CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP042474	Spiroplasma citri strain CC-2 plasmid pScpCC2-2, complete sequence	0 crisprs	NA	0	0
NZ_CP042472	Spiroplasma citri strain CC-2 chromosome	0 crisprs	cas4	0	15
NZ_CP042473	Spiroplasma citri strain CC-2 plasmid pScpCC2-1, complete sequence	0 crisprs	NA	0	0
NZ_CP042475	Spiroplasma citri strain CC-2 plasmid pScpCC2-3	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP042475_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP042475_1

715-860

Orphan

Consensus_repeat	Method
TTTTTTATATTCTCAAATAAAGAACCTTTCTTTACTGTCATAAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP042475_1

>merge|NZ_CP042475|1|715-860|CRISPRCasFinder
TTTTTTATATTCTCAAATAAAGAACCTTTCTTTACTGTCATAATATTATCATTTACTAAATTATTTTTTGGTTGAAAAGATTTATCAACAGAATTAATACTATTTTTTATATTCTCAAATAAAGAACCTTTCTTTACTGTCATAAT

>NZ_CP042475|1|1|715-860|CRISPRCasFinder
TTTTTTATATTCTCAAATAAAGAACCTTTCTTTACTGTCATAAT	ATTATCATTTACTAAATTATTTTTTGGTTGAAAAGATTTATCAACAGAATTAATACTA
TTTTTTATATTCTCAAATAAAGAACCTTTCTTTACTGTCATAAT

Protein	Function_ID	Function_description	E-value
NZ_CP042475.1\|WP_147077916.1\|1061_1286_-\|AAA-family-ATPase	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.4112e-09
NZ_CP042475.1\|WP_147077918.1\|1318_1639_-\|AAA-family-ATPase	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	2.00602e-15

>NZ_CP042475.1|WP_147077914.1|340_574_-|hypothetical-protein
MILNELKRLNYKINLSQLVRREVAKILRRTHQGNQINLKRKEVIKMKCWFKKIFSKKEKQESKCNNENKFTRKYLRM
>NZ_CP042475.1|WP_147077916.1|1061_1286_-|AAA-family-ATPase
MLSDKIDYVFFDVFPSFNKILLNVLLCCDEIIIPIEPHKFSYEGFKTINEPYNKTIIMLNELGIKCKIIWIIYY
>NZ_CP042475.1|WP_147077918.1|1318_1639_-|AAA-family-ATPase
MKKITFANSKGGVGKTTITLNMINILSQVDKKILVFDIDPQANLSRSLLNEYTSIKNIEVWFKDSTADELINSMMESNIKNVLIVPAYKKLVLETNTAVTSMGMGN
>NZ_CP042475.1|WP_147077920.1|1732_1915_+|hypothetical-protein
MGGENEALVAENEALVAENEALVAENEALVAENEALVAENEALVAENEAISIKNKKLNKK
>NZ_CP042475.1|WP_147077922.1|2358_2682_-|hypothetical-protein
MKRKNYGERVNEKYNLVGFHYLTVEQQRFKNMQKANPFFLQFKNVKESMEWHRQQAKEQREQLNALLMNRKKNTDTKVSENDVISKFNSDYENKNINQPKIKKGLLI
>NZ_CP042475.1|WP_162302587.1|2615_2810_-|hypothetical-protein
MVRFGTIYISSSKKFCHLDKNKENYLIGIKQHYTYNVYDAEKNWKEKITGKELMKNTTWLVFII

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP042475_1	1.1\|759\|58\|NZ_CP042475\|CRISPRCasFinder	759-816	58	NC_007386	Spiroplasma citri plasmid pSciA strain GII3	2641-2698	0	1.0
NZ_CP042475_1	1.1\|759\|58\|NZ_CP042475\|CRISPRCasFinder	759-816	58	NZ_CP042475	Spiroplasma citri strain CC-2 plasmid pScpCC2-3	759-816	0	1.0

1. spacer 1.1|759|58|NZ_CP042475|CRISPRCasFinder matches to NC_007386 (Spiroplasma citri plasmid pSciA strain GII3) position: , mismatch: 0, identity: 1.0

attatcatttactaaattattttttggttgaaaagatttatcaacagaattaatacta	CRISPR spacer
attatcatttactaaattattttttggttgaaaagatttatcaacagaattaatacta	Protospacer
**********************************************************

2. spacer 1.1|759|58|NZ_CP042475|CRISPRCasFinder matches to NZ_CP042475 (Spiroplasma citri strain CC-2 plasmid pScpCC2-3) position: , mismatch: 0, identity: 1.0

attatcatttactaaattattttttggttgaaaagatttatcaacagaattaatacta	CRISPR spacer
attatcatttactaaattattttttggttgaaaagatttatcaacagaattaatacta	Protospacer
**********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

87100 : 91868

Spiroplasma_virus(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071890527.1\|87100_87250_+	hypothetical protein	A8RHI0	Spiroplasma_virus	2.4e-09	71.4
WP_071890530.1\|87249_87501_+	hypothetical protein	A8RHI2	Spiroplasma_virus	2.2e-31	85.5
WP_147076649.1\|88449_88809_+	hypothetical protein	NA	NA	NA	NA
WP_071890537.1\|88792_89242_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	3.0e-71	91.3
WP_071890543.1\|89395_89599_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_147076651.1\|89598_90612_+	hypothetical protein	A8RHJ5	Spiroplasma_virus	9.8e-171	90.2
WP_015979226.1\|90604_91009_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	3.8e-41	98.9
WP_015967964.1\|91008_91245_+	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_071890548.1\|91256_91868_+	DUF3688 family protein	A8RHK2	Spiroplasma_virus	2.3e-90	84.2

DBSCAN-SWA_2

237087 : 244864

Spiroplasma_virus(87.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147076754.1\|237087_238062_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	6.8e-28	32.2
WP_071892025.1\|238663_240853_-	DUF3688 family protein	A8RHK2	Spiroplasma_virus	0.0e+00	83.6
WP_015967964.1\|240864_241101_-	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_015979226.1\|241100_241505_-	hypothetical protein	A8RHJ8	Spiroplasma_virus	3.8e-41	98.9
WP_071890544.1\|241497_242511_-	hypothetical protein	A8RHJ5	Spiroplasma_virus	3.4e-171	90.5
WP_071890543.1\|242510_242714_-	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_084566904.1\|242866_243307_-	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	6.8e-68	89.7
WP_015979232.1\|243299_243641_-	hypothetical protein	NA	NA	NA	NA
WP_015979231.1\|243937_244177_-	hypothetical protein	NA	NA	NA	NA
WP_015979230.1\|244612_244864_-	hypothetical protein	A8RHI2	Spiroplasma_virus	2.0e-32	88.0

DBSCAN-SWA_3

459294 : 467440

Staphylococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937084.1\|459294_460164_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.0e-91	53.2
WP_071937085.1\|460163_460646_+	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.6e-22	37.1
WP_071937086.1\|460647_461433_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_071937087.1\|461458_462769_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	2.0e-107	49.2
WP_071937088.1\|462868_463630_+	segregation/condensation protein A	NA	NA	NA	NA
WP_004028618.1\|463635_464184_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.7e-15	31.6
WP_147076849.1\|464183_464921_+	pseudouridine synthase	NA	NA	NA	NA
WP_004028620.1\|464936_465545_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	8.9e-18	35.1
WP_071937090.1\|465647_466841_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-29	34.1
WP_071937091.1\|466876_467440_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	5.5e-22	38.6

DBSCAN-SWA_4

826162 : 833976

Spiroplasma_virus(88.89%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015979229.1\|826162_826312_+	hypothetical protein	A8RHI0	Spiroplasma_virus	3.1e-09	69.4
WP_015979230.1\|826311_826563_+	hypothetical protein	A8RHI2	Spiroplasma_virus	2.0e-32	88.0
WP_015979231.1\|826986_827226_+	hypothetical protein	NA	NA	NA	NA
WP_071890535.1\|827491_827851_+	hypothetical protein	NA	NA	NA	NA
WP_071937346.1\|827834_828284_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	3.9e-71	90.6
WP_071890543.1\|828436_828640_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_071937347.1\|828639_829653_+	hypothetical protein	A8RHJ5	Spiroplasma_virus	1.9e-169	89.3
WP_071937327.1\|829645_830023_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.3e-39	98.8
WP_015967964.1\|830022_830259_+	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_147077199.1\|830270_832430_+	DUF3688 family protein	A8RHK2	Spiroplasma_virus	0.0e+00	83.2
WP_147077200.1\|833001_833976_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	5.8e-27	31.2

DBSCAN-SWA_5

939261 : 945565

Spiroplasma_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937130.1\|939261_939411_+	hypothetical protein	A8RHI0	Spiroplasma_virus	5.7e-11	75.5
WP_071937454.1\|939410_939662_+	hypothetical protein	A8RHI2	Spiroplasma_virus	4.4e-32	88.0
WP_147077265.1\|940612_940972_+	hypothetical protein	NA	NA	NA	NA
WP_147077266.1\|940955_941405_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	2.3e-71	90.6
WP_071890543.1\|941557_941761_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_147077738.1\|941810_942773_+	hypothetical protein	A8RHJ5	Spiroplasma_virus	3.7e-159	89.4
WP_147077268.1\|942765_943143_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.3e-39	98.8
WP_015967964.1\|943142_943379_+	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_147077270.1\|943390_945565_+	DUF3688 family protein	A8RHK2	Spiroplasma_virus	0.0e+00	84.7

DBSCAN-SWA_6

971443 : 982787

Spiroplasma_virus(72.73%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155522121.1\|971443_971581_-	hypothetical protein	A8RHK0	Spiroplasma_virus	1.4e-16	95.6
WP_147077288.1\|971859_972096_+	hypothetical protein	A8RHK0	Spiroplasma_virus	1.9e-32	96.2
WP_071937464.1\|972107_972305_+	hypothetical protein	NA	NA	NA	NA
WP_071937465.1\|973068_973284_-	hypothetical protein	NA	NA	NA	NA
WP_071937466.1\|973828_973978_+	hypothetical protein	A8RHI0	Spiroplasma_virus	6.1e-13	79.6
WP_071937359.1\|973977_974229_+	hypothetical protein	A8RHI2	Spiroplasma_virus	2.6e-32	89.2
WP_084566886.1\|975309_975750_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	4.2e-70	88.4
WP_071937469.1\|975902_976106_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_015979226.1\|977111_977516_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	3.8e-41	98.9
WP_071937470.1\|977515_977752_+	hypothetical protein	A8RHK0	Spiroplasma_virus	1.6e-31	94.9
WP_162302564.1\|977813_977966_+	DUF3688 family protein	NA	NA	NA	NA
WP_147077290.1\|978046_978586_+	hypothetical protein	Q9QTG8	Spiroplasma_phage	5.0e-97	95.0
WP_147077292.1\|978940_979180_+	hypothetical protein	Q9QTI0	Spiroplasma_phage	8.3e-28	89.7
WP_071937475.1\|981053_982787_-\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	3.8e-05	56.4

DBSCAN-SWA_7

1006179 : 1028835

Spiroplasma_virus(72.73%)

terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147077312.1\|1006179_1007640_-\|terminase	PBSX family phage terminase large subunit	A7J291	Streptococcus_phage	3.1e-08	21.5
WP_071937338.1\|1007632_1008040_-	hypothetical protein	NA	NA	NA	NA
WP_147077314.1\|1008343_1009327_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	6.2e-29	32.7
WP_147077316.1\|1010523_1010991_+	DUF3688 family protein	A8RHK2	Spiroplasma_virus	3.3e-12	43.7
WP_147077318.1\|1011001_1013176_-	DUF3688 family protein	A8RHK2	Spiroplasma_virus	0.0e+00	84.0
WP_015967964.1\|1013187_1013424_-	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_071937327.1\|1013423_1013801_-	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.3e-39	98.8
WP_147077738.1\|1013793_1014756_-	hypothetical protein	A8RHJ5	Spiroplasma_virus	3.7e-159	89.4
WP_071890543.1\|1014805_1015009_-	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_071937346.1\|1015161_1015611_-	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	3.9e-71	90.6
WP_071890535.1\|1015594_1015954_-	hypothetical protein	NA	NA	NA	NA
WP_015979231.1\|1016219_1016459_-	hypothetical protein	NA	NA	NA	NA
WP_015979230.1\|1016881_1017133_-	hypothetical protein	A8RHI2	Spiroplasma_virus	2.0e-32	88.0
WP_015979229.1\|1017132_1017282_-	hypothetical protein	A8RHI0	Spiroplasma_virus	3.1e-09	69.4
WP_155522075.1\|1017391_1017541_-	hypothetical protein	NA	NA	NA	NA
WP_071937484.1\|1020170_1020407_-	hypothetical protein	A8RHK0	Spiroplasma_virus	2.4e-32	97.4
WP_071937327.1\|1020406_1020784_-	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.3e-39	98.8
WP_147077320.1\|1020776_1021790_-	hypothetical protein	A8RHJ5	Spiroplasma_virus	1.9e-169	89.3
WP_147077322.1\|1021789_1021993_-	DUF2649 family protein	A8RHJ3	Spiroplasma_virus	1.3e-29	94.0
WP_071937485.1\|1022131_1022503_-	hypothetical protein	NA	NA	NA	NA
WP_147077324.1\|1022504_1022942_-	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	4.7e-69	91.0
WP_071937487.1\|1022934_1023270_-	hypothetical protein	NA	NA	NA	NA
WP_071938058.1\|1023983_1024175_-	hypothetical protein	A8RHI2	Spiroplasma_virus	3.7e-23	88.9
WP_071937489.1\|1024247_1024385_-	hypothetical protein	A8RHI0	Spiroplasma_virus	6.4e-09	73.3
WP_071937491.1\|1024709_1025003_-	hypothetical protein	A0A2H4JCY8	uncultured_Caudovirales_phage	7.3e-10	44.6
WP_155522123.1\|1025187_1025352_-	hypothetical protein	NA	NA	NA	NA
WP_071937493.1\|1025485_1026085_-	hypothetical protein	A0A290GJW3	Caldibacillus_phage	4.8e-24	38.1
WP_071937494.1\|1026087_1026570_-	hypothetical protein	NA	NA	NA	NA
WP_147077328.1\|1026839_1027361_-	hypothetical protein	NA	NA	NA	NA
WP_155522124.1\|1027594_1027753_-	hypothetical protein	NA	NA	NA	NA
WP_071937496.1\|1027883_1028237_-	hypothetical protein	A0A0K2CYS9	Paenibacillus_phage	8.5e-05	31.1
WP_071937497.1\|1028241_1028835_-	hypothetical protein	A0A0A7RW37	Clostridium_phage	3.0e-26	44.4

DBSCAN-SWA_8

1120489 : 1128274

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937586.1\|1120489_1120924_+	single-stranded DNA-binding protein	A7DYE1	Streptococcus_phage	3.7e-10	37.6
WP_147077392.1\|1120926_1121157_+	hypothetical protein	NA	NA	NA	NA
WP_155522131.1\|1121277_1121430_+	hypothetical protein	NA	NA	NA	NA
WP_147077394.1\|1121435_1122131_+	recombinase RecT	A0A0A7RUP3	Clostridium_phage	1.5e-37	41.8
WP_071937589.1\|1122135_1122489_+	hypothetical protein	A0A1B0YEC6	Lactobacillus_phage	1.5e-12	42.6
WP_155522132.1\|1122472_1122616_+	hypothetical protein	NA	NA	NA	NA
WP_071937570.1\|1122634_1122814_+	hypothetical protein	NA	NA	NA	NA
WP_071937590.1\|1123182_1125564_+	N-6 DNA methylase	A0A1W6JNK1	Staphylococcus_phage	4.8e-67	34.4
WP_147077396.1\|1126064_1126280_+	hypothetical protein	NA	NA	NA	NA
WP_071937591.1\|1126568_1126961_+	hypothetical protein	A0A290GJW3	Caldibacillus_phage	2.5e-13	39.8
WP_071937592.1\|1127032_1128274_+	hypothetical protein	B5WZP1	Staphylococcus_phage	5.1e-52	33.0

DBSCAN-SWA_9

1145733 : 1152923

Spiroplasma_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937609.1\|1145733_1145970_-	hypothetical protein	A8RHK0	Spiroplasma_virus	1.0e-30	96.2
WP_071937610.1\|1145969_1146365_-	hypothetical protein	A8RHJ8	Spiroplasma_virus	8.3e-41	96.6
WP_071937611.1\|1147369_1147573_-	DUF2649 family protein	A8RHJ3	Spiroplasma_virus	2.4e-28	92.5
WP_147077414.1\|1147725_1148175_-	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	7.9e-72	91.3
WP_155522119.1\|1148625_1148775_+	hypothetical protein	NA	NA	NA	NA
WP_071937131.1\|1149027_1149279_+	hypothetical protein	A8RHI2	Spiroplasma_virus	2.6e-32	88.0
WP_155522133.1\|1150390_1150549_+	hypothetical protein	NA	NA	NA	NA
WP_071937616.1\|1150532_1150982_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	7.9e-72	91.3
WP_071937469.1\|1151134_1151338_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_147077417.1\|1152345_1152687_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	1.2e-40	97.7
WP_015967964.1\|1152686_1152923_+	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7

DBSCAN-SWA_10

1241502 : 1248328

Spiroplasma_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071890527.1\|1241502_1241652_+	hypothetical protein	A8RHI0	Spiroplasma_virus	2.4e-09	71.4
WP_071937131.1\|1241651_1241903_+	hypothetical protein	A8RHI2	Spiroplasma_virus	2.6e-32	88.0
WP_015979231.1\|1242326_1242566_+	hypothetical protein	NA	NA	NA	NA
WP_071937671.1\|1242887_1243247_+	hypothetical protein	NA	NA	NA	NA
WP_015979233.1\|1243239_1243680_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	2.1e-69	90.4
WP_015979235.1\|1243832_1244036_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	8.3e-29	94.0
WP_147077472.1\|1244035_1245049_+	hypothetical protein	A8RHJ5	Spiroplasma_virus	8.9e-172	90.8
WP_071937672.1\|1245041_1245383_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	1.2e-40	96.6
WP_071937673.1\|1245382_1245619_+	hypothetical protein	A8RHK0	Spiroplasma_virus	3.2e-32	96.2
WP_071937675.1\|1247860_1248328_-	DUF3688 family protein	A8RHK2	Spiroplasma_virus	1.9e-12	41.4

DBSCAN-SWA_11

1255400 : 1281699

Spiroplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937684.1\|1255400_1255691_-	PTS lactose/cellobiose transporter subunit IIA	Q9QTH0	Spiroplasma_phage	3.4e-07	96.3
WP_071937685.1\|1256089_1256272_-	hypothetical protein	Q9QTH2	Spiroplasma_phage	3.7e-20	85.0
WP_071937686.1\|1256612_1256852_-	hypothetical protein	Q3ZVE8	Spiroplasma_phage	7.2e-32	98.7
WP_147077482.1\|1256851_1257142_-	hypothetical protein	Q3ZVE9	Spiroplasma_phage	2.6e-44	95.8
WP_071937688.1\|1258153_1258351_-	hypothetical protein	NA	NA	NA	NA
WP_147077749.1\|1258325_1258514_-	hypothetical protein	Q3ZVF1	Spiroplasma_phage	9.4e-19	94.2
WP_147077751.1\|1258578_1258770_-	hypothetical protein	Q3ZVF2	Spiroplasma_phage	5.6e-27	98.4
WP_155522136.1\|1258856_1259030_-	hypothetical protein	Q3ZVF3	Spiroplasma_phage	1.7e-19	100.0
WP_155522137.1\|1259031_1259175_-	hypothetical protein	Q3ZVF4	Spiroplasma_phage	6.9e-14	97.9
WP_071937689.1\|1259214_1259484_-	hypothetical protein	Q3ZVF5	Spiroplasma_phage	7.3e-41	94.4
WP_071937690.1\|1259812_1260127_-	hypothetical protein	Q3ZVF6	Spiroplasma_phage	2.3e-46	91.3
WP_071937691.1\|1260565_1261069_-	hypothetical protein	Q3ZVF7	Spiroplasma_phage	1.6e-68	80.9
WP_147077484.1\|1261098_1261506_-	hypothetical protein	Q3ZVF7	Spiroplasma_phage	3.3e-61	83.0
WP_071937693.1\|1261645_1261924_-	hypothetical protein	NA	NA	NA	NA
WP_071937694.1\|1262060_1262903_-	hypothetical protein	Q3ZVF7	Spiroplasma_phage	3.3e-148	92.8
WP_147077486.1\|1263042_1263285_-	hypothetical protein	NA	NA	NA	NA
WP_147077488.1\|1263359_1263581_-	hypothetical protein	NA	NA	NA	NA
WP_147077490.1\|1263826_1265230_-	DUF3688 family protein	Q9QTH9	Spiroplasma_phage	1.6e-134	65.6
WP_147077492.1\|1265242_1265479_-	hypothetical protein	Q9QTI0	Spiroplasma_phage	1.5e-29	90.9
WP_147077495.1\|1265478_1265772_-	hypothetical protein	Q9QTI1	Spiroplasma_phage	2.2e-30	94.4
WP_147077497.1\|1265764_1266775_-	hypothetical protein	Q9QTG8	Spiroplasma_phage	2.3e-167	93.8
WP_147077499.1\|1266779_1266989_-	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	7.5e-09	56.5
WP_147077501.1\|1267209_1267413_-	hypothetical protein	Q9QTH1	Spiroplasma_phage	3.7e-13	83.1
WP_147077503.1\|1267544_1267727_-	hypothetical protein	Q9QTH2	Spiroplasma_phage	1.4e-19	85.0
WP_147077505.1\|1267726_1267954_-	hypothetical protein	Q9QTH4	Spiroplasma_phage	1.3e-27	88.9
WP_155522138.1\|1268156_1268294_-	hypothetical protein	NA	NA	NA	NA
WP_147077506.1\|1268295_1268646_-	hypothetical protein	Q3ZVF6	Spiroplasma_phage	1.1e-15	39.8
WP_147077508.1\|1268961_1269852_-	hypothetical protein	NA	NA	NA	NA
WP_147077510.1\|1269979_1270990_-	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	1.1e-140	77.1
WP_147077512.1\|1271115_1272378_-	AAA family ATPase	NA	NA	NA	NA
WP_071937709.1\|1272682_1273138_-	hypothetical protein	NA	NA	NA	NA
WP_147077514.1\|1273880_1274738_-	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	2.5e-122	74.8
WP_147077516.1\|1275034_1275250_-	hypothetical protein	NA	NA	NA	NA
WP_147077753.1\|1275488_1276358_-	DUF3688 family protein	Q3ZVE7	Spiroplasma_phage	3.9e-75	49.8
WP_105298387.1\|1276904_1277141_-	hypothetical protein	Q9QTI0	Spiroplasma_phage	2.3e-30	93.5
WP_147077518.1\|1277245_1277503_-	hypothetical protein	Q9QTI1	Spiroplasma_phage	2.3e-31	92.2
WP_147077519.1\|1277495_1278506_-	hypothetical protein	Q9QTG8	Spiroplasma_phage	1.4e-172	95.8
WP_071937699.1\|1278510_1278720_-	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	2.5e-12	98.6
WP_147077521.1\|1278940_1279144_-	hypothetical protein	Q3ZVF2	Spiroplasma_phage	3.4e-14	65.6
WP_147077523.1\|1279478_1279694_-	hypothetical protein	Q9QTH4	Spiroplasma_phage	7.7e-25	86.8
WP_147077525.1\|1280024_1280339_-	hypothetical protein	Q3ZVF6	Spiroplasma_phage	1.0e-49	94.2
WP_147077527.1\|1280799_1281699_-	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	1.3e-150	85.8

DBSCAN-SWA_12

1285144 : 1319140

Spiroplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937724.1\|1285144_1285381_+	hypothetical protein	Q9QTI0	Spiroplasma_phage	1.5e-29	92.2
WP_147077529.1\|1286975_1287284_+	hypothetical protein	NA	NA	NA	NA
WP_147077531.1\|1287523_1287937_+	hypothetical protein	NA	NA	NA	NA
WP_147077533.1\|1288101_1289112_+	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	3.1e-140	73.8
WP_071937703.1\|1289500_1289851_+	hypothetical protein	Q3ZVF6	Spiroplasma_phage	5.3e-15	39.0
WP_071937702.1\|1290093_1290321_+	hypothetical protein	Q9QTH4	Spiroplasma_phage	3.2e-29	91.7
WP_071937701.1\|1290320_1290512_+	hypothetical protein	Q9QTH2	Spiroplasma_phage	6.6e-20	86.4
WP_147077535.1\|1290644_1290848_+	hypothetical protein	Q9QTH1	Spiroplasma_phage	4.0e-07	71.8
WP_147077537.1\|1291068_1291290_+	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	2.6e-12	98.6
WP_147077539.1\|1292283_1292577_+	hypothetical protein	Q9QTI1	Spiroplasma_phage	2.0e-31	94.5
WP_071937697.1\|1292576_1292813_+	hypothetical protein	Q9QTI0	Spiroplasma_phage	2.3e-30	92.2
WP_147077559.1\|1293359_1294229_+	DUF3688 family protein	Q3ZVE7	Spiroplasma_phage	4.8e-73	48.8
WP_155522139.1\|1294463_1294616_+	hypothetical protein	NA	NA	NA	NA
WP_155522140.1\|1294761_1294935_+	hypothetical protein	NA	NA	NA	NA
WP_147077541.1\|1295009_1296026_+	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	1.4e-148	80.4
WP_071937703.1\|1296415_1296766_+	hypothetical protein	Q3ZVF6	Spiroplasma_phage	5.3e-15	39.0
WP_147077543.1\|1296964_1297192_+	hypothetical protein	Q9QTH4	Spiroplasma_phage	1.9e-29	93.2
WP_071937717.1\|1297191_1297374_+	hypothetical protein	Q9QTH2	Spiroplasma_phage	2.2e-20	86.7
WP_071937700.1\|1297505_1297709_+	hypothetical protein	Q9QTH1	Spiroplasma_phage	2.0e-06	71.8
WP_071937699.1\|1297929_1298139_+	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	2.5e-12	98.6
WP_071937697.1\|1299507_1299744_+	hypothetical protein	Q9QTI0	Spiroplasma_phage	2.3e-30	92.2
WP_147077553.1\|1299757_1301161_+	DUF3688 family protein	Q9QTH9	Spiroplasma_phage	1.9e-135	66.2
WP_155522139.1\|1301394_1301547_+	hypothetical protein	NA	NA	NA	NA
WP_147077555.1\|1301692_1301914_+	hypothetical protein	NA	NA	NA	NA
WP_147077541.1\|1301941_1302958_+	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	1.4e-148	80.4
WP_071937703.1\|1303347_1303698_+	hypothetical protein	Q3ZVF6	Spiroplasma_phage	5.3e-15	39.0
WP_147077543.1\|1303896_1304124_+	hypothetical protein	Q9QTH4	Spiroplasma_phage	1.9e-29	93.2
WP_071937717.1\|1304123_1304306_+	hypothetical protein	Q9QTH2	Spiroplasma_phage	2.2e-20	86.7
WP_071937700.1\|1304437_1304641_+	hypothetical protein	Q9QTH1	Spiroplasma_phage	2.0e-06	71.8
WP_071937699.1\|1304861_1305071_+	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	2.5e-12	98.6
WP_071937697.1\|1306439_1306676_+	hypothetical protein	Q9QTI0	Spiroplasma_phage	2.3e-30	92.2
WP_147077557.1\|1306873_1307233_+	hypothetical protein	Q9QTH9	Spiroplasma_phage	1.0e-21	53.8
WP_147077559.1\|1307220_1308090_+	DUF3688 family protein	Q3ZVE7	Spiroplasma_phage	4.8e-73	48.8
WP_147077555.1\|1308616_1308838_+	hypothetical protein	NA	NA	NA	NA
WP_147077541.1\|1308865_1309882_+	plectrovirus svts2 rep protein	Q3ZVF7	Spiroplasma_phage	1.4e-148	80.4
WP_071937703.1\|1310270_1310621_+	hypothetical protein	Q3ZVF6	Spiroplasma_phage	5.3e-15	39.0
WP_147077543.1\|1310819_1311047_+	hypothetical protein	Q9QTH4	Spiroplasma_phage	1.9e-29	93.2
WP_071937717.1\|1311046_1311229_+	hypothetical protein	Q9QTH2	Spiroplasma_phage	2.2e-20	86.7
WP_071937700.1\|1311360_1311564_+	hypothetical protein	Q9QTH1	Spiroplasma_phage	2.0e-06	71.8
WP_071937699.1\|1311784_1311994_+	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	2.5e-12	98.6
WP_071937697.1\|1313362_1313599_+	hypothetical protein	Q9QTI0	Spiroplasma_phage	2.3e-30	92.2
WP_147077553.1\|1313612_1315016_+	DUF3688 family protein	Q9QTH9	Spiroplasma_phage	1.9e-135	66.2
WP_147077561.1\|1315244_1315565_+	hypothetical protein	NA	NA	NA	NA
WP_071937753.1\|1316014_1316368_+	hypothetical protein	Q3ZVF7	Spiroplasma_phage	1.2e-43	72.6
WP_147077563.1\|1316374_1317013_+	hypothetical protein	Q3ZVF7	Spiroplasma_phage	1.3e-83	76.5
WP_071937755.1\|1317389_1317608_+	hypothetical protein	NA	NA	NA	NA
WP_071937756.1\|1317579_1317768_+	hypothetical protein	NA	NA	NA	NA
WP_071937757.1\|1317966_1318194_+	hypothetical protein	Q9QTH4	Spiroplasma_phage	5.4e-29	93.1
WP_071937758.1\|1318193_1318376_+	hypothetical protein	Q9QTH2	Spiroplasma_phage	4.8e-20	85.0
WP_071937759.1\|1318507_1318711_+	hypothetical protein	NA	NA	NA	NA
WP_071937760.1\|1318930_1319140_+	DUF2649 family protein	Q9QTG9	Spiroplasma_phage	8.0e-11	97.1

DBSCAN-SWA_13

1428609 : 1432428

Spiroplasma_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015967964.1\|1428609_1428846_-	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_071937327.1\|1428845_1429223_-	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.3e-39	98.8
WP_071890543.1\|1430227_1430431_-	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_147077611.1\|1430583_1431027_-	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	1.2e-64	84.6
WP_147077613.1\|1431010_1431370_-	hypothetical protein	NA	NA	NA	NA
WP_071937855.1\|1432027_1432279_-	hypothetical protein	A8RHI2	Spiroplasma_virus	1.2e-32	89.2
WP_071937856.1\|1432278_1432428_-	hypothetical protein	A8RHI0	Spiroplasma_virus	6.3e-10	73.5

DBSCAN-SWA_14

1453007 : 1494359

Spiroplasma_virus(50.0%)

portal,terminase,tRNA,transposase,tail,capsid,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_147077625.1\|1453007_1454423_+\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	9.8e-68	34.5
WP_147077627.1\|1454419_1454710_+	hypothetical protein	B5WZP1	Staphylococcus_phage	6.1e-09	47.1
WP_071937869.1\|1455231_1456434_+\|portal	phage portal protein	J9QE83	Clostridium_phage	1.0e-25	25.7
WP_162302577.1\|1456420_1458196_+\|capsid	phage major capsid protein	A0A1W6JQG3	Corynebacterium_phage	1.1e-07	28.4
WP_071937190.1\|1458219_1458588_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_071937189.1\|1458577_1458904_+	hypothetical protein	NA	NA	NA	NA
WP_071937188.1\|1458914_1459313_+	hypothetical protein	NA	NA	NA	NA
WP_071937187.1\|1459318_1459696_+	hypothetical protein	NA	NA	NA	NA
WP_071937186.1\|1459711_1460299_+	hypothetical protein	A6M958	Geobacillus_virus	4.5e-19	38.5
WP_071937185.1\|1460291_1460624_+	hypothetical protein	NA	NA	NA	NA
WP_071937184.1\|1460811_1462359_+\|tail	phage tail tape measure protein	NA	NA	NA	NA
WP_071937871.1\|1462368_1463295_+	hypothetical protein	NA	NA	NA	NA
WP_071937872.1\|1463312_1464764_+	hypothetical protein	NA	NA	NA	NA
WP_071937180.1\|1465187_1465703_+	DUF4065 domain-containing protein	A7J2B6	Streptococcus_phage	4.3e-05	25.2
WP_071937179.1\|1465719_1466094_+	hypothetical protein	NA	NA	NA	NA
WP_162302578.1\|1466345_1466987_+	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_147077631.1\|1466976_1467399_+	hypothetical protein	NA	NA	NA	NA
WP_071937561.1\|1468664_1469267_+	hypothetical protein	NA	NA	NA	NA
WP_147077633.1\|1469282_1470908_+	hypothetical protein	NA	NA	NA	NA
WP_147077635.1\|1470923_1471103_+	hypothetical protein	NA	NA	NA	NA
WP_071937877.1\|1471184_1471397_+	hypothetical protein	NA	NA	NA	NA
WP_071937878.1\|1471434_1471953_-	lipoprotein	NA	NA	NA	NA
WP_071937170.1\|1472091_1472481_+	hypothetical protein	NA	NA	NA	NA
WP_071937879.1\|1472671_1473994_+	hypothetical protein	NA	NA	NA	NA
WP_071937880.1\|1474318_1474513_-	hypothetical protein	NA	NA	NA	NA
WP_071937881.1\|1474506_1476054_-	sodium-dependent transporter	NA	NA	NA	NA
WP_071937882.1\|1476110_1477763_-	hypothetical protein	NA	NA	NA	NA
WP_071937883.1\|1481138_1481504_-	PTS transporter subunit EIIB	NA	NA	NA	NA
WP_071937884.1\|1481506_1482313_-	NAD(+) kinase	NA	NA	NA	NA
WP_155522075.1\|1482622_1482772_+	hypothetical protein	NA	NA	NA	NA
WP_015979229.1\|1482881_1483031_+	hypothetical protein	A8RHI0	Spiroplasma_virus	3.1e-09	69.4
WP_015979230.1\|1483030_1483282_+	hypothetical protein	A8RHI2	Spiroplasma_virus	2.0e-32	88.0
WP_015979231.1\|1483705_1483945_+	hypothetical protein	NA	NA	NA	NA
WP_071890535.1\|1484210_1484570_+	hypothetical protein	NA	NA	NA	NA
WP_071937346.1\|1484553_1485003_+	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	3.9e-71	90.6
WP_071890543.1\|1485155_1485359_+	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	3.4e-30	95.5
WP_071937347.1\|1485358_1486372_+	hypothetical protein	A8RHJ5	Spiroplasma_virus	1.9e-169	89.3
WP_071937327.1\|1486364_1486742_+	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.3e-39	98.8
WP_015967964.1\|1486741_1486978_+	hypothetical protein	A8RHK0	Spiroplasma_virus	8.4e-33	98.7
WP_147077637.1\|1486989_1489161_+	DUF3688 family protein	A8RHK2	Spiroplasma_virus	0.0e+00	85.0
WP_071936912.1\|1489757_1490732_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	5.2e-28	31.5
WP_071937886.1\|1491941_1494359_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.1e-271	59.4

DBSCAN-SWA_15

1579974 : 1589148

Spiroplasma_virus(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071937945.1\|1579974_1580427_+	DUF3688 family protein	A8RHK2	Spiroplasma_virus	2.3e-10	41.1
WP_071937946.1\|1582592_1582829_-	hypothetical protein	A8RHK0	Spiroplasma_virus	1.9e-32	97.4
WP_071937947.1\|1582828_1583206_-	hypothetical protein	A8RHJ8	Spiroplasma_virus	4.8e-38	97.6
WP_071937948.1\|1584209_1584413_-	DUF2649 domain-containing protein	A8RHJ3	Spiroplasma_virus	1.3e-29	95.5
WP_084566901.1\|1584565_1585006_-	DUF3627 domain-containing protein	A8RHI7	Spiroplasma_virus	2.3e-68	91.1
WP_071937951.1\|1585354_1585594_-	hypothetical protein	NA	NA	NA	NA
WP_015967969.1\|1586072_1586222_-	hypothetical protein	A8RHI0	Spiroplasma_virus	1.2e-13	81.6
WP_071937952.1\|1587723_1589148_-\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	1.7e-96	39.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP042475

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP042472

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection