CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP042430	Baekduia soli strain BR7-21 chromosome, complete genome	3 crisprs	csa3,cas3,WYL,DEDDh,cas1	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042430_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042430_1

1120843-1120937

Orphan

Consensus_repeat	Method
CGGTTCAAGTCCGGGACCGCCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042430_1

>merge|NZ_CP042430|1|1120843-1120937|CRISPRCasFinder
CGGTTCAAGTCCGGGACCGCCCATGCGCGTCTGGTGATGGCGTCCGTGCCGTGACCGGGGACGTCGTCCGGACGGTTCAAGTCCGGGACCGCCCA

>NZ_CP042430|1|1|1120843-1120937|CRISPRCasFinder
CGGTTCAAGTCCGGGACCGCCCA	TGCGCGTCTGGTGATGGCGTCCGTGCCGTGACCGGGGACGTCGTCCGGA
CGGTTCAAGTCCGGGACCGCCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042430.1\|WP_146916989.1\|1127529_1128429_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NZ_CP042430.1\|WP_146916991.1\|1128776_1130126_+\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NZ_CP042430.1\|WP_146916958.1\|1116105_1116324_-\|CbtB-domain-containing-protein	unknown	unknown	gnl\|CDD\|370526
NZ_CP042430.1\|WP_146916973.1\|1120461_1120647_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916981.1\|1123469_1123964_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379275
NZ_CP042430.1\|WP_146916956.1\|1115340_1116096_-\|CbtA-family-protein	unknown	unknown	gnl\|CDD\|378192
NZ_CP042430.1\|WP_146916965.1\|1118698_1118923_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916987.1\|1126852_1127263_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226318
NZ_CP042430.1\|WP_146916985.1\|1125651_1126845_-\|RNA-polymerase-subunit-sigma-24	unknown	unknown	gnl\|CDD\|227277
NZ_CP042430.1\|WP_146916963.1\|1117338_1118568_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224511
NZ_CP042430.1\|WP_146916971.1\|1120150_1120381_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916975.1\|1120967_1122002_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916977.1\|1122089_1122770_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916994.1\|1130306_1130804_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319968
NZ_CP042430.1\|WP_146916954.1\|1114276_1115317_-\|precorrin-3B-synthase	unknown	unknown	gnl\|CDD\|274131
NZ_CP042430.1\|WP_146916961.1\|1116877_1117087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916967.1\|1119054_1119720_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146916983.1\|1123976_1125635_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|235722
NZ_CP042430.1\|WP_146916979.1\|1122766_1123588_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP042430.1\|WP_146916969.1\|1119926_1120154_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP042430.1\|WP_146916989.1\|1127529_1128429_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	2.11751e-07
NZ_CP042430.1\|WP_146916994.1\|1130306_1130804_-\|hypothetical-protein	gnl\|CDD\|319968	cd16361, VOC_ShValD_like, vicinal oxygen chelate (VOC) family protein similar to Streptomyces hygroscopicus ValD protein. This subfamily of vicinal oxygen chelate (VOC) family protein includes Streptomyces hygroscopicus ValD protein and similar proteins. ValD protein functions in validamycin biosynthetic pathway. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.03776e-22
NZ_CP042430.1\|WP_146916958.1\|1116105_1116324_-\|CbtB-domain-containing-protein	gnl\|CDD\|370526	pfam09489, CbtB, Probable cobalt transporter subunit (CbtB). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of a single transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a protein (CbtA) predicted to have five additional transmembrane segments.	5.07075e-06
NZ_CP042430.1\|WP_146916981.1\|1123469_1123964_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	6.15391e-23
NZ_CP042430.1\|WP_146916956.1\|1115340_1116096_-\|CbtA-family-protein	gnl\|CDD\|378192	pfam09490, CbtA, Probable cobalt transporter subunit (CbtA). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of five transmembrane segments, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a small protein (CbtB) having a single additional transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site.	4.6855e-64
NZ_CP042430.1\|WP_146916985.1\|1125651_1126845_-\|RNA-polymerase-subunit-sigma-24	gnl\|CDD\|227277	COG4941, COG4941, Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription].	1.07859e-88
NZ_CP042430.1\|WP_146916963.1\|1117338_1118568_-\|hypothetical-protein	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	3.15481e-12
NZ_CP042430.1\|WP_146916979.1\|1122766_1123588_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	4.79925e-22
NZ_CP042430.1\|WP_146916954.1\|1114276_1115317_-\|precorrin-3B-synthase	gnl\|CDD\|274131	TIGR02435, Precorrin-3B_synthase, precorrin-3B synthase. An iron-sulfur protein. An oxygen atom from dioxygen is incorporated into the macrocycle at C-20. In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	1.30282e-32
NZ_CP042430.1\|WP_146916983.1\|1123976_1125635_+\|AMP-binding-protein	gnl\|CDD\|235722	PRK06164, PRK06164, acyl-CoA synthetase; Validated.	8.19301e-154
NZ_CP042430.1\|WP_146916991.1\|1128776_1130126_+\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	7.41348e-57
NZ_CP042430.1\|WP_146916987.1\|1126852_1127263_-\|hypothetical-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	7.69602e-12

>NZ_CP042430.1|WP_146916973.1|1120461_1120647_-|hypothetical-protein
MKPDDPLPALVASIDQLVALAPHAARAARGLFDAFRAEQFSDSQALYLTAASTQDNPLEAP
>NZ_CP042430.1|WP_146916971.1|1120150_1120381_-|hypothetical-protein
MTLARAWTVHWYEDDGWGNAVRERPTSLSELLALYPGARDLLIERHVEVLRNAERSVAVAAEHIARHRADLEGQAR
>NZ_CP042430.1|WP_146916969.1|1119926_1120154_-|hypothetical-protein
MTDDAWEARQRAIARDHAIPPTPGVKPATRPQPMNPDEVRVDGVRYPVIGDEEREFRSCGGSFRQLAGSQVPGRA
>NZ_CP042430.1|WP_146916967.1|1119054_1119720_-|hypothetical-protein
MTASTTPADPVTTAKRDRDAQLPELTDQAHGANTDLGHALINNLALVDPADLTVAQFFVYALLGADHASSPYTQTGERVAHIAAAGVRLVVEDLRADVTKTRKDGTRGRLRYDYGDHRDPQAAIAWMWKFIDAAKTASELYGRALVVIAAEQHASRLVVAGSQRTPASRWPSHKDHAAKGWQARRPPRPHGADAARARGQARTRRLRAGAGRLALVRVRRR
>NZ_CP042430.1|WP_146916965.1|1118698_1118923_-|hypothetical-protein
MLGRTARTPLSPVQREARRQADRDRLEDAARALLTSDGWQRWIRVRSKNGLSRYSINNQLLIAIDCWSRGITPT
>NZ_CP042430.1|WP_146916963.1|1117338_1118568_-|hypothetical-protein
MFFRTVPVFDVSMTDPLPGTEPIPLEPPSEPIAGDTHTHLVGPLIALAGELGYRAEIRDLPTDGPGGWCDPKHKVIVVAAGPANAQVRTLVHDIAHALGIGYADYRREQAEVLVDCVTYIACSSAALDMGGESIAYVAGWGEDGALDAIRAYADMVDTVARRIEDAIAARPDRRVHRGLTRVGQGLLARDDRASRAGARYDLTVAASRPAPGPAHPGGVMQPSTHNEQPTRRGDEDSLYRRHHRSLQRSVARVVRASPELIEDACQMAWMMLLRNQPERHRIFAWLRRVAINESYRLSALERRTTNLDYAEATASHALVGDAEALDRACEAREALRALAALPERQRRDLTLKVAGYTYKEIAQLTGGSHLHEHRQDDRQGPRARPTRASAAATADQWSDRERGRHPGGQ
>NZ_CP042430.1|WP_146916961.1|1116877_1117087_+|hypothetical-protein
MISDTVNDGPKYHHRGCRGVTLAGFTEKVLSALADNRRPNGRYFWVASEHVAKTGGARACELEDDPLYR
>NZ_CP042430.1|WP_146916958.1|1116105_1116324_-|CbtB-domain-containing-protein
MSDVTLDRRGSTPAVPIVSPRELLPYALFAGVLMMLLIFFVGAEEGATSIIGGHSVHEFVHDARHLLGFPCH
>NZ_CP042430.1|WP_146916956.1|1115340_1116096_-|CbtA-family-protein
MTRSLLIRGMIIGACAGLLAFAFARVFGEPQIQHAIDFESYLARLHHEPEGPELVSRGVQRSFGLLTGTLFMGVALGGIFSLTYAWAYGRIGNMSPRLTSLVLAAAAYLTIVLVPFAKYPANPPAISNPDTISKRTLLYFTMITISILAAIAARRIWRAGIMRLGMWNATLVAAAAFLVVIGAAELILPRILETPQGFPADVLYRFRLASLGISLTLWTTIGLGFGAAADRLLAPAVRRAAEPDSTAAPVG
>NZ_CP042430.1|WP_146916954.1|1114276_1115317_-|precorrin-3B-synthase
MSTPMARAPADRCPGVLRLHPAGDGGLARVRLPGGILTTRGLSAVRSAAALGNGLVEITSRANVQVRGLDPAAATEVADVLWCGGLLPSPEHDRVRNIAAAPWAGPEVQALVGELDRLLCADPALVQLSGRFLFGVGPTTGPVPDVAVIDDILILDGRPTTLRGDAASMLDAARTFLAHADGAWRIADIPDGPQRVARRLGGRVVPGAAPRAPAIRLGVHHDAVTVLPPLGRLDLRLLDVVAAHGEPDVRLSARRTVTFAGDRGGDLLSVLDRKGFVTQESSGWWGLSACAGIGACPRAELNVRAEATRRAAQRAPGAPPEHWSACERGCGRPDAAIERGIARSPR
>NZ_CP042430.1|WP_146916975.1|1120967_1122002_-|hypothetical-protein
MSAAPNVHLPEGFVLTPEDESMHTPDDLVNFNESVYCSGWDPKLKAGVWMRLGNRVNEGHAELSLVAYLPDGRLACQFKRPKISHNDAFDAGGLRYRCLEPFQRIEMVYEGELLVLEDPELLRDAKALFASAPRVQGSMRLEATAVSPAHGGEPTSREYADHMLYGYDFSRGHFNQHVRSVGEMVVGDERIPIDGFGWRDHSWGPRFWQEIWFYRLFMVNFGADRGLMLLRNNLESGRTKRLGVVLVDGEYEEVTDLDVTTEWSDDQEPVSVTVGFSTARRRELVHGRVLRMAPLRNRRKAGDETLVSRVAEGFSEWTWGDRVGYGMIEYIERVQDGVPVGYPT
>NZ_CP042430.1|WP_146916977.1|1122089_1122770_+|hypothetical-protein
MSERFEDYQVGRRSISDTEASRLPDDPGTLELSWRLVAEGDPATVETIVTRCRRHRTEQAGHVHRHRLVRDRDGTVVQEATSTALVPARGLAPDPDPAVALDFCSVGWGRLLVPALDAHPAFAEATRTFDGALGLRAGSEEVQLRVYRGRVLEAARSTPLGATFTLAASELEWTELALAARNEFMARATLGRFSVSGNAHEYLRLTKALVAIVDATRALAAPGGVA
>NZ_CP042430.1|WP_146916979.1|1122766_1123588_+|alpha/beta-fold-hydrolase
MIRAEYHEIDGAVGFAEVAGDGPPVLCLHTAGQTGAQWREVLHALPAHGYRVIAPDLPGHGRSESPLGGPVRDLRRHGRWLAVLLHRLGAQHPFVVGCSIGGKLALELALDPGVAPRGVVAMAADAHNRRLSVRGLERSLEDAASPSRSDRTYLGTLACVGRAVGPERAARIAAMHRREDPVVSAADLIAWTSHDLRDRLGAIACPVRLVAGEDDFWIDLADTRWAAGRIPGAAYEELAGVGHYPMEEIEGFPELLATWLRALGPTEEETGDG
>NZ_CP042430.1|WP_146916981.1|1123469_1123964_+|nuclear-transport-factor-2-family-protein
MRSWRASGTIRWRRSRGSPSCSRPGCGRSVRPRRRRAMDDIEAIKQLTARYNRAFDSVDVPGYLATWTEDGFFERSNAGRSFQGHAELEELLTTFGVDGRHVTSDFIIEVDGDRATSSSHLIYLDVDAGFKVAIFGIYADELVRTDEGWKFSARRLQVHAPKGT
>NZ_CP042430.1|WP_146916983.1|1123976_1125635_+|AMP-binding-protein
MTAAAAGTLTALLDEVAGRTPDAPAVIERDHAEGVARLSYAELRAAAGAAAAQLAEHGVRRGDVVAVWLPNWTEALVVQYALARLGAVNLGVNTRYGVHEVADLLAQGRPVGIVAPASFLDLDFAGRLRGAMAQLAQRDDGIAAPWVAVVRGTPGDAPGLDAGAGAWALQPAAGTAAPPAVGRPGDLLNCFTTSGSTGVPKLAGHDQAAVADHARNDAEAIGFRPGDVFLGVLPLSGVFGFNPVMGCLAAGGTVLLEPVFDAASVLAGMDELGVTHAVGGDDLLGALKDAWTADPRPLRAFRRGGIADFAGRATEIVAWAERELGASISGLYGSSELFALTAIWPEDLPAPERGRPGGRPVSAGIEVRVADPGSGTALGPGEVGELQFRGYNVLQRYLGRPGAQRAAFTGDGWFRSGDLGALTGEGADFVYTCRAGDALRLRGFLVEPAEIERFLASHESVDVAKVVGVRAGTGEDLAVAYVTARAGAVLEEDALRAFATERLAPFKVPARINVIDAFPVTVGTNGTKIRTAELRRWAAEQLGAGGPRGTTP
>NZ_CP042430.1|WP_146916985.1|1125651_1126845_-|RNA-polymerase-subunit-sigma-24
MRDEPTAPLDEGALRALVPRVLAGLVRRGEDFDAAEDALQEALLEALRVWPGHPPGDPRAWLTTVATRRLVDARRSEAARHRREEAVAAQPPPGEAAPGEGDDTLFLLFCCCHPDLAPASQVALTLRAVGGLTTREIADAFFVPEATMAQRVSRAKRTLAGRPLDRPGDLAVVLRVLYLVYTTGHTARVDLATEAIRLTRRLTLATEEPEARGLLALMLLNHARLPARFDAEGRIVTLDRQDRSRWDTRQIAEGVRVLQSALAVRRPGPYQVQAAIAALHDDAASAAETDWPQILAWYDDLVALTDDPVRRDPAAVLGRAVAVGHVLGAAAGLRETDRLRDVLGDRHRWHAVRGHLHELGGDPAAAATAYAEAARRATVVAERDHLVRQAARARAAV
>NZ_CP042430.1|WP_146916987.1|1126852_1127263_-|hypothetical-protein
MPKYLLLKHYRGGPQPHHPFPPMDQWAPEDVEAHMAFLRHVSATLEERGELVGVQALTPERTWVRYGGPGAAPVTTDGPHPETSDLIAGWFMIDVESRERALEIAAHVSSEPGPGGGPLYEWIDVREIMSGRPADD
>NZ_CP042430.1|WP_146916989.1|1127529_1128429_+|acyl-CoA-dehydrogenase
MVALAEELAITAAVHGHGTRGHAAALRDARYLSAPIPASRGGLGVTSVHDVVLASTRLARGDPALARGDPALARGVTPHLVAVLGLARSWRRAIRSDQHARARAFEAPMRLVARGGVVLAAALGASGRSAPGPIPVATRTDGGWRVDGRALVCAIGPVASVLSIPVTYTGEDDGACRAHVLVPVAAPGLAVDGVAPAAALRGPGLHTVTLDGVALVPDALGTGAPWRDAIDELDRELIARLLGAAASPRVAAPALLRLAARLDAMAAPDEAGLLALLDEAEAVQERTWPPCQVAAAAGL
>NZ_CP042430.1|WP_146916991.1|1128776_1130126_+|MmgE/PrpD-family-protein
MADAETATITELEALARFVLDARLEDVPDEVVEYARHLTLKTISGMVAGARFSPGPQMVELVRRKGLPEEVRVVGCDFRTSLWEGVFLSNFVAHATETEDDRLEHGVAWDIAIVPVILTLADKLGLSGRDTLAAIVIGLEVHSRSSDFDAAARGLYCVPAAVGTAAAAARVMGLTHEQTVNAMGMVLSTAMVTETNFGYDAHCLESAMQCLQAIMAVEAAAAGLSSNPDLRGYLDKLVGPENVFADGILAGLGETWSMMDICVKKYPACSCIHKPADALRELMREHGFGADDVESLVTEISPYDVFNDRPDPLSMGDAKFSYQHCLGAVLVDGDITFANIGAIDEPRYVQARAKVSINVHEDWSPLMLAAPNGVTVRLRDGRELQRIREHIHGSRPDPLSHEEFVDLFALYTDGILSADEVATCVDLVERLEELPHLGALLDVVAPVAP
>NZ_CP042430.1|WP_146916994.1|1130306_1130804_-|hypothetical-protein
MTIANDHQAVRVTDMERSTRFYVEAFDATVLTRPFVIEGDFAEAMMGGPPGVRFRIRHLRFEQGVVELFEFLEPVVRAEPAHGSRASILHLGFRVDDVDATVARVLDAGGRLLLPVTAWGGARLTFCADPDGNVVELADASIEQLVTATVAAFPEAAPDAPDAVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP042430_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042430_2

1648636-1648739

Orphan

Consensus_repeat	Method
GGGGCATCACCCCACGTTCGCGCCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042430_2

>merge|NZ_CP042430|2|1648636-1648739|CRISPRCasFinder
GGGGCATCACCCCACGTTCGCGCCATGCGGCGCGGCGGTGCCGGCGCGCGCGGTACGCCCGTCGGGTGGCGCAGACGCGGGGCATGACCCCACGTTCGCGCCAT

>NZ_CP042430|2|2|1648636-1648739|CRISPRCasFinder
GGGGCATCACCCCACGTTCGCGCCAT	GCGGCGCGGCGGTGCCGGCGCGCGCGGTACGCCCGTCGGGTGGCGCAGACGC
GGGGCATGACCCCACGTTCGCGCCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042430.1\|WP_146917921.1\|1639405_1640008_+\|recombination-protein-RecR	unknown	unknown	gnl\|CDD\|234616
NZ_CP042430.1\|WP_146917916.1\|1637146_1638955_+\|DNA-polymerase-III-subunit-gamma/tau	unknown	unknown	gnl\|CDD\|235505
NZ_CP042430.1\|WP_146917930.1\|1644891_1646118_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366376
NZ_CP042430.1\|WP_146917926.1\|1641808_1644094_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|225669
NZ_CP042430.1\|WP_146917949.1\|1657287_1657935_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP042430.1\|WP_146917946.1\|1655630_1657310_-\|DNA-alkylation-response-protein	unknown	unknown	gnl\|CDD\|183199
NZ_CP042430.1\|WP_146917937.1\|1651119_1652820_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|273815
NZ_CP042430.1\|WP_146917944.1\|1655203_1655608_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP042430.1\|WP_146917940.1\|1653378_1654548_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|100085
NZ_CP042430.1\|WP_146923573.1\|1646171_1647428_+\|aspartate-kinase	unknown	unknown	gnl\|CDD\|235843
NZ_CP042430.1\|WP_146917931.1\|1647424_1648474_+\|aspartate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|237845
NZ_CP042430.1\|WP_146917951.1\|1658201_1660379_+\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|377178
NZ_CP042430.1\|WP_146917924.1\|1640235_1641786_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|213859
NZ_CP042430.1\|WP_146917933.1\|1648977_1649895_-\|disulfide-reductase	unknown	unknown	gnl\|CDD\|224959
NZ_CP042430.1\|WP_146917914.1\|1635812_1637144_-\|M20/M25/M40-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|349929
NZ_CP042430.1\|WP_146917953.1\|1660433_1661420_+\|malate-dehydrogenase	unknown	unknown	gnl\|CDD\|235468
NZ_CP042430.1\|WP_146917928.1\|1644090_1644831_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP042430.1\|WP_146917942.1\|1654625_1655201_+\|leucyl/phenylalanyl-tRNA--protein-transferase	unknown	unknown	gnl\|CDD\|234720
NZ_CP042430.1\|WP_146917935.1\|1649947_1651117_-\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|223555
NZ_CP042430.1\|WP_146917919.1\|1638954_1639398_+\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|376829

Protein	Function_ID	Function_description	E-value
NZ_CP042430.1\|WP_146917921.1\|1639405_1640008_+\|recombination-protein-RecR	gnl\|CDD\|234616	PRK00076, recR, recombination protein RecR; Reviewed.	6.03672e-106
NZ_CP042430.1\|WP_146917916.1\|1637146_1638955_+\|DNA-polymerase-III-subunit-gamma/tau	gnl\|CDD\|235505	PRK05563, PRK05563, DNA polymerase III subunits gamma and tau; Validated.	5.86144e-173
NZ_CP042430.1\|WP_146917930.1\|1644891_1646118_-\|hypothetical-protein	gnl\|CDD\|366376	pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N terminal domain.	2.48737e-34
NZ_CP042430.1\|WP_146917926.1\|1641808_1644094_-\|FtsX-like-permease-family-protein	gnl\|CDD\|225669	COG3127, COG3127, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	2.10392e-12
NZ_CP042430.1\|WP_146917949.1\|1657287_1657935_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.86857e-11
NZ_CP042430.1\|WP_146917946.1\|1655630_1657310_-\|DNA-alkylation-response-protein	gnl\|CDD\|183199	PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional.	6.7883e-168
NZ_CP042430.1\|WP_146917937.1\|1651119_1652820_-\|FAD-binding-protein	gnl\|CDD\|273815	TIGR01812, Fumarate_reductase_flavoprotein_subunit, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup. This model represents the succinate dehydrogenase flavoprotein subunit as found in Gram-negative bacteria, mitochondria, and some Archaea. Mitochondrial forms interact with ubiquinone and are designated EC 1.3.5.1, but can be degraded to 1.3.99.1. Some isozymes in E. coli and other species run primarily in the opposite direction and are designated fumarate reductase. [Energy metabolism, Aerobic, Energy metabolism, Anaerobic, Energy metabolism, TCA cycle].	0
NZ_CP042430.1\|WP_146917944.1\|1655203_1655608_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	3.12276e-07
NZ_CP042430.1\|WP_146917940.1\|1653378_1654548_-\|CBS-domain-containing-protein	gnl\|CDD\|100085	cd06164, S2P-M50_SpoIVFB_CBS, SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.	3.44255e-68
NZ_CP042430.1\|WP_146923573.1\|1646171_1647428_+\|aspartate-kinase	gnl\|CDD\|235843	PRK06635, PRK06635, aspartate kinase; Reviewed.	0
NZ_CP042430.1\|WP_146917931.1\|1647424_1648474_+\|aspartate-semialdehyde-dehydrogenase	gnl\|CDD\|237845	PRK14874, PRK14874, aspartate-semialdehyde dehydrogenase; Provisional.	1.03242e-159
NZ_CP042430.1\|WP_146917951.1\|1658201_1660379_+\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|377178	pfam03971, IDH, Monomeric isocitrate dehydrogenase. NADP(+)-dependent isocitrate dehydrogenase (ICD) is an important enzyme of the intermediary metabolism, as it controls the carbon flux within the citric acid cycle and supplies the cell with 2-oxoglutarate EC:1.1.1.42 and NADPH for biosynthetic purposes.	0
NZ_CP042430.1\|WP_146917924.1\|1640235_1641786_-\|hypothetical-protein	gnl\|CDD\|213859	TIGR03767, P_acnes_RR, metallophosphoesterase, PPA1498 family. This model describes a small collection of probable metallophosphoresterases, related to pfam00149 but with long inserts separating some of the shared motifs such that the homology is apparent only through multiple sequence alignment. Members of this protein family, in general, have a Sec-independent TAT (twin-arginine translocation) signal sequence, N-terminal to the region represented by this model. Members include YP_056203.1 from Propionibacterium acnes KPA171202.	9.29533e-62
NZ_CP042430.1\|WP_146917933.1\|1648977_1649895_-\|disulfide-reductase	gnl\|CDD\|224959	COG2048, HdrB, Heterodisulfide reductase, subunit B [Energy production and conversion].	1.04399e-77
NZ_CP042430.1\|WP_146917914.1\|1635812_1637144_-\|M20/M25/M40-family-metallo-hydrolase	gnl\|CDD\|349929	cd05680, M20_dipept_like, uncharacterized M20 dipeptidase. Peptidase M20 family, unknown dipeptidase-like subfamily (inferred by homology to be dipeptidases). M20 dipeptidases include a large variety of bacterial enzymes including cytosolic nonspecific dipeptidase (CNDP), Xaa-methyl-His dipeptidase (anserinase),and canosinase. These dipeptidases have been shown to act on a wide range of dipeptides, but not larger peptides. For example, anserinase mainly catalyzes the hydrolysis of N-alpha-acetylhistidine while carnosinase degrades beta-alanyl-L-histidine.	1.51951e-129
NZ_CP042430.1\|WP_146917953.1\|1660433_1661420_+\|malate-dehydrogenase	gnl\|CDD\|235468	PRK05442, PRK05442, malate dehydrogenase; Provisional.	0
NZ_CP042430.1\|WP_146917928.1\|1644090_1644831_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	2.46164e-88
NZ_CP042430.1\|WP_146917942.1\|1654625_1655201_+\|leucyl/phenylalanyl-tRNA--protein-transferase	gnl\|CDD\|234720	PRK00301, aat, leucyl/phenylalanyl-tRNA--protein transferase; Reviewed.	1.65395e-60
NZ_CP042430.1\|WP_146917935.1\|1649947_1651117_-\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|223555	COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion].	1.8892e-75
NZ_CP042430.1\|WP_146917919.1\|1638954_1639398_+\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|376829	pfam02575, YbaB_DNA_bd, YbaB/EbfC DNA-binding family. This is a family of DNA-binding proteins. Members of this family form homodimers which bind DNA via a tweezer-like structure. The conformation of the DNA is changed when bound to these proteins. In bacteria, these proteins may play a role in DNA replication-recovery following DNA damage.	2.12841e-28

>NZ_CP042430.1|WP_146917931.1|1647424_1648474_+|aspartate-semialdehyde-dehydrogenase
MSRYRVAVVGATGAVGTEMRRLLRDRGYPASEIVPFASQRSAGRELEDGLVVRGLADDDSIGGFDVAIFSAGGSISREWAPRFAARGAIVVDNSSAFRMDPEVPLVVSEVNPEALDHIGKGIVANPNCTTMAIMPPLHALHVEFGLRAMVATSFQAAGGAGQKGMDELMEQVPGLLADPLALQRRGAEAAATVTDTPVFGKPLAFNVVPLLGTDTGNGYTDEEMKLQNESRKILGIEDLAVSPTCVRVPVMVGHSIEVRAQFEREPTVARALEVMGAHEGVELDDVPTPLEWAGRDPVAVGRVRLDLGDPFALNLFVVGDNLLKGAALNTVQIAELLHERGLLGARAAA
>NZ_CP042430.1|WP_146923573.1|1646171_1647428_+|aspartate-kinase
MKFGGTSVADAARLKRAAGRIVAKREQGFRVVAVLSARGKETDRLIADALEVSPVPDPREMDMLLSTGERVSCALCAMAINDLGHRAISLTGSQAGIVTDTSHTKARILEVRADRIRSALDEDSIVLVAGFQGVSTAKDVTTLGRGGSDTTAVALAAAIGADECEIYTDVPGVFSADPRIVPDARKLDVVSFDEMLEMAASGAGVLQLRSVEYARTHGVRIHCRSSFDDSEGTRVASEDARRDQDMENPLITAVTHSRGEARVTLIGLPDSPGIAGRVTTALAASNVNIDMIIQNEPRSAGALAELSFTVPQDDVAAAQAALAPIASELGIEVDTDDAMGKVSIVGAGMKSHPGVAAKVFTVLGEHEINIEMISTSPIRISCVVPGDKVADAVKALHSAFELQGADTIRPEQPFGEFS
>NZ_CP042430.1|WP_146917930.1|1644891_1646118_-|hypothetical-protein
MRRWILLGLTGCLGAAIVIAVAFTLSGGGDAHGPQPVAPSPRAVVTARPSTAAPVTVTAPAAPAPATTTTTRARAPAPAAPGRPLSAAEAEQAARLFLIGFAGDTPTAAVRARITAHDWGGVVLQHGNGGTPQQVAALIGQLRRWAVRAGHTAPLVAAVQPGGAVDAVPVGTPAAAAQSGVAAARRIAAATGRVLHALGVGLVLGPVADIATAGGPWEGRAFSDDPTVVTPMVSSSLAGFKAAGIAAAPGHFPGEGAASGDPADGQATVGESEGDLQRRDLQPFLQLALHAPALQLSSATYVAFDGVTPATLLPGVVDLLRGPLRFGGVVVSGDLAAASLATGDSVAATAVEALKAGCDLLWIPGDAADQDAAWRAVTQALRTGQIPPARLRDALARVAALRARYGAA
>NZ_CP042430.1|WP_146917928.1|1644090_1644831_-|ATP-binding-cassette-domain-containing-protein
MVDDHLTSDVVLRARGLVKVHGVGRGERRILDGVDLDVHPGELVAIVGRSGSGKSTLLQLLGGLDRADAGSVEVAGRPVAGPRAPGERELSALRRTEIGFVFQFFHLLPELDGEANVLLPTTLPGADRASAGRGRELIDRLGLRDVAGLRPHQLSGGEQQRFALARALVADPALVLADEPIGNLDAEAGDTVLDLLRGAADHRRAVVMVTHQAEATARADRVLRLEEGRLVPVTSSDGDVAVHAAG
>NZ_CP042430.1|WP_146917926.1|1641808_1644094_-|FtsX-like-permease-family-protein
MSFALRTAWASLRARPGRTALTATGIAAAGLVLGVALTVAYALSTGFGRAADRAGLPTIEARFGDRDPADVDRVVRSLPNLEAASYRFERTGLRLEAPGHDTRQGVLQVVAGGRRGYAIVDGRDIADRAGPPEVVVERGLMTDWGLRVGDDLHVGRLGPMRIVGASVAPDNVAWPLAKTARVTVSEQALLARFGARPGERFPVNTALLWARDPSRADVLVSAARQSSYGLRGLRFLTRGGVEALIGQAAGIVVALLVAFGVVAAGLAGVLLVAGAQSEVRRALDRIGLQRAIGAAPGAVVGVHAARGALVAAPAAAIGLVAGALAGAGPTRRVLASLNELAPGAGTVALLLAGLWVAAVGLVTVASALPAWRAARRRPAELLRGGDVAGGRPRAGRTRGGLAALGARLVAARRLRFASVVAVLGTAAGVVLLLLALATLLTRLRDDPATLGKRYQLTTRLPPQDTGAVEAIPGVAAAALRYSIDAVSATSLGSPLKVIAYAGDHTRFEAPPLASGRRVRSAGEAEVGVGLADALGLRPGATLVIQPRSPREARFRVVGVVRTLQDEGRVAFVRPDRLVAAGAALDGPMVLALRPGADRARIAQGLRALGARADAVRGATGDNGAFLGVLAGLLRVVAGAVALVCLHALVGALALTARERRGAVATLRSAGADARALRRLLGGAAAVVVLPAIAVAVALEALVLSPLVARLAAGYADLPLGASVAQIALLAGALSVLAWVAAWVTGRRLVREPVLAGLREES
>NZ_CP042430.1|WP_146917924.1|1640235_1641786_-|hypothetical-protein
MSRGRTRRELLGAAGVAGAAALLGCGGTAGPPGSTLARTLVDPDGDGLLSRGPGVALADRTDLAPRAAASGAVATVAQVSDLHVRDAQSPGRVAFLDRLGPRLGSAFRWHETLTAQVVAATVASVNAARPDVVLVTGDLADSAQRNELEWAVTLLGGGTVVPDSGRRGYQGVQAETIADPLYYRPDVDAPRHPGLLDRAVAPVRSPGLRAPWHAVLGNHDILVAGELAPTEATRAAATGDRLLVTPAPALLQQLRGTQLTRSQVDDLLRAGLDGDALRVAPDPARTQLGADDVVGRLRRGAGKRLDYAVNVGADLRIVVLDVVRRDAGSGGVVVASTLAFLRRALAAAGNRYIMVALHQPLDQTAGADSVLDVLDADPRVVAVLAGHTHRNAIAPRRTAAGGHWHITTASIVDWPQQWRMLRLVHTRGGATALETWLVDHTGRPRDEGDLAGIARDLAFLDPQGGRPAGAAGPPGARNVRLHLPARPPRPPARPGVPRPLPALTAPATLGAGDAVA
>NZ_CP042430.1|WP_146917921.1|1639405_1640008_+|recombination-protein-RecR
MLAPPVQRLVTELGKLPGIGQRTAQRLAFHLLRVDGEEANALADAIREVKLRIRQCEICFNLADEPRCRICQDERRDPRVICVVEEFGDVLPVERTHEFRGRYHVLGGALSPIDGVDPEDLKLAELYRRVEGGEVREVVIATNPTTTGEATAHHIAGVLRERTPDVAVTRLASGLPVGGDLEYADEVTLGRAFSGRREIV
>NZ_CP042430.1|WP_146917919.1|1638954_1639398_+|YbaB/EbfC-family-nucleoid-associated-protein
MPQPNIQQMLQQAQEAMAAQQEAQDALKEQRVEASAGGGMVKVVVTGDLRIEALTIDPDAVDPEDVEMLQDLVLAATNEALRQVVDLQEKAMQGAAGAGGFDPMQALEGLGLGGALGGLGGPGGPGAGGGGPQLNRAARRAAAKKNR
>NZ_CP042430.1|WP_146917916.1|1637146_1638955_+|DNA-polymerase-III-subunit-gamma/tau
MADYADRWSRPRAGTRRGPARGPRSPYTRLPVPAGPSLYRRHRPRTFDDVIGQEHVVRTLRNAIEQGKVHHAYLFVGSRGTGKTSMAKMLAACLNCEQGPTVTPCGRCESCVSIASASSMDVIEMDAASNNSVDDIRELRDSVQYAPVGGRYKVYILDEAHMLSTAAWNAFLKTLEEPPPSTIFVLATTEAAKIMDTVVDRCHRFDFRRPTVEQLATVVQRVAGKEAIEIAPDAVALVARNATGSYRDALGTLEQLVTYSGTSIDTDDALAVLGVADDDLLFGALDAVGARDARAAWQVTARLAESGRDAAQFLRDLETHARDVLVVQTLGEVPSQLAMTAERDARLADQAGRLTGADTVRLLDLLAAGMRLAKDGADAQTQLEVALVKAAAPEVDPSTRALLARLERLEQALSGAAPAPRPAAVPHAAAPAPAPPAPPAPHAPVAEPGAAAPEPAREEAPSAVAVAEPTPAPAPPPLGELDLAMVQELWPAVLQGVAETNQMLAGCLAEARPITVAGRDVTLAFTPAMAFQKRKAEDAASRRVLGAAFQALTGVPPRLLYETREPEELGVEPEVLGEDDFIARLRAEFDAVDHQPDEEGPA
>NZ_CP042430.1|WP_146917914.1|1635812_1637144_-|M20/M25/M40-family-metallo-hydrolase
MADTLLDELFTWLRIPSISTGGGDPADLERAAQWAVDKVRAAGGEAELVRIGGGNPLVIGELRAAREDAPTVLIYGHYDVQGAEPLDLWESPPFEPEVRDGRVYARGAADDKGNFLPLLHAACGLAQAGELPVHVRVAIEGEEEAGGESIAAWLAADERGADAAIVYDSGMVGPDLPAICVGLRGVVLLTFEVRAARRDLHSGMYGGSALNSLHALHAALAAVLPGPDGRVRDELRVGIAPVADAERATWDALPSGQEALDAAGARPAYPAAAAEYIERNGSDTAVDVNQIVAGDARTVIPAVARATISIRLAPGQDPDAMGAELLRLLRGGLPEGAELEVVSSHSAQPALFGVDTAAIRLAGEAIERACGVAPAFVRSGGSIPIVADLGAKGIPTIVTGFVLPDDPFHAPNESFSLRGLELGERAARELLAALAALGDGAPQ
>NZ_CP042430.1|WP_146917933.1|1648977_1649895_-|disulfide-reductase
MKVAYWPGCVSRGFTPELHGSMAAVAPLLDIELVPLDRACCTGAGVIAEHNTELADTLNARTFALAQAVEGADLMMNICSTCQGAQGECQERLDASAEYRGHINGTLEKHGLHYEPGISNKNFLWVLVEELGLDELRSRVRRPLTDLKVGPFYGCYIVRPTDRLGIDDEHPRDTYLAQVIEALGGTVIEYAGSHKCCGFPIITMNKEASLRQTGRHMGDAADADADCVVTPCPLCHLNLDLQQPLAQRLVGREINMPVLHLPQLVGLALGLDPKELGLNKHVVKPTSVIDWTTSVVAGVGAGDGR
>NZ_CP042430.1|WP_146917935.1|1649947_1651117_-|4Fe-4S-dicluster-domain-containing-protein
MAAEPTTAHSPTRSDVSESFTLRIRRYDPESGEAPYWVEHTIELEPHRSVLEGILQAKGRFDGSIGIRCSCKAAICGSCGVRVNGQPGLACHTHLDRAKATSRDGVIEIEPMGNMPVIKDLIVDMDAVHWKKVQRVTPWLINKTPIPEREYIVDRESMVDVTQSMACIQCGACVSDCLAMEVDPLFIGPAALAKSYRFVGDPRDAEQRERLMDLAEDPHGIYDCTHCFKCIEACPKGVAPMNQIMRLRRRATGDHHIVDRNNGERHEAAFVTLIKNYGLLWEAELLPRSYGGNSWFGKFAPPAGLELASSLPAITKAVMRRKVTIMGAVKPHKIPPADLKQVQAIYDEIEGRDKRIEYNLYISGRDEDNEDSPQERVEATGDAKSEDNA
>NZ_CP042430.1|WP_146917937.1|1651119_1652820_-|FAD-binding-protein
MPAHDVLILGAGLAGQRAALAAADAGASVAIMSKVHPVRSHSVAAAGGINAAINPADDWRSHAYDTVKGSDFIGDQDAIEVMCREAPHEVMHLEHIGVTFHRNETGALDLRAFGGASTKRTAYVADITGQAILHVLYEQLMKYHERVDRYEEWFTTSLLQDETGAVSGCIARDIRTGTLEIFTAKNVILATGGAGQCFKPTTNGLICTGDGIAQAYRLGAPLMDMEMVQYHPTCLVENGFLITEGARGEGAHLLNANGERFMEKYAPNKMELASRDVVSRAEQTEINEGRGVGPGGVGIYLDITVVPKKRTLEALREIVNIGKDFAGVDITREPILIRPGQHYIMGGVKTDIDGATPIEGLYAAGEVACVSVHGGNRLGANSLLDTLIFGRRAGEHAAQRAAGMAQPKPAAQQARLNDEQAWVKSIIDRPQTGRRIAEIKDELGTEMNRNVAVFREQAGLEHALEVVRRLKEEAKTAYVDDKGSVFNQDVLGAIELGYMLDCAECTVVAAIERKESRGAQFRTDYPERNDEVWMKHITLSRNGGDSPEIDYAPVTITQWQPEERKY
>NZ_CP042430.1|WP_146917940.1|1653378_1654548_-|CBS-domain-containing-protein
MFSGRGSVQLARVFGIRIGASPSWFVVLFVMIYSFSGFFDSVLDVSNSVAYLVTVAAVLLFFVSLALHELGHALVARRNGIEVLGIDLWIFGGLAKLSRDSETPGEEFRIAAAGPAVTALIALICLGGVAATSHLGEAVDSYTHGDSTTPLLALLSWLGIVNLWLLAFNLLPGFPLDGGRIARAAIWRATGDRHRATRAAGRIGQGLAYLLMGFGLYLALGGGDPFAGIWLLILGWFISSGARGAIAASAFSDRIDGVTAADVMDAEPVAVPGTTTALAAQDEFFLRYRLPWFPVTDAAGRVLGLLRAELVDGALASGRPTLPVDDLLDAAADGDAHVARDTPLESLLSSEALRRLGALVVVDADGRLCGLVTLDHVRRALAAGLELRP
>NZ_CP042430.1|WP_146917942.1|1654625_1655201_+|leucyl/phenylalanyl-tRNA--protein-transferase
MDVATILGLYAQGLFPMDEPGAPDLPWWAADPRTVFGLDAPARAGVRRRVRRSLAAREGWELRVDGAFDEVVTACARPRGPHDGVWLTPRMHELYRALHAAGHAHTFEVWLDDGLAAGLVGVTIGRAAMLESMFHRVPHAGNVLVSLTLDALAASGYELCDIQTATDHTLFLGAVQIPREEYERRLCAALG
>NZ_CP042430.1|WP_146917944.1|1655203_1655608_-|nuclear-transport-factor-2-family-protein
MTAPAPHPFRAAVEAGDIEAAIATLAPGIVFHSPAVFHPYVGRDTVAALLRLVFETFEDFRYTDEIGGSDGTEALVFRAAVGGRELEGLDLLRTGSDGLVQDFTVMIRPLSGLLALAQALGPKVEAAGLKATGA
>NZ_CP042430.1|WP_146917946.1|1655630_1657310_-|DNA-alkylation-response-protein
MSTITRPDALGATHEVLNQVPPMEGRNLYLDHAALVEGLEREGGGWAHARAAEAGAFWGAEPIRWGFEANEHPPVLHTHDRQGNRLDAVEFHPSWHRLMARGVHDEMHALPWNDPRPGANVARAAIYLSGTQAEAGFGCPITMTYAAVPALRATPEVAQEWVPRLTARGYDGALRPADQKPGAICGMAMTEKQGGSDVRANTTIALPAGAATGAGAEYLLVGHKWFCSAPMSDLFLVLAQTDEGLSCFAVPRFLPDGAKNAGFQLQRLKDKLGNRSNASSEVEFRRAWGRMVGEPGRGVPTIIEMVGHTRLDCVIGAAGGMRAAVAAATWHAQHREAFGRRLVDQPLMRNVLADLAVESEAATVLALRLCRAYDEAAAGDEGADHLRRLATAVGKYHVCKRVPNHAFEALECLGGNGYVEASGMPRLYREAPLCSIWEGSGNVMALDVLRALRRTPQALDAYLAELDLAAGHDDRYDAFTESLRDEFTRPDDLEHRARLVVEHLAIALEASLLIRHAPAAVADAFTATRVAGGGGLHYGTLPAGTDVGAIIERHAPQAA
>NZ_CP042430.1|WP_146917949.1|1657287_1657935_-|TetR-family-transcriptional-regulator
MPYRPTERTEARRVAARGVIVDAATELVAHGGYREAQVAAVARRAGVATGTVYRHFPSKADLLVEVFRRAARREVDAVASATAGREDARDALAEAVRTFARRALRSRRLAWALLAEPVDPAVEAERLAFRRAYAAVFAATIRDGIARGQLPAQDAGLTATALVGAVGEALVDWVAPASPTTPARDAGALLQGLVTFCLRATTDQEHDADVHHHAA
>NZ_CP042430.1|WP_146917951.1|1658201_1660379_+|NADP-dependent-isocitrate-dehydrogenase
MKIIYTHTDEAPALATRSLLPIVEAFAATAGVELELRDISLSGRILAQFPDLLAPDQRVPDALAELGELARTPEANIIKLPNISASVPQLKAAIAELQQQGHAIPDYPEDPSTDAERDVRSRYDAVKGSAVNPVLREGNSDRRAPASVKAFARKHPHSMGAWSADSRTHVATMDDGDFRSTERSVTVAQATDVRIEHVDGDGAVTVLKASTPLLAGEVIDASVMRHAALQAFFRQQIADAAQQGVLFSVHLKATMMKVSDPIIFGHAVRAFVGDEVFAGLGDVSPNDGLASLLGAHPEAQEAVDRALSDGPALYMVDSDRGITNLHAPSDVIVDASMPALIRASGQGWDAAGAQQDTKCVIPDSSYAALYAETIAHCREHGAFDPATMGTTPNVGLMAQKAEEYGSHDKTFEIAAAGVVRVVDADGATLLEHDVQPGDIWRMCQTKDAPIRDWVALAVGRARATGAPAVFWLDETRAHDAEVLRKVRPALEALDTDGLQIEILPVAEAARFTLERARRGEDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQFLKEDHLRWDSLGEFLALAVSLEMLAQKTGNARAQLLADTLDRATGSVLEEGRSPSRRCGELDNRGSHFYLALYWAQELAGQDQDAELAARFAPLARRLAEAETTIVEELNAVQGSPVDVGGYFRPDPERVEAAMRPSATLNAALAEFA
>NZ_CP042430.1|WP_146917953.1|1660433_1661420_+|malate-dehydrogenase
MSKTVTVTGAAGAIGYALLFRIASGQLVGPDEKVRLRLLEIEPALKAAEGTAMELVDCAFPLLEAIDITADPNEAFDGANIAMLVGARPRTKGMERADLLEANGAIFQPQGKAINDHAADDIKVLVVGNPANTNALIAMNNAPDVPRERFTAMTRLDQNRAYGQLAAKLAIPLTDIEDLVIWGNHSPTMFPDLFNAKIKGPPSQKAVDAVDDMAWYENEYLPNVGKRGAAIIEARGASSAASAANAAIDHIHDWVLGADGLVSMAVPSGGQYGVPDGLVSSFPVRVSGGDYEIVEGLEVGEFAQSKIDITVNELKEEQAAVKSLGLIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP042430_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042430_3

3426460-3426603

Orphan

Consensus_repeat	Method
GCCACCACCGACGCCGGCAACGTG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP042430_3

>merge|NZ_CP042430|3|3426460-3426603|PILER-CR
GCCATGACCGACGCCGGCAACGTGTCGCTGGACCTCTTCGGCGAGCCCACCCGCACCGAGGCGCGGTCCGACGCCGGCAACGTGCGGGTGACGGTGCCCTACGGGCCCTACCGCGTCGACGCCACCACCGACGCGGGCAACGTG

>NZ_CP042430|3|1|3426460-3426603|PILER-CR
GCCATGACCGACGCCGGCAACGTG	TCGCTGGACCTCTTCGGCGAGCCCACCCGCACCGAGGCGCGGT
CCGACGCCGGCAACGTGCGGGTGA	CGGTGCCCTACGGGCCCTACCGCGTCGACGCCACCA
CCGACGCGGGCAACGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP042430.1\|WP_146921120.1\|3424038_3425361_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP042430.1\|WP_146921113.1\|3421654_3422713_-\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237264
NZ_CP042430.1\|WP_146921107.1\|3418617_3419475_+\|diaminopimelate-epimerase	unknown	unknown	gnl\|CDD\|234768
NZ_CP042430.1\|WP_146921126.1\|3426717_3428682_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|270246
NZ_CP042430.1\|WP_146921109.1\|3419522_3420521_+\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	unknown	unknown	gnl\|CDD\|274635
NZ_CP042430.1\|WP_146921122.1\|3425424_3425874_-\|dUTP-diphosphatase	unknown	unknown	gnl\|CDD\|234802
NZ_CP042430.1\|WP_146921137.1\|3431799_3432456_+\|DUF2064-domain-containing-protein	unknown	unknown	gnl\|CDD\|275102
NZ_CP042430.1\|WP_146923794.1\|3432515_3433103_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|100107
NZ_CP042430.1\|WP_146921133.1\|3430031_3431099_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NZ_CP042430.1\|WP_146921139.1\|3434462_3434951_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146921129.1\|3428420_3429113_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224095
NZ_CP042430.1\|WP_146923796.1\|3433185_3434466_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|238198
NZ_CP042430.1\|WP_146921115.1\|3422754_3423576_+\|DUF429-domain-containing-protein	unknown	unknown	gnl\|CDD\|377266
NZ_CP042430.1\|WP_146921117.1\|3423538_3423967_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133390
NZ_CP042430.1\|WP_146921131.1\|3429112_3429916_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213262
NZ_CP042430.1\|WP_146921111.1\|3420536_3421649_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|274636
NZ_CP042430.1\|WP_146921135.1\|3431146_3431800_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133022
NZ_CP042430.1\|WP_146921104.1\|3416863_3417655_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223377
NZ_CP042430.1\|WP_146921141.1\|3435909_3437199_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP042430.1\|WP_146921106.1\|3417636_3418605_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626

Protein	Function_ID	Function_description	E-value
NZ_CP042430.1\|WP_146921120.1\|3424038_3425361_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	8.2131e-171
NZ_CP042430.1\|WP_146921113.1\|3421654_3422713_-\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237264	PRK13007, PRK13007, succinyl-diaminopimelate desuccinylase; Reviewed.	7.69744e-112
NZ_CP042430.1\|WP_146921107.1\|3418617_3419475_+\|diaminopimelate-epimerase	gnl\|CDD\|234768	PRK00450, dapF, diaminopimelate epimerase; Provisional.	6.13694e-82
NZ_CP042430.1\|WP_146921126.1\|3426717_3428682_-\|ABC-transporter-permease-subunit	gnl\|CDD\|270246	cd13528, PBP2_osmoprotectants, Substrate-binding domain of osmoregulatory ABC-type transporters; the type 2 periplasmic-binding protein fold. This family represents the periplasmic substrate-binding component of ABC transport systems that are involved in uptake of osmoprotectants (also termed compatible solutes) such as betaine, choline, proline betaine, carnitine, and L-proline. To counteract the efflux of water, bacteria and archaea accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.86133e-95
NZ_CP042430.1\|WP_146921109.1\|3419522_3420521_+\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	gnl\|CDD\|274635	TIGR03535, DapD_actino, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. This enzyme is part of the diaminopimelate pathway of lysine biosynthesis. This model represents a clade of the enzyme specific to Actinobacteria. Alternate name: tetrahydrodipicolinate N-succinyltransferase.	4.39756e-161
NZ_CP042430.1\|WP_146921122.1\|3425424_3425874_-\|dUTP-diphosphatase	gnl\|CDD\|234802	PRK00601, dut, dUTP diphosphatase.	5.57304e-46
NZ_CP042430.1\|WP_146921137.1\|3431799_3432456_+\|DUF2064-domain-containing-protein	gnl\|CDD\|275102	TIGR04282, hypothetical_protein, transferase 1, rSAM/selenodomain-associated. Members of this protein family show strongly correlated phylogenetic distribution, and in most cases co-clustering, with an unusual radical SAM enzyme (TIGR04167) whose C-terminal pfam12345 domain often contains a selenocysteine residue. Other members of the conserved gene neighborhood include another putative glycosyltransferase, an alkylhydroperoxidase family protein (TIGR04169), and a phosphoesterase family protein (TIGR04168). The cassette is likely to be biosynthetic but its exact function is unknown. [Unknown function, Enzymes of unknown specificity].	4.75152e-45
NZ_CP042430.1\|WP_146923794.1\|3432515_3433103_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|100107	cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).	3.7076e-08
NZ_CP042430.1\|WP_146921133.1\|3430031_3431099_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.56395e-70
NZ_CP042430.1\|WP_146921129.1\|3428420_3429113_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	4.31349e-52
NZ_CP042430.1\|WP_146923796.1\|3433185_3434466_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|238198	cd00321, SO_family_Moco, Sulfite oxidase (SO) family, molybdopterin binding domain. This molybdopterin cofactor (Moco) binding domain is found in a variety of oxidoreductases, main members of this family are nitrate reductase (NR) and sulfite oxidase (SO). SO catalyzes the terminal reaction in the oxidative degradation of the sulfur-containing amino acids cysteine and methionine. Assimilatory NRs catalyze the reduction of nitrate to nitrite which is subsequently converted to NH4+ by nitrite reductase. Common features of all known members of this family are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate.	6.47547e-23
NZ_CP042430.1\|WP_146921115.1\|3422754_3423576_+\|DUF429-domain-containing-protein	gnl\|CDD\|377266	pfam04250, DUF429, Protein of unknown function (DUF429).	3.51956e-08
NZ_CP042430.1\|WP_146921117.1\|3423538_3423967_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	2.18427e-07
NZ_CP042430.1\|WP_146921131.1\|3429112_3429916_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213262	cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter. OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	2.50228e-138
NZ_CP042430.1\|WP_146921111.1\|3420536_3421649_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|274636	TIGR03537, DapC, succinyldiaminopimelate transaminase. The four sequences which make up the seed for this model are not closely related, although they are all members of the pfam00155 family of aminotransferases and are more closely related to each other than to anything else. Additionally, all of them are found in the vicinity of genes involved in the biosynthesis of lysine via the diaminopimelate pathway (GenProp0125), although this amount to a separation of 12 genes in the case of Sulfurihydrogenibium azorense Az-Fu1. None of these genomes contain another strong candidate for this role in the pathway. Note: the detailed information included in the EC:2.6.1.17 record includes the assertions that the enzyme uses the pyridoxal pyrophosphate cofactor, which is consistent with the pfam00155 family, and the assertion that the amino group donor is L-glutamate, which is undetermined for the sequences in this clade.	5.95153e-124
NZ_CP042430.1\|WP_146921135.1\|3431146_3431800_+\|glycosyltransferase	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	5.82242e-38
NZ_CP042430.1\|WP_146921104.1\|3416863_3417655_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223377	COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only].	6.33919e-55
NZ_CP042430.1\|WP_146921106.1\|3417636_3418605_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.86646e-83

>NZ_CP042430.1|WP_146921122.1|3425424_3425874_-|dUTP-diphosphatase
MLPSIAVDELEVRLLRDGARAPARSRPGDAGHDLACVEPVALSPGARAKVPTGVAIALPDGVCGLVVPRSGLAARHGVVPALGLIDPNFRGELCVTLMNTGEEPFAAQAGDRIAQLLLVPFWAPALTVVDELPPSPDDRGADGWGSSGR
>NZ_CP042430.1|WP_146921120.1|3424038_3425361_+|GTPase-HflX
MGQMQRSRNGRTAPNRVGTAPQQQARAKQRAYCIAALEDGDDLSELQELLRTAGVAVVGQAVQHRDRPHPNTYLGPGKLLEVKEAALAADANVVAVDDELSPRQERNLEKELGIPVVDRTTVILDIFAGHANTAEGKLQVELAQLEYNLARMRGLWTHLERLGGGIGTRGPGESQIETDRRLARDRISALKRRLEHVKGTRAVQRAERERAHLPQVALAGYTNAGKSTLLNALTGSEVGVRDRLFHTLDPTTRQLQIDGRPYLMTDTVGFIRKLPHQLVDAFGATLEETTRADLILHVLDASAPEEEGLAMLRSVEDTLEEIGAGERPRLLVLNKIDALDEAGRAALPHRHPRGIPVSAKTGEGLEALRDAIELAFARTLTSVELLLPYSEGGRLAELHEVAGDLHREDTAEGVRVVARLPAAVAERFARFAVDGRPLAS
>NZ_CP042430.1|WP_146921117.1|3423538_3423967_-|MerR-family-transcriptional-regulator
MSEYGRAPGAPTVTDDPRPDDWIRIGAAASALGVSVDTLRRWERDGRVRFQRRGRQRYLPAATLAELMRDRHRDHAASGHTRLAGVVLSVQRDGVMAQVELACGPYRVTSLMAGAATDDLGLKPGDPAVAVIASTAVVVEAR
>NZ_CP042430.1|WP_146921115.1|3422754_3423576_+|DUF429-domain-containing-protein
MRYCGIDVSAKPANQQLVTLHERRGADAQELVATFYEPGDVDAVARTVLGFGGEAVAAIDAPSGPRLDLLAAGLPLRMELGLPHGRYERMRVCDALLFRRRLPLYPVPSADQALSRWETWMAVGFELFAALDGLELFRPPAAGVHEAPVGDGALRLGRLCETYPDAVFCTLLGHRPSPKRTPWGLQQRIAALRLRGVVDDDGGLWHRTLDELDACAAAYAAYALAAGQGCWVGDAREGVIVLPTLGLAERYDRLPPPARSALSAPRRPPPSTR
>NZ_CP042430.1|WP_146921113.1|3421654_3422713_-|succinyl-diaminopimelate-desuccinylase
MTDGLADRLADRVLELVDVPSESREEAALAARVLAMLGDRGRDAGDTCVLAGVTERRDRPLVLLAGHLDTVPAQGNLPGARDDGWVTGLGAADMKAALGVMIELALDPPPAATVDVGYVFFGREELPFGDSALTPLLDREPGLRTADLVVVMEPTDNALHAGCVGNINATWTFRGTAGHSARPWLADNAIHRAAAGIAELAVLEPVDHVFAGLTFREVVSVVTVSGGVARNVVPDTCVAEINMRYAPGTSAADAEARLRALCEPHGELVIDGNAPSGAVPEANPLVDRLVAAGDLETAPKQAWTPVAEFAAAGVDAVNFGPGAPRFAHRRDERVAEASLVRSHAILQRFLCA
>NZ_CP042430.1|WP_146921111.1|3420536_3421649_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MLADLGTYPFVRLDEARAGALARGIELIDFGMGEPREVTPEFIRRALAAAIEPVSTYPKAVGMPELRAAIARWIERRFGVVLDPDREVVPTLGSKEAIFHLAQVAGGDAVAVTTPGYPVAARGARFAGMDVLELALDPARGHLPDLGALDPARLDRLAVLWLNYPNNPTGATIGLDDLERAAALARRHDFVLACDEAYSELWFEGPPPASALQLADRTNVVVLNTLSKRSSMPGYRSGFMAGDPELIAALRRYRPNVGVAPQDFVQRASIAAWDDDAHVEEVRERYRAKRDALLPALQAAGFTSVGGPASFFLWLRTPGGEDEEACAMRLLESGIVCAPGSFFGAGGAGHVRFALVPTPEACARAAARLG
>NZ_CP042430.1|WP_146921109.1|3419522_3420521_+|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase
MSEQQQITGGAWAVGLATATPDGRILDAYYVAPRLGTGGAPDGATAGTHPLHITRATDLGGGAFAAAARPDALRDVTVTAVLTVVEDLQAAPADVHDAYLRLHLLSHRLVAPNTINLTGVFAVLPNVAWTNRGPVDLEALDAVRLRARALDRPLSVTSVDKFPRMTDYVVPAGVRIADADRVRLGAHLAAGTTVMHEGFVNYNAGTLGASMVEGRISQGVVVGDGTDIGGGASIMGTLSGGGTETITIGERCLIGAEGGLGISLGDDCVIEAGLYVTAGTRVTTPDGEVVKAQELSGAPNLLYRRNSMTGTVEVLPRTGGWGGLNAALHAND
>NZ_CP042430.1|WP_146921107.1|3418617_3419475_+|diaminopimelate-epimerase
MRFEKWQALGNDYIILERAQLPFALTAARVRRLCDAHLGIGSDGVLELSEADADGFVARLRIFNPDGSEAELSGNGAREAVMYLRRRGWTDRAQFSIQTAAGEIRPTIHDDRTCALAMGRARLQSADFPSGGADGTGTLEATGQTWHFQHVQVGNPQCAIHVPDGDALQALDLPRIGPGIERHPLFPNRTNVSFFRAEAADRIRARIFERGVGETSASGTGACGAAIAHVLRGGDSPVTVRLDGGELAVDVDESLLFTLTGWAVPVYTGELAPELLADLAGDEPA
>NZ_CP042430.1|WP_146921106.1|3417636_3418605_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MNRAVPCRNPLTRGGRRAPTPAGILRGVPVLALFGPTGIGKTALALEVADRLRARGERPVAVSADALQVYRGLETLTGVASPAEQERLEHRLVAFVDVRETFSVARYAALAHAEIDALLDAGATPIVVGGTGLYLRAALAELELRPPPAPGVRERLMADAAARGTEVLHAELAARAPAAAAGIDPRDRHRVVRALELEAQGALASPPEDNRLWTADTRRPTRLVALTMQRAELHARIDARVEAMVAAGAAREVAAADAAGASPTARKALGFDELLAGDVEAMKTRTRRYARRQLTWLRKLPGVEHVDLTGRRAADVAAELVG
>NZ_CP042430.1|WP_146921104.1|3416863_3417655_-|SDR-family-NAD(P)-dependent-oxidoreductase
MELRGSSVLLTGATGGIGHAIARRLGAEGAALLLTGRRADVLEPLAAEVGGRATAVDLGQRDAVDRLLEEAGDVDVLVANAALPASGNVLDFRTDQIDAALEVNLRAPMILSRVLGERMAGRGRGHIVLISSLSGKSSQPGSAIYSATKFGLRGFGQGLRGDLAPRGVGVSVVFPGFIRDAGMFHESGAKLPRGVGTSTPEQVAAAVVRAITADKGEIDVAPIAMRLGSTFAGIAPELSARVAKRLGGEEIAAQMVRGQADKR
>NZ_CP042430.1|WP_146921126.1|3426717_3428682_-|ABC-transporter-permease-subunit
MARRAAARAARDLRRAARGDHHDRRARRAGLLRRRRRPGPADPQRHRVQVQRRGGRPALRAAGLRARPRAARRPAAAAALAAGEGDVKDAIDYLLHARESVGGGVQIGGSHLLPLLWTHLRVTFEAILIACLVTLPLATWLGHKGRAQLAASTAANVGRAVPSFAVLVFFSTYLGLNVGNLVFAMVLLAIPPIFTNTYVGIRQVDRDVVDAARGMGLTERQLATKVELPLSLPLVFGGIRTSVVNVLATATLGPYVGVDTLGVPIVNANVHGDAGRLGTAILIALLAIAAELIFAALQRAVTPRGLKLSQQPTPTRRNRHMRSRSVLAAVATVVLAFGLAACGSSDNSSSNDSGSGTSTPATTTSTDNGKLIQSNPENGSKPTITIGSKNFTEEFILGEIYAQALQAAGYKVKKQLNLGSEQIALKALKAGRVDAYPEYTGTVLTSFCKVKDKAVPHDETAAYDQAKACMAKEGITALPHTPFTDSNGFAVTQATAQKLGGITKLSDLKAKASTLTVSGPPECQQRTDCLLGLESVYGLKFKKFLSIDLAKRHEVIKNGQSDVGEVFTTDGQIKADNLVLLQDDKQLFPPYNVTLLASTKVADAAGPDFAKVVSSVNEGLTTPVMQELNSRVDLDKQTPAAVAGEYLKEAGYLK
>NZ_CP042430.1|WP_146921129.1|3428420_3429113_-|ABC-transporter-permease-subunit
MLAQVTIHRRDQHSCVQDNGFCPDWIVHHLGEYTAPLWRHVELTMASVALGMAIALVLAIVARRRRWLTGPIVGVTGILYTIPSLAFFALLLPLTGFGFVTALIPLTAYTLLILFRNIVTGLDNVPAEARDAALGMGFTPRQLLWRVELPLALPEIFAGLRVATTTTVGLAALAFYAGGGGLGQQILSDIAFKSNVAVAGLLCVLLAFVLDLGLLGAQRLLLPWQRARAT
>NZ_CP042430.1|WP_146921131.1|3429112_3429916_-|ATP-binding-cassette-domain-containing-protein
MPASSAATLEFRQVSKVYPGSPEPAIRELSLEVAAGELCILIGPSGCGKTTAMRLANRMIELTGGDVLVDGVSVRDRAPAELRRTIGYAIQQIGLFPHLTVAENIGTVPRLLGWESGRIRARVAELLELVGLEADMGGRYPAQLSGGQRQRVGVARALAADPPLLLMDEPFGAIDPITRARLQEEFRRLQRELDKTVVFVTHDIDEALKLGDRIAVLKPGGVLAQFATPDELVRHPADAFVEEFVGADRMIARLEWLTSVRQEGRRT
>NZ_CP042430.1|WP_146921133.1|3430031_3431099_-|NAD-dependent-epimerase/dehydratase-family-protein
MRILVTGGAGFVGSHIADQLLEAGHEVRIVDALLPTAHDGGPPWLPAGAEVVTADLRDPEVAAAAVAGVGAVCHQASMVGLGADIMDIADYVAHNDLATAVLLRALARRSFAGRIVLASSMVVYGEGRYACPEHGLVAPGPRATADLDAGRFEPPCHRCGRPLVPQAVPEDAPADPRNVYAATKLHQEHLLAAFAREQDGVDVTALRYHNVYGPRMPRDTPYAGVASIFRSALERGEAPSVFEDGAQIRDFVHVGDVARANVLALGCEEPAPGAYNIASGVPRTVGDMARALAAALPGAPEPVVTGAYRRGDVRHVFASPQRAAEVLGFRARVGLEEGMAEFAHAPLRLPAVGGG
>NZ_CP042430.1|WP_146921135.1|3431146_3431800_+|glycosyltransferase
MLHVDVDVILPVLDEARALPWVLGRLPAGYRAVVADNGSTDGSDAIARGLGAAVVGEPRRGFGAACHAGLRAARADVVCFMDCDGSLDPADLPAIAGPVLRGEADLVLGARRADRGAWPPHARLANRVLVWELARRGGPRLEDLGPMRAARREALLDLGIQDRRFGYPLEMVVRAHRRGWRIAEAGVPYRAREGRSKVTGTVRGTVRTVRDMAAVLA
>NZ_CP042430.1|WP_146921137.1|3431799_3432456_+|DUF2064-domain-containing-protein
MPGPARPAATTVAVIAKAPVPGRVKTRLCPPCTPRQAAALAEASLRDTLAAMDGLDAAVGRAIVLDGAAGPWHGTERLLAQRGGGLDERLAAAFTDLGGPALIVGMDTPQLRTGHLLRALGALEDHEAVLGPARDGGYWAIGLRDPSRAAEVLHGVPMSVGGTLAAQRRRLAGAALRWDEVDELHDVDTIADAAHVAALAPASRFAAVLQSLDLRRAA
>NZ_CP042430.1|WP_146923794.1|3432515_3433103_+|methyltransferase-domain-containing-protein
MSEGALVVRYDDEERVALDVARWLGPVTAADETVLQRAVGPVLDIGCGPGRHVHALARRGVLALGVDVSPDAVRLARSRGAPVVEGSVFDVVPGPHRWGSALLLDGSVGIGGAPRRLLGRVRELLVPGGRLLVETEAPGVATRTVRARLEGTGARSAAFPWALVGADGIGALGAATGFATVERWCDDGRWFAELR
>NZ_CP042430.1|WP_146923796.1|3433185_3434466_+|molybdopterin-dependent-oxidoreductase
MRVTELLRDPPAPPGPFRPGFWRSPLRGPWMTTVLGSLLLLGVTVVAVTGLLSHAAYEPGLGANAIVPAGRDLPLTFTWPTSPAWLYALDQGLHVNVGLVTIPLLLAKLWSVIPRLFAWPPVASAAEGLERLGIALLVGSALFEFATGVVNMQNWYPFSFNFVVAHYYGAIVFIASILLHVAIKLPVMRRAWRERDGLAPLRASLAQTVPEPPDEHGLVAAQPAAPTISRRGLLGLVGVGSATLLVSNVGESIGGPLRGTALLAPRRTSGPGPNGFPVNKTARAARITPAMTGDAWRLRLAAGSRSVVLSRADLLALELRTEELPIACVEGWSTSQHWEGVPLIALARMVGGDRTSHVLVRSLQKSGVLRRATLTRNQYADDRALLALRVNGADLSPDHGYPARIIVPALPGVHTTKWVSDLRFGA
>NZ_CP042430.1|WP_146921139.1|3434462_3434951_+|hypothetical-protein
MTALRRHYGATSVHLLAHLVALPLAAWAILQVVDFRGARDVVVWFVAALVLHDLVALPAYTALDRVAQRARVRGVAVVNHLRVPAVMSGVTLLVFFPLILGRSTGSLHYLSGVTPTGYLGRWLLVVAAAWGGSAAVLGVRLLRADDLHDAGGAPGDHDGAQG
>NZ_CP042430.1|WP_146921141.1|3435909_3437199_+|hypothetical-protein
MTRVTDRWMLLGALVLAAVWTVLGLGIEHGGGVLGTASPPFVMGWVPRIDVWALAAVAVLGALVAAGPALLVVRLPAFLAATTALALGAALALNAARSGTHGWWAIFDTRPGGSFEAKNEYLPGLPALSYGPRFFLDRFAELVPAMPVNVAGHPPGLLLGVDALGLSTPRRLAALCIAAAAATAPLTWALARGLGAGAARARVAGLLAAASPGLLLFGATSADAVYAALGTATAALLVRRGRAAPAAGTLLLAVAAFCSWALLALGAFAVLVVARRDGLRRAAVLAVACAVPFLVLNGALAAAVGYDPVGTLRATEGVYRRSVAEVRPWWFWSLGSPVAWGVSGGLAVTGAWLVAVRRRDTAALALAAIVVIASAAGFTKAETERIWLIFAAPACAAAAAVLPPRALRIVLLALAVQALATQLLFETVW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4570608 : 4623454

Bacillus_phage(37.5%)

protease,transposase,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_146922367.1\|4570608_4571217_-\|protease	DJ-1/PfpI/YhbO family deglycase/protease	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.3e-13	31.0
WP_146922368.1\|4571278_4571791_+	rubrerythrin	NA	NA	NA	NA
WP_146922369.1\|4571928_4572732_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_146922370.1\|4572728_4573118_-	hypothetical protein	NA	NA	NA	NA
WP_146922371.1\|4573127_4573331_-	hypothetical protein	NA	NA	NA	NA
WP_146922372.1\|4573340_4574009_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_146922373.1\|4574005_4574497_-	hypothetical protein	NA	NA	NA	NA
WP_146922374.1\|4574531_4575284_-	SigB/SigF/SigG family RNA polymerase sigma factor	A0A218KDJ1	Bacillus_phage	7.9e-24	33.6
WP_146922375.1\|4575419_4576634_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_146922376.1\|4576560_4577715_-	SigB/SigF/SigG family RNA polymerase sigma factor	A0A0Y0AU18	Bacillus_phage	9.6e-21	32.7
WP_146922377.1\|4577748_4578045_+	ANTAR domain-containing protein	NA	NA	NA	NA
WP_146922378.1\|4578209_4579151_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_146922379.1\|4579147_4582825_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	5.1e-07	35.6
WP_146922380.1\|4582809_4584792_-	hypothetical protein	NA	NA	NA	NA
WP_146922381.1\|4586210_4587026_-	hypothetical protein	NA	NA	NA	NA
WP_146922382.1\|4587012_4589277_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	3.5e-51	32.2
WP_146922383.1\|4589340_4590495_-\|protease	MarP family serine protease	NA	NA	NA	NA
WP_146922384.1\|4590540_4592268_+	hypothetical protein	NA	NA	NA	NA
WP_146922385.1\|4592349_4592907_-	hypothetical protein	NA	NA	NA	NA
WP_146922386.1\|4592921_4593464_-	hypothetical protein	NA	NA	NA	NA
WP_146922387.1\|4593518_4593788_-	hypothetical protein	NA	NA	NA	NA
WP_146922388.1\|4594037_4594625_+	FHA domain-containing protein	NA	NA	NA	NA
WP_146922389.1\|4594730_4595549_+	AAA family ATPase	Q8JL10	Natrialba_phage	3.7e-19	31.8
WP_146922390.1\|4595545_4596316_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_146922391.1\|4596383_4597238_-	homoserine kinase	NA	NA	NA	NA
WP_146922392.1\|4597414_4598428_-	threonine synthase	NA	NA	NA	NA
WP_146922393.1\|4598427_4599651_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_146922394.1\|4600960_4601683_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_146915057.1\|4601679_4602648_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_146922395.1\|4602827_4604039_-	peptidoglycan DD-metalloendopeptidase family protein	A0A075BS18	Microcystis_phage	3.2e-19	41.1
WP_146922396.1\|4604158_4605085_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_146922397.1\|4605094_4605667_+	hypothetical protein	NA	NA	NA	NA
WP_146922398.1\|4605663_4607322_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_146922399.1\|4607334_4608126_-	hypothetical protein	NA	NA	NA	NA
WP_146922400.1\|4608023_4608407_-	ATP-binding protein	NA	NA	NA	NA
WP_146922401.1\|4608668_4609472_+	hypothetical protein	NA	NA	NA	NA
WP_146922402.1\|4609490_4609775_-	hypothetical protein	NA	NA	NA	NA
WP_146922403.1\|4609771_4610524_-	PspA/IM30 family protein	NA	NA	NA	NA
WP_146922404.1\|4610723_4611338_-	NlpC/P60 family protein	NA	NA	NA	NA
WP_146922405.1\|4611661_4612864_+	hypothetical protein	NA	NA	NA	NA
WP_146922406.1\|4612860_4613187_+	hypothetical protein	NA	NA	NA	NA
WP_146922407.1\|4613249_4614272_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_146922408.1\|4614282_4615623_+	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	1.6e-27	31.4
WP_146922409.1\|4615619_4615859_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_146922410.1\|4615855_4616911_+	hypothetical protein	NA	NA	NA	NA
WP_146922411.1\|4616995_4617793_+	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_146922412.1\|4617783_4618818_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_146922413.1\|4618711_4619407_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_146922414.1\|4619564_4620890_-	DUF21 domain-containing protein	NA	NA	NA	NA
WP_146922415.1\|4620980_4621271_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_146922416.1\|4621283_4622174_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_146922417.1\|4622716_4623454_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042430

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection