical protein	NA	NA	NA	NA
WP_004903031.1\|701786_702038_+	hypothetical protein	NA	NA	NA	NA
WP_036069642.1\|702000_702312_+	hypothetical protein	NA	NA	NA	NA
WP_004903038.1\|702325_702589_+	hypothetical protein	NA	NA	NA	NA
WP_004903041.1\|702711_702993_+	hypothetical protein	NA	NA	NA	NA
WP_004903043.1\|702998_703250_-	hypothetical protein	NA	NA	NA	NA
WP_004903045.1\|703242_703611_-	hypothetical protein	E3W8I0	Leuconostoc_phage	3.6e-14	37.9
WP_004903047.1\|703600_704938_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	4.9e-85	38.6
WP_004906468.1\|705308_705413_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_004903048.1\|705752_706217_-	hypothetical protein	NA	NA	NA	NA
WP_004906470.1\|707270_708086_-	hypothetical protein	NA	NA	NA	NA
WP_004903057.1\|708075_708534_-	hypothetical protein	NA	NA	NA	NA
WP_004903059.1\|708958_710176_-	hypothetical protein	NA	NA	NA	NA
WP_004903061.1\|710394_710637_-	hypothetical protein	NA	NA	NA	NA
WP_004903063.1\|710645_711149_-	hypothetical protein	NA	NA	NA	NA
WP_004903065.1\|711198_711393_-	hypothetical protein	NA	NA	NA	NA
WP_004903067.1\|711693_712560_-	peptidoglycan-binding protein LysM	NA	NA	NA	NA
WP_004903070.1\|712668_713619_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	5.6e-75	48.1
WP_147002278.1\|713584_715375_-	YfhO family protein	NA	NA	NA	NA
WP_004902801.1\|715890_716316_-	hypothetical protein	NA	NA	NA	NA
WP_147002279.1\|716661_718164_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_004902805.1\|718156_718459_-	hypothetical protein	NA	NA	NA	NA
WP_004902807.1\|718451_719162_-	hypothetical protein	NA	NA	NA	NA
WP_147002280.1\|719161_719953_-	DNA-entry nuclease	NA	NA	NA	NA
WP_004902811.1\|720030_720339_-	hypothetical protein	NA	NA	NA	NA
WP_004902813.1\|720544_721528_-	hypothetical protein	NA	NA	NA	NA
WP_147002281.1\|721527_721944_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_147002481.1\|721933_722278_-	hypothetical protein	NA	NA	NA	NA
WP_147002282.1\|722264_722537_-	hypothetical protein	NA	NA	NA	NA
WP_147002283.1\|722560_723514_-	replication initiator protein A	A0A286QNA4	Streptococcus_phage	1.5e-16	45.1
WP_147002284.1\|723517_723787_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_147002285.1\|724395_725574_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.7e-23	29.8
WP_147002286.1\|725710_726082_-	hypothetical protein	NA	NA	NA	NA
WP_147002287.1\|726081_726492_-	hypothetical protein	NA	NA	NA	NA
WP_146955643.1\|726564_726825_-	hypothetical protein	NA	NA	NA	NA
WP_147002288.1\|726912_727107_-	hypothetical protein	NA	NA	NA	NA
WP_147002289.1\|727179_728832_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_050884792.1\|729215_729509_-	hypothetical protein	NA	NA	NA	NA
WP_050884793.1\|729654_730692_+	peptidase S41	A0A1V0SJG8	Klosneuvirus	1.2e-09	31.5
WP_147002290.1\|730935_732306_-	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	2.8e-35	28.9
WP_147002291.1\|732298_732562_-	hypothetical protein	NA	NA	NA	NA
WP_004906421.1\|732648_732924_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	5.2e-10	43.5
WP_147002292.1\|732980_733751_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	7.8e-35	35.5

DBSCAN-SWA_7

1371177 : 1379066

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004899198.1\|1371177_1371945_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.0e-23	31.0
WP_004899199.1\|1371988_1372630_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	6.7e-48	44.8
WP_004906841.1\|1372699_1373458_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_040190636.1\|1373740_1374181_-	hypothetical protein	NA	NA	NA	NA
WP_004904405.1\|1374173_1374380_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004899202.1\|1374492_1375485_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.5e-50	36.0
WP_004904406.1\|1375525_1376263_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_004899214.1\|1376273_1377149_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-76	54.6
WP_004899217.1\|1377150_1378086_-	DNA polymerase III subunit delta	M1NSC1	Streptococcus_phage	3.7e-07	25.5
WP_004899218.1\|1378085_1378415_-	DUF970 domain-containing protein	NA	NA	NA	NA
WP_012305425.1\|1378421_1379066_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.0e-53	50.9

DBSCAN-SWA_8

1674982 : 1680809

Leuconostoc_phage(70.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004908233.1\|1674982_1675351_-	helix-turn-helix transcriptional regulator	A0A097BYI9	Leuconostoc_phage	4.9e-19	48.1
WP_147002445.1\|1675615_1675873_+	hypothetical protein	A0A097BYE6	Leuconostoc_phage	6.2e-29	78.6
WP_004908227.1\|1675979_1676141_+	hypothetical protein	A0A097BYK8	Leuconostoc_phage	1.2e-19	86.8
WP_012305010.1\|1676142_1676409_+	hypothetical protein	A0A097BYJ6	Leuconostoc_phage	8.0e-32	74.4
WP_004908221.1\|1676424_1676703_+	hypothetical protein	NA	NA	NA	NA
WP_012305011.1\|1676699_1677020_+	hypothetical protein	A0A097BYF1	Leuconostoc_phage	2.4e-46	97.0
WP_040176522.1\|1677022_1677205_+	hypothetical protein	A0A097BYL1	Leuconostoc_phage	9.7e-21	86.7
WP_147002446.1\|1677261_1678032_+	DNA replication protein	I7A9C3	Enterococcus_phage	3.7e-13	30.0
WP_004908211.1\|1678018_1679422_+	DNA primase	A0A097BYJ2	Leuconostoc_phage	1.8e-239	92.5
WP_147002292.1\|1679706_1680477_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	7.8e-35	35.5
WP_004906421.1\|1680533_1680809_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	5.2e-10	43.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP042397

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042397_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042397_1

17009-17167

Orphan

Consensus_repeat	Method
GTGATCCATCTGACTATGTTCCATTTCATTATGGTCGTGTTTTGAGTGATCCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042397_1

>merge|NZ_CP042397|1|17009-17167|CRISPRCasFinder
GTGATCCATCTGACTATGTTCCATTTCATTATGGTCGTGTTTTGAGTGATCCATCGCACTATGATCCATTTCACTGTGATCCATCGCACTATGATTCATCTTGCCGTGATCCATCTGACTATGTTCCATTTCATTATGGTCCTGTTTTGAGTGATCCAT

>NZ_CP042397|1|1|17009-17167|CRISPRCasFinder
GTGATCCATCTGACTATGTTCCATTTCATTATGGTCGTGTTTTGAGTGATCCAT	CGCACTATGATCCATTTCACTGTGATCCATCGCACTATGATTCATCTTGCC
GTGATCCATCTGACTATGTTCCATTTCATTATGGTCCTGTTTTGAGTGATCCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042397.1\|WP_147002519.1\|11851_12439_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP042397.1\|WP_005917927.1\|12810_13113_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP042397.1\|WP_106786128.1\|11221_11416_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042397.1\|WP_004906031.1\|18518_19085_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|282780
NZ_CP042397.1\|WP_147002523.1\|18129_18405_-\|transposase	unknown	unknown	gnl\|CDD\|379233
NZ_CP042397.1\|WP_006845379.1\|5195_5579_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319912
NZ_CP042397.1\|WP_012304941.1\|17356_17509_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042397.1\|WP_147002520.1\|12542_12821_+\|RelB	unknown	unknown	gnl\|CDD\|225619
NZ_CP042397.1\|WP_147002518.1\|9658_10594_-\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP042397.1\|WP_147002524.1\|19077_20232_-\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|227814
NZ_CP042397.1\|WP_006845380.1\|5750_6620_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|366120
NZ_CP042397.1\|WP_147002522.1\|17521_17977_-\|CopY/TcrY-family-copper-transport-repressor	unknown	unknown	gnl\|CDD\|131745
NZ_CP042397.1\|WP_147002517.1\|7952_9323_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181958
NZ_CP042397.1\|WP_147002516.1\|4420_5149_+\|fructose-permease	unknown	unknown	unknown
NZ_CP042397.1\|WP_146973266.1\|13676_14882_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564

Protein	Function_ID	Function_description	E-value
NZ_CP042397.1\|WP_147002519.1\|11851_12439_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.17988e-72
NZ_CP042397.1\|WP_005917927.1\|12810_13113_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	5.70318e-24
NZ_CP042397.1\|WP_004906031.1\|18518_19085_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|282780	pfam04967, HTH_10, HTH DNA binding domain.	0.00159776
NZ_CP042397.1\|WP_147002523.1\|18129_18405_-\|transposase	gnl\|CDD\|379233	pfam13518, HTH_28, Helix-turn-helix domain. This helix-turn-helix domain is often found in transposases and is likely to be DNA-binding.	0.00157791
NZ_CP042397.1\|WP_006845379.1\|5195_5579_+\|glyoxalase	gnl\|CDD\|319912	cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE). MMCE, also called methylmalonyl-CoA racemase (EC 5.1.99.1) interconverts (2R)-methylmalonyl-CoA and (2S)-methylmalonyl-CoA. MMCE has been found in bacteria, archaea, and in animals. In eukaryotes, MMCE is an essential enzyme in a pathway that converts propionyl-CoA to succinyl-CoA, and is important in the breakdown of odd-chain length fatty acids, branched-chain amino acids, and other metabolites. In bacteria, MMCE participates in the reverse pathway for propionate fermentation, glyoxylate regeneration, and the biosynthesis of polyketide antibiotics. MMCE is closely related to glyoxalase I and type I extradiol dioxygenases.	7.93193e-12
NZ_CP042397.1\|WP_147002520.1\|12542_12821_+\|RelB	gnl\|CDD\|225619	COG3077, RelB, DNA-damage-inducible protein J [DNA replication, recombination, and repair].	0.00015259
NZ_CP042397.1\|WP_147002518.1\|9658_10594_-\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.97079e-38
NZ_CP042397.1\|WP_147002524.1\|19077_20232_-\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|227814	COG5527, COG5527, Protein involved in initiation of plasmid replication [DNA replication, recombination, and repair].	2.31771e-87
NZ_CP042397.1\|WP_006845380.1\|5750_6620_+\|ROK-family-protein	gnl\|CDD\|366120	pfam00480, ROK, ROK family.	1.17409e-72
NZ_CP042397.1\|WP_147002522.1\|17521_17977_-\|CopY/TcrY-family-copper-transport-repressor	gnl\|CDD\|131745	TIGR02698, Uncharacterized_16.5_kDa_protein_in_ptsI_3'region, copper transport repressor, CopY/TcrY family. This family includes metal-fist type transcriptional repressors of copper transport systems such as copYZAB of Enterococcus hirae and tcrYAZB (transferble copper resistance) of an Enterocuccus faecium plasmid. High levels of copper can displace zinc and prevent binding by the repressor, activating efflux by copper resistance transporters. The most closely related proteins excluded by this model are antibiotic resistance regulators including the methicillin resistance regulatory protein MecI. [Transport and binding proteins, Cations and iron carrying compounds, Regulatory functions, DNA interactions].	1.67907e-66
NZ_CP042397.1\|WP_147002517.1\|7952_9323_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|181958	PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed.	8.83653e-107
NZ_CP042397.1\|WP_146973266.1\|13676_14882_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	1.03774e-27

>NZ_CP042397.1|WP_146973266.1|13676_14882_+|IS110-family-transposase
MHAVIGIDVSKATSQVAVAVDGKVVQNFKITHDVFGFNQLNSVIMQFNTFPDIVFEATGVYSRRLKTFLEAHNYPYTYLNPLTAKKQLDKLRPNKNDLNDAKHLAETQFILKRAKSYVQNPIYIELQDMSRFYQQLNHDIVSAKNRLHRLLQLTFPEIETLFSTTDSQQYWEIVSLIPHATMAKHSRQTLSDTIQSSVSRQIGVARLTRLVDKLVALGSLSAPAVAVASYNVTEVRYYAQRLIALSQSKANVLATMVDQTKDLPEYDIYQSIPGFSDKTVVSLIAELGDLHRFATSNKLNAFVGIDLRFNDSGDYKSSGFITKRGNTIARKVLFKAISNIASTATYGHQNHINDWYQKKKQSSMSKGTKKIAIGAMSRLLRTMHYLVLNNQLYDYDTASKR
>NZ_CP042397.1|WP_005917927.1|12810_13113_+|type-II-toxin-antitoxin-system-YafQ-family-toxin
MQIKQTKSFERELKKLVKKHFPITVLKPCLEAIVEQDVLVLKQIKDHALKGNWRGYREFHPARYGNYGKNYDNWIVIYQLDHDELILLLVATGSHEILNQ
>NZ_CP042397.1|WP_147002520.1|12542_12821_+|RelB
MSNTIIKNKTISTRVTPDISERAKANLAKQGLTVSEYIRLSLVKAANNEVRLVSFLDSPKALAAKKEAETGQVKNIGSLTDFEDWIDKLDAN
>NZ_CP042397.1|WP_147002519.1|11851_12439_-|tyrosine-type-recombinase/integrase
MQQIVLPIKDSNILKEVQDTLLNNFKAGQRNYTIFQVGKATLLRVSDVMCLKQADIFNPEGSIKQNAFIHDRKTGKPNTLYLKPVQTELLLYRQWLLDHKLESEWLFPSIQHPERHITEKQFYKIMSKVGDLLSINYLGTHTMRKTGAYRVYTQSNYNIGLVMHLLNHSSEAMTLAYLGLDQASTETMLDQIDFG
>NZ_CP042397.1|WP_106786128.1|11221_11416_-|hypothetical-protein
MDEKKVLKPIDEMLVDPWQVDIQELFEAFVHEPDEIKQNLYNSLYTYILQKRQEDIINRPGFVI
>NZ_CP042397.1|WP_147002518.1|9658_10594_-|RepB-family-plasmid-replication-initiator-protein
MSNELVKYDPELNTIPLRRFTPVEMNLFFSVVSRMRDKGDDTVRFTFDQLKELSAYKPTANNRFIDDIQSTYQKILSLRFGSRSKDGLDREMFVMFTRFEIKGSADVPYVDIQIYPKALKLLNNLESWVRYALAEFRDLKSSYAKTTFRILKQFRTTGYAYFSKNDFFELLDIPQSYWSKPANVESRVIRPIKEELTPLFRGLTIRKKYGKGRGKPVIGYAFTWKPERKDANDFSQGKFQDERQKLFNIQNNGELTEQEKWRATDKVKGLPLGSTEKQILAERQIEHDKKIRDQTRQEMLAELRKGFGNNA
>NZ_CP042397.1|WP_147002517.1|7952_9323_+|FAD-dependent-oxidoreductase
MDKPKIIVVGASHGGHQSVLELLYRYPDADITMFEAGDFVSFMSCGMELFLENQVTDVNDVRNFRPDDLIKRGAHVLNNHEVTAINADVKSVTVRDTKNGTTQDYPYDKLILSSGVRPNSLPVPGNDLKNVFLMRGYDWATNIKAKLEDPAVKHVTIIGAGYIGIEAAEASRKAGKQVTLLDMIDRPLGTYLDPEMTDILAKELTDKGVELKLGVKIEAFTGDESVSAVKTDAGDVKTDLVIQAVGIKPATEWLKGTVNLDKRGFINTDPYLRTNLPDVYAIGDATLVYSIPAQQKVPIALATVARREARYLVENIFAENPARPFKGVVGSSALSVFDYHFAASGLNTFTAKRADVNVHTAFYTDSLRPDYVPEANGNPQVCVNLVFDPQSHRLLGGAVLSTYDVTAQGNVLALAVQQQLSLEDLAEADFFFQPGFDRQWSLLNLAAQHALGEPRF
>NZ_CP042397.1|WP_006845380.1|5750_6620_+|ROK-family-protein
MGLLGAIEAGGTKFVVAVADHNYNIVERTAFPTLDGQKTLDQVISFFDQFDNIDAIGIAAFGPIDIIEQSKTYGYVLATPKTGWSGYNFLGRMKEWRDIPYYWTTDVNGAGWAEFETGAAKNVDNMVYLTVGTGVGAGIVSSGHLVSGYSHPEAGHIFLQKHPADNYVGHCPFHDDNCLEGLAAGPAIEERWHMSAKEIPDDAEAWKIEAFYLAQAALDYTMILRPDKIVFGGGVPHREMLFPLIRESFAEQMSDYLDVPDLDNYIVPVANGDNAGILGCFYLAKTLLP
>NZ_CP042397.1|WP_006845379.1|5195_5579_+|glyoxalase
MAFSDYYSGVQHIGIPTKDLATAESFWTKLGFKKTGDFPVGDVIFMQRDNLVIETWHADEVAGKPGAINHISMDTTDADAAFAAAKSEGFDLIDDEVQHLDFWKKGIKFFNISGPDAVIVEFCEIVK
>NZ_CP042397.1|WP_147002516.1|4420_5149_+|fructose-permease
MDSQDVLDSKIHGRKLTIGVSLSYFIFSLVINAAGNVLTVVTSQKIHPTFLGSAYWTAASAGVNKAIFNGNSSMLGWVFFVIGVVVAILNVFLQGHFNARKFFGNIAFMVPFSALISYFANIFSSIMPDSQSIGMTIFYVILNFSGVFLIAIAISIYQRVNLVLHPADDLMQILRFKYFKGSAAKAMWASYIPPTILAIIAIIIYPDFSNYGLGTVFAFLFQGGITGWGDKAIFPNLKHQGV
>NZ_CP042397.1|WP_012304941.1|17356_17509_-|hypothetical-protein
MENKSFAIEGMTCASFAQTVEKAVLESQTEIDTETLNAALAETNYSVLSA
>NZ_CP042397.1|WP_147002522.1|17521_17977_-|CopY/TcrY-family-copper-transport-repressor
MSTIVVNPHITDAEWEVMRVVWANGRVTSKEIISILKEKMDWKQATIKTLLGRLVEKGVLNTEREGRKFIYTTNIEEKEAVGNYTDDIFNRICRKNVGNVVGSIIEDHVLSFDDIQRLEEILEMKKAFAVEEVDCQCAEGQCECRLHHHGE
>NZ_CP042397.1|WP_147002523.1|18129_18405_-|transposase
MIRYKKAFKQSLVEMHNQGRSYTDLSAEYGPSVDSIRNWVKLYAVHEVDGKKWTQADVNALQKENDKLREELEILKIRNSKINKSKSMVTL
>NZ_CP042397.1|WP_004906031.1|18518_19085_-|winged-helix-turn-helix-transcriptional-regulator
MSENLKTIRELAEELGVSKQAIQYHIKSLTNKTRQTNDKGIVVLSLEEQHFIRSKVDKQTNKTKTNKQTNDKQTDKETKWDIHNYLISELDEVKKNRDKQLAVKDKQLENKDSQIAQMQNLLDQQQRLALQDKKLLEEYKAEIKDLKALTMAPHDDGEKEVTSDKQPEPENSTPESQPKPKKWWRFGK
>NZ_CP042397.1|WP_147002524.1|19077_20232_-|RepB-family-plasmid-replication-initiator-protein
MSIIPESKTRQVQTLNELSKRKVVEHNSLITSIAKMDKTPLKMFELAVSLIDTENPPKDQTVYLSKQELFAFFNVDDSNKHSRFKEAIEKMQKQAFFKIKNAKEKGYEFESIVPIPYVKWADYHDEVTIRFSPEIMPYLINLKTNFTQHALSDIAELNSKYAIILYRWLSMNYNQYEHYSVKGGRREEQVESYRNPIITIRELRDMTDTVSEYKKFTDFERRVLKDPIKEITNHTSFNVTYEKVKKGRSIESIVFHITKNQVADDISYKLDDPVYIDGKIRQEESEKDLVYEAMKSPYTKLLMEHFLLSYIDLTDTAILSGLQKNIYPLYDELKELRGLKGVKEHLAYIRDKQDDYSKKNIAKYLKKSIEQYLPIVKRQDIDHE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NZ_CP042397	Leuconostoc citreum strain CBA3623 plasmid unnamed4, complete sequence	17063-17113	0	1.0
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NZ_CP028258	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence	3263-3313	4	0.922
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NZ_CP021493	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed2, complete sequence	10814-10864	4	0.922
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NZ_CP021494	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed3, complete sequence	10252-10302	4	0.922
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NZ_CP047631	Lactococcus raffinolactis strain Lr_18_12S plasmid pLraf_18_12S_1, complete sequence	10458-10508	4	0.922
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NZ_CP049099	Weissella confusa strain N17 plasmid p2, complete sequence	4626-4676	4	0.922
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NC_015756	Weissella koreensis KACC 15510 plasmid WKp2903, complete sequence	6956-7006	4	0.922
NZ_CP042397_1	1.1\|17063\|51\|NZ_CP042397\|CRISPRCasFinder	17063-17113	51	NC_010469	Leuconostoc citreum KM20 plasmid pLCK4, complete sequence	7525-7575	5	0.902

1. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NZ_CP042397 (Leuconostoc citreum strain CBA3623 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	Protospacer
***************************************************

2. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NZ_CP028258 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.922

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tcctccatgatccatttcactgtgatccatcgcactatgattcatcttgcc	Protospacer
. * *.*********************************************

3. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NZ_CP021493 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.922

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tcctccatgatccatttcactgtgatccatcgcactatgattcatcttgcc	Protospacer
. * *.*********************************************

4. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NZ_CP021494 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.922

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tcctccatgatccatttcactgtgatccatcgcactatgattcatcttgcc	Protospacer
. * *.*********************************************

5. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NZ_CP047631 (Lactococcus raffinolactis strain Lr_18_12S plasmid pLraf_18_12S_1, complete sequence) position: , mismatch: 4, identity: 0.922

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tgcgccatgatccatttcactgtgatccatcgcactatgattcatcttgct	Protospacer
.**.*.********************************************.

6. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NZ_CP049099 (Weissella confusa strain N17 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.922

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tgcgccatgatccatttcactgtgatccatcgcactatgattcatcttgct	Protospacer
.**.*.********************************************.

7. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NC_015756 (Weissella koreensis KACC 15510 plasmid WKp2903, complete sequence) position: , mismatch: 4, identity: 0.922

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tcctccatgatccatttcactgtgatccatcgcactatgattcatcttgcc	Protospacer
. * *.*********************************************

8. spacer 1.1|17063|51|NZ_CP042397|CRISPRCasFinder matches to NC_010469 (Leuconostoc citreum KM20 plasmid pLCK4, complete sequence) position: , mismatch: 5, identity: 0.902

cgcactatgatccatttcactgtgatccatcgcactatgattcatcttgcc	CRISPR spacer
tcctccatgatccatttcactgtgatccatcgcactatgattcatcttgct	Protospacer
. * *.********************************************.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042393

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP042397

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection