CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP043055	Acinetobacter pittii strain AP43 plasmid pAP43-3, complete sequence	0 crisprs	NA	0
NZ_CP043054	Acinetobacter pittii strain AP43 plasmid pAP43-2, complete sequence	0 crisprs	WYL	1
NZ_CP043052	Acinetobacter pittii strain AP43 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,csa3	10
NZ_CP043053	Acinetobacter pittii strain AP43 plasmid pAP43-OXA58-NDM1, complete sequence	0 crisprs	csa3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

543 : 77758

Acinetobacter_phage(21.74%)

integrase,protease,transposase

attL 37865:37924|attR 68805:69891

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000443160.1\|543_2583_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_000276416.1\|4314_5292_-	oxidoreductase	NA	NA	NA	NA
WP_001043693.1\|5428_6361_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	8.4e-60	41.8
WP_000627021.1\|6905_7127_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000937271.1\|7321_7573_+	hypothetical protein	NA	NA	NA	NA
WP_000059636.1\|8104_9304_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	9.6e-40	29.1
WP_000684953.1\|9603_10035_+	hypothetical protein	NA	NA	NA	NA
WP_000631290.1\|10449_11088_-	glutathione S-transferase	NA	NA	NA	NA
WP_000859510.1\|11103_12123_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_000805351.1\|12268_12874_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001088959.1\|12981_13212_+	hypothetical protein	NA	NA	NA	NA
WP_000655283.1\|13295_14423_-	alkene reductase	NA	NA	NA	NA
WP_000697979.1\|14626_15304_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_002120170.1\|15389_16547_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_000920558.1\|17146_17449_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000402510.1\|17783_18614_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_000842149.1\|18842_19955_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.2e-31	29.3
WP_001133624.1\|19976_20252_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_000941154.1\|21086_22046_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_001094923.1\|22161_23400_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_000794339.1\|23456_24749_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.5e-56	33.3
WP_000925802.1\|24761_25676_+	aromatic amino acid DMT transporter YddG	NA	NA	NA	NA
WP_001038516.1\|27047_28043_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000009381.1\|28032_29049_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_001180108.1\|29099_29999_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001059480.1\|30134_30875_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.5e-06	27.0
WP_002120211.1\|30948_31947_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000155817.1\|31967_32252_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000555567.1\|32952_33180_-	hypothetical protein	NA	NA	NA	NA
WP_032001945.1\|33945_34248_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000269908.1\|34240_34597_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_000478902.1\|35154_35838_+	hypothetical protein	NA	NA	NA	NA
WP_001081101.1\|36813_37134_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
37865:37924	attL	NA	NA	NA	NA
WP_010326927.1\|37871_38897_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-51	37.8
WP_005804864.1\|46297_48964_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.3e-157	34.7
WP_000064928.1\|50192_51365_-	replication initiation protein	A0A1V0E006	Clostridioides_phage	9.8e-05	29.4
WP_000104830.1\|52278_53055_+	AAA family ATPase	Q8JL10	Natrialba_phage	1.8e-18	36.6
WP_000254418.1\|53073_53973_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	3.0e-14	37.4
WP_000964375.1\|54121_54976_+	alkaline phosphatase	NA	NA	NA	NA
WP_000366815.1\|56732_57038_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000911012.1\|59590_60055_+	hypothetical protein	NA	NA	NA	NA
WP_001124154.1\|60067_62419_+	hypothetical protein	NA	NA	NA	NA
WP_002120188.1\|62423_65624_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000395699.1\|65839_66310_+	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	8.3e-56	66.4
WP_162097055.1\|66382_66529_+	hypothetical protein	NA	NA	NA	NA
WP_000152660.1\|66722_66959_+	hypothetical protein	NA	NA	NA	NA
WP_004994718.1\|67082_68108_+\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
WP_010326927.1\|68811_69837_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-51	37.8
WP_079283729.1\|69953_70256_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	5.7e-50	95.0
68805:69891	attR	NA	NA	NA	NA
WP_000378528.1\|70316_70778_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.0e-55	73.8
WP_000372120.1\|70746_71388_+	hypothetical protein	A0A0P0I8J9	Acinetobacter_phage	3.2e-111	85.0
WP_005804845.1\|72849_73173_+	hypothetical protein	NA	NA	NA	NA
WP_002120129.1\|73244_73421_+	hypothetical protein	A0A0R6PIB1	Moraxella_phage	1.1e-08	57.7
WP_001258993.1\|74393_74681_-	helix-turn-helix domain-containing protein	A0A088CD40	Shigella_phage	3.3e-15	48.4
WP_000288004.1\|74667_74997_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.9e-23	64.6
WP_000453245.1\|75051_75321_-	transcriptional regulator	NA	NA	NA	NA
WP_000096286.1\|75527_76130_+	hypothetical protein	A0A0P0J0J1	Acinetobacter_phage	3.2e-36	62.2
WP_000994925.1\|76186_76405_+	hypothetical protein	A0A0R6PIC9	Moraxella_phage	4.0e-21	77.4
WP_025464206.1\|76497_76695_+	hypothetical protein	A0A1B1P9F8	Acinetobacter_phage	7.5e-11	57.1
WP_000743263.1\|76825_77758_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.9e-57	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP043052

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043052_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043052_1

2005858-2005971

Orphan

Consensus_repeat	Method
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043052_1

>merge|NZ_CP043052|1|2005858-2005971|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

>NZ_CP043052|1|1|2005858-2005971|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	TTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAAC
CGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043052.1\|WP_002113669.1\|2000795_2001404_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP043052.1\|WP_002113812.1\|2015667_2016687_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP043052.1\|WP_005802236.1\|1993698_1995117_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
NZ_CP043052.1\|WP_148728137.1\|2003863_2004868_-\|homoserine-dehydrogenase	unknown	unknown	gnl\|CDD\|168683
NZ_CP043052.1\|WP_002113744.1\|2011904_2012690_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
NZ_CP043052.1\|WP_002113754.1\|1995171_1997376_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP043052.1\|WP_002113553.1\|2010816_2011875_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
NZ_CP043052.1\|WP_002113810.1\|2009856_2010768_+\|bestrophin	unknown	unknown	gnl\|CDD\|376448
NZ_CP043052.1\|WP_005076109.1\|1999362_2000712_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
NZ_CP043052.1\|WP_000331400.1\|2001891_2002746_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP043052.1\|WP_001177517.1\|2016700_2017663_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NZ_CP043052.1\|WP_002113934.1\|2004977_2005769_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP043052.1\|WP_002113740.1\|1997892_1999179_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182433
NZ_CP043052.1\|WP_002113836.1\|2007628_2008324_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NZ_CP043052.1\|WP_002113912.1\|2002912_2003830_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP043052.1\|WP_002113563.1\|2012716_2014120_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
NZ_CP043052.1\|WP_002113519.1\|2008515_2009787_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP043052.1\|WP_002113898.1\|2018025_2019012_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
NZ_CP043052.1\|WP_001983845.1\|2001499_2001895_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP043052.1\|WP_005076132.1\|2014130_2015666_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|237001

Protein	Function_ID	Function_description	E-value
NZ_CP043052.1\|WP_002113669.1\|2000795_2001404_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	1.57248e-84
NZ_CP043052.1\|WP_002113812.1\|2015667_2016687_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	7.15262e-167
NZ_CP043052.1\|WP_005802236.1\|1993698_1995117_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
NZ_CP043052.1\|WP_148728137.1\|2003863_2004868_-\|homoserine-dehydrogenase	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	2.3871e-76
NZ_CP043052.1\|WP_002113744.1\|2011904_2012690_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.5012e-113
NZ_CP043052.1\|WP_002113754.1\|1995171_1997376_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.33284e-104
NZ_CP043052.1\|WP_002113553.1\|2010816_2011875_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
NZ_CP043052.1\|WP_002113810.1\|2009856_2010768_+\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	2.35864e-81
NZ_CP043052.1\|WP_005076109.1\|1999362_2000712_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	7.57664e-60
NZ_CP043052.1\|WP_000331400.1\|2001891_2002746_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
NZ_CP043052.1\|WP_001177517.1\|2016700_2017663_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
NZ_CP043052.1\|WP_002113934.1\|2004977_2005769_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	7.30352e-23
NZ_CP043052.1\|WP_002113740.1\|1997892_1999179_+\|MFS-transporter	gnl\|CDD\|182433	PRK10406, PRK10406, alpha-ketoglutarate transporter; Provisional.	6.94672e-167
NZ_CP043052.1\|WP_002113836.1\|2007628_2008324_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.56698e-86
NZ_CP043052.1\|WP_002113912.1\|2002912_2003830_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	6.73638e-15
NZ_CP043052.1\|WP_002113563.1\|2012716_2014120_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
NZ_CP043052.1\|WP_002113519.1\|2008515_2009787_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	1.04762e-122
NZ_CP043052.1\|WP_002113898.1\|2018025_2019012_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
NZ_CP043052.1\|WP_001983845.1\|2001499_2001895_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.15826e-39
NZ_CP043052.1\|WP_005076132.1\|2014130_2015666_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	3.94652e-113

>NZ_CP043052.1|WP_002113934.1|2004977_2005769_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLAGIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVGITSAFALACAVGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>NZ_CP043052.1|WP_148728137.1|2003863_2004868_-|homoserine-dehydrogenase
MKRVNLAICGFGRIGQQIAELLLNRTTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTQYQAGLTEQKFLEQVQADVIIETGPSDYVTGGKGLFYLDYALTHSMNAIAVSKGALVVDGKKLVNLAPQHNNKLFFSGATAAALPTVDLFEYNLAGCQILEIEGVFTGTTNFILNDMLQHECAFAESLEKAQAKGIAEPDSSFEVDGWDTAAKITILANTVLGADVKIQDIPRQGISHVTADHIRDWKKENVIPRLVGFIHIKNQQIQTGVELRLVSANHPFAHLQGSNKCIRALTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>NZ_CP043052.1|WP_002113912.1|2002912_2003830_+|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAAILGLIGIVLLFWHDLVNSQFNAQLLMGIGLCAVGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVILSLALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYVWALNAVFGILLILLGNYLMFSKLEIGKKLFNSQKNCEKQA
>NZ_CP043052.1|WP_000331400.1|2001891_2002746_-|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>NZ_CP043052.1|WP_001983845.1|2001499_2001895_+|helix-turn-helix-transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPPHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>NZ_CP043052.1|WP_002113669.1|2000795_2001404_-|NAD(P)H-dependent-oxidoreductase
MELLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNEIAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>NZ_CP043052.1|WP_005076109.1|1999362_2000712_+|chromate-efflux-transporter
MENEKSPLPESIIQVTFWQAFLFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTAGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVIAGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWFVAIAAFLAIFVLKLPFPLIVLSAGIAGYLTSKKYPELFSSAAGHKSSQKDYGSAFIDDDTPPPEHAKFHWPRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGFEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDIVAAFITVGAFIALFRFNVNVLYVIFASALVGLAVTFFS
>NZ_CP043052.1|WP_002113740.1|1997892_1999179_+|MFS-transporter
MTYTQEEKRSRIRGIVGAASGNLVEWFDFYIYAVFAAYFTQALTAPDMDSTTKSIYVWGVFAASFFMRPIGSWVFGRIADRHGRKKSMVISICLMALSSFLFAALPTYDQVGLFAPFLLLVVRLLQGLSVGGEYGAVATYMSELGLKGQRGFYSSFQYVTLSGGQLLASLLGVILLTFLSEQQLHDGGWRIPFVIGGIAAILSLLARSRLEETLSHQDSERKESGSLRELFKKHWKTFLLVVGYTSAGSLTFYVETVYSKTYLTNLGMDGKTVGYIMTFALFVYMCAQPVFGAISDRIGRRSSMLAFSLLSAIFIYPVMVIGMRAYIDSPIIIALLLIFMMMLLSFYTSISGLVKAEMFPPHVRALGVGFSYAVGNALFGGSAPSVALQFKAAGIENTFFIYVIVMLIICFLCSLALPKKPDYLEHDH
>NZ_CP043052.1|WP_002113754.1|1995171_1997376_-|TonB-dependent-siderophore-receptor
MHGMAGSYSMERRSINLHFMTCSKTALASSIALITSVVYANEAEVSQLPTITVNATQNNDALYTSKKVNLSGFQTDDLKKVPASITTITSERIEDQHAKTLTDVIKNDSSLGDGYAAIGYYPNFVARGFALDLGSSYLINGHTIRGEQNVALENKEQVEILKGISAIQSGMSTPGGVVNYVTKRPADVKNIAVDANSEGGYTLATDVGGFINDSFGYRINLAHESIHPNVHHANGKREFGSVALDWKINERSKLLFDIEAQHQSQRSVPGYQLLDGQEVPTNVDQDRLLGYQSWSKPVVNNSVNASLKYQYAFNDQWNGTLSASQSRVVIDDNSAFPWGCYNDICEYSGLGNTFDKHGNYDIYDFRSPDDTRITNQFAAGLNGQFNTANIQHQIAFELQRTYKTLKHHTPLNVVVGTGNIYEDTIDYSPSSESLGDRYKALESDQTAFTISDRVQFNDQWSTLLGGKLIHLDEQTYNSDGQQSRDTDLNKFLPQLALMYSPTAGTNLYASYAKGLSDGGEAPWFANNALEVLSPKNSEQYEIGIKQQIRNFLVTAAIFDLKQDNQYSKVNAEGTFDFVSQGEQHNQGIELGLTGALTDKLDVSSGITYTKSRLVDIDNDSYKGHQTQNVPKVRATAQLSYKVPSVEGLRLLSGMQYSSSKYANKEGTAKVGGYSVFNIGAAYKTNFAGHDTTFRFNIDNLFNKKYWRDVGAFMGDDYLFLGNPRTAQFSTTFSF
>NZ_CP043052.1|WP_005802236.1|1993698_1995117_+|aspartate-ammonia-lyase
MMNAEITTRIEKDLIGYREINNNDYYGVQTLRALENFNLTQSKVGNFPHLIKALAMVKLACAEANYNLKSLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHAKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFRNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALAKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQSKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQMLDDILSINNMVKPKMSA
>NZ_CP043052.1|WP_002113836.1|2007628_2008324_-|MBL-fold-metallo-hydrolase
MFFKQFFEKESSTYTYMLGCEETRGAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSEVSCGDILITHGCMLKVGNLSIEARYTPGHTNACTSYLVENMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHRQLFSLPDDTIVYPGHDYKGRLSSTIGNERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>NZ_CP043052.1|WP_002113519.1|2008515_2009787_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFESEQDFFILFEQLKALFPNASLFLADTTTQAIHYKFNTDDISVENMAALIQDHHNQYLEINTPKMRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIADQGELTEQLEDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEVEDLPNELLNAEDYVKLPETNTELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>NZ_CP043052.1|WP_002113810.1|2009856_2010768_+|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLTNEQREHLIHQVLIFSNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKILKDGEISDIIYSTLNRHIIELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>NZ_CP043052.1|WP_002113553.1|2010816_2011875_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGKGVDDIEIGQHVVVEPYIVSDDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHEETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>NZ_CP043052.1|WP_002113744.1|2011904_2012690_-|acetoin-reductase
MVKGLKNKVVLVTGAAQGIGRGIALRLAQEGAHIALVDMKQDQLNDVQQEIQALGVNASIFIANVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASNDSDYITGQSILTDGGIVYR
>NZ_CP043052.1|WP_002113563.1|2012716_2014120_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHSGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNHVTVFNGRAQLTAKEKIEVTDAQGKSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEDLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIVNGQVHCVIETANDVQTIVFDRVLSAIGVQPNATGLGLEHLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAQNLPIRIGKFSLTANGKALAIGDASGFVKTVIHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>NZ_CP043052.1|WP_005076132.1|2014130_2015666_-|2-oxo-acid-dehydrogenase-subunit-E2
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEISDAEIEQFIASLGGSAAKAPETPSEQSKAETFAPVTEKAEQPQPVAASASVPVKTAKGDYAVPESLQGYQASDELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>NZ_CP043052.1|WP_002113812.1|2015667_2016687_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENELEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDAAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>NZ_CP043052.1|WP_001177517.1|2016700_2017663_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>NZ_CP043052.1|WP_002113898.1|2018025_2019012_+|lipoyl-synthase
MDLKRQIETGIKLRGADKVARIPIKILPTEELPTKPDWIRAKITDFEEINRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPKPLDEDEPKHLAETVKNLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRKRCPETLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLELLKRFKAYCPDIKTKSGLMVGLGEIEAEVLALLNDLKDYQVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTRHGKRLGFKNIWSGPMVRSSYFADRQYFGEEVPKPFSRQDVLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1254170 : 1276273

Acinetobacter_phage(94.44%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002118101.1\|1254170_1255106_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-22	30.0
WP_078210479.1\|1256655_1257741_+\|capsid	minor capsid protein	A0A1B1P9B7	Acinetobacter_phage	8.6e-197	97.2
WP_057066875.1\|1257895_1258090_+	hypothetical protein	NA	NA	NA	NA
WP_057082070.1\|1258174_1258900_+	hypothetical protein	A0A1B1P9C7	Acinetobacter_phage	6.5e-76	91.7
WP_057066872.1\|1258917_1259934_+	hypothetical protein	A0A1B1P9D0	Acinetobacter_phage	9.5e-166	87.0
WP_057066869.1\|1259945_1260128_+	hypothetical protein	A0A1B1P9F4	Acinetobacter_phage	1.6e-23	85.0
WP_057066867.1\|1260184_1260571_+	hypothetical protein	A0A1B1P9F2	Acinetobacter_phage	9.5e-66	97.7
WP_078210478.1\|1260574_1260967_+	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	1.2e-63	92.3
WP_032051272.1\|1260971_1261394_+	hypothetical protein	A0A1B1P9D5	Acinetobacter_phage	2.9e-60	82.9
WP_078210477.1\|1261395_1261791_+	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	7.9e-68	94.7
WP_078210476.1\|1261951_1262488_+	Rha family transcriptional regulator	A0A1B1P9D9	Acinetobacter_phage	5.2e-78	83.1
WP_078210475.1\|1262561_1263491_+	hypothetical protein	A0A1B1P9E0	Acinetobacter_phage	1.8e-163	94.8
WP_078210474.1\|1263537_1264062_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	3.9e-46	60.5
WP_078210472.1\|1264423_1265140_+	hypothetical protein	NA	NA	NA	NA
WP_078210471.1\|1265136_1265586_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_057066846.1\|1265669_1265894_+	hypothetical protein	NA	NA	NA	NA
WP_057066844.1\|1265966_1266797_-	hypothetical protein	A0A0P0J0J7	Acinetobacter_phage	7.8e-65	68.4
WP_016803030.1\|1266868_1267024_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_016803029.1\|1267131_1267359_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_016803028.1\|1267375_1268017_+	hypothetical protein	NA	NA	NA	NA
WP_016803027.1\|1268051_1268579_+	hypothetical protein	NA	NA	NA	NA
WP_148728121.1\|1268641_1272064_+	tape measure protein	A0A220VZA0	Acinetobacter_phage	3.1e-136	35.0
WP_148728122.1\|1272128_1272596_+	hypothetical protein	A0A1B1P9F0	Acinetobacter_phage	2.1e-83	94.8
WP_148728123.1\|1272592_1273090_+	DUF1833 family protein	A0A1B1P9F1	Acinetobacter_phage	1.5e-87	97.6
WP_148728124.1\|1273089_1273473_+	hypothetical protein	A0A1B1P9H4	Acinetobacter_phage	1.1e-66	96.9
WP_148728125.1\|1273438_1276273_+	hypothetical protein	A0A1B1P9G8	Acinetobacter_phage	0.0e+00	95.1

DBSCAN-SWA_2

1498892 : 1517238

Pseudomonas_phage(37.5%)

capsid,transposase,integrase

attL 1492482:1492496|attR 1511976:1511990

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1492482:1492496	attL	NA	NA	NA	NA
WP_148728133.1\|1498892_1500152_-\|capsid	minor capsid protein	I6PBD2	Pseudomonas_phage	2.8e-74	36.7
WP_002119404.1\|1500151_1501765_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.8e-110	41.7
WP_002119411.1\|1502041_1502773_+	hypothetical protein	NA	NA	NA	NA
WP_002119417.1\|1502773_1504411_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	1.1e-115	45.3
WP_002119422.1\|1504410_1504977_-	DUF3486 family protein	J9SH37	Pseudomonas_phage	1.3e-18	37.9
WP_002119439.1\|1504984_1505278_-	hypothetical protein	J9SNG3	Pseudomonas_phage	2.7e-20	52.6
WP_002119398.1\|1505284_1505566_-	hypothetical protein	NA	NA	NA	NA
WP_016802887.1\|1505558_1505939_-	hypothetical protein	NA	NA	NA	NA
WP_016802888.1\|1505935_1506436_-	glycoside hydrolase family 108 protein	A0A0M3LSH2	Mannheimia_phage	3.0e-56	66.5
WP_016802889.1\|1506514_1507144_-	hypothetical protein	NA	NA	NA	NA
WP_016802890.1\|1507140_1507866_-	hypothetical protein	NA	NA	NA	NA
WP_016802891.1\|1507883_1508360_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016802892.1\|1508452_1508659_+	DNA-binding protein	A0A0S4L0D0	Pseudomonas_phage	9.6e-09	52.7
WP_171252973.1\|1508703_1508865_+	hypothetical protein	NA	NA	NA	NA
WP_016802894.1\|1508864_1509161_+	MarR family transcriptional regulator	Q5ZR02	Pseudomonas_phage	3.8e-14	45.6
WP_057066962.1\|1509173_1510058_+	DUF3102 domain-containing protein	Q6QID9	Burkholderia_phage	1.2e-28	34.5
WP_016803092.1\|1510060_1511812_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q5ZR04	Pseudomonas_phage	3.2e-100	36.5
WP_057066963.1\|1511821_1513099_+	AAA family ATPase	Q6QIE1	Burkholderia_phage	5.1e-92	47.0
1511976:1511990	attR	NA	NA	NA	NA
WP_016803091.1\|1513193_1513412_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_016803090.1\|1513408_1513645_+	hypothetical protein	NA	NA	NA	NA
WP_016803089.1\|1513645_1514317_+	DUF2752 domain-containing protein	A0A2H4JFV8	uncultured_Caudovirales_phage	1.6e-28	47.2
WP_016803088.1\|1514316_1514820_+	host-nuclease inhibitor Gam family protein	A0A2K9VGT9	Faecalibacterium_phage	2.9e-14	32.9
WP_000288872.1\|1514842_1515010_+	hypothetical protein	NA	NA	NA	NA
WP_016803087.1\|1515014_1515287_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.3e-21	62.2
WP_016803086.1\|1515286_1515466_+	hypothetical protein	NA	NA	NA	NA
WP_016803085.1\|1515502_1515787_+	hypothetical protein	NA	NA	NA	NA
WP_016803083.1\|1516375_1516600_+	hypothetical protein	NA	NA	NA	NA
WP_016803082.1\|1516601_1516814_+	hypothetical protein	K4IBU9	Acinetobacter_phage	1.6e-06	59.5
WP_016803081.1\|1516800_1517238_+	regulatory protein GemA	A0A0C4UQU3	Shigella_phage	2.0e-11	32.6

DBSCAN-SWA_3

1523482 : 1582548

Acinetobacter_phage(33.33%)

tRNA,transposase,capsid,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002122283.1\|1523482_1523956_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_002122200.1\|1523948_1525898_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.7e-83	32.7
WP_002122252.1\|1525904_1526849_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_005803553.1\|1526931_1527456_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_002122237.1\|1527596_1528454_+	DMT family transporter	NA	NA	NA	NA
WP_002122258.1\|1528493_1529147_-	oxygen-insensitive NAD(P)H nitroreductase	NA	NA	NA	NA
WP_005803551.1\|1529282_1529513_+	hypothetical protein	NA	NA	NA	NA
WP_002122216.1\|1529520_1530240_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_002122280.1\|1530255_1530765_-	peptidyl-prolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-13	34.7
WP_002122255.1\|1530932_1532660_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	7.5e-187	57.2
WP_002122166.1\|1533086_1533809_-	glutamine amidotransferase	NA	NA	NA	NA
WP_004994718.1\|1533925_1534951_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_002119351.1\|1535065_1535881_-	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_002119346.1\|1535891_1537277_-	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_002119334.1\|1537291_1538728_-	ethanolamine permease	NA	NA	NA	NA
WP_002119354.1\|1538948_1540460_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_002119349.1\|1540602_1541793_+	transcriptional regulator	NA	NA	NA	NA
WP_002119321.1\|1541789_1542758_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002119340.1\|1542953_1544126_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_002119362.1\|1544356_1546069_+	AAA family ATPase	A0A172Q090	Acinetobacter_phage	5.7e-78	40.0
WP_078210520.1\|1546106_1546472_+	5-carboxymethyl-2-hydroxymuconate Delta-isomerase	NA	NA	NA	NA
WP_002119326.1\|1546594_1547422_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_078210521.1\|1547457_1548549_-	hypothetical protein	NA	NA	NA	NA
WP_002119338.1\|1548765_1549023_-	hypothetical protein	NA	NA	NA	NA
WP_002119359.1\|1549341_1551948_+	aminopeptidase N	NA	NA	NA	NA
WP_002119337.1\|1552529_1553060_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_002119329.1\|1553132_1553837_+	molecular chaperone	NA	NA	NA	NA
WP_032015156.1\|1553846_1556306_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_002163143.1\|1556296_1557316_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_002163145.1\|1557542_1558229_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_002163150.1\|1558236_1558998_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_002163146.1\|1559007_1559691_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_078210424.1\|1559807_1560326_+	chorismate mutase	NA	NA	NA	NA
WP_002163148.1\|1560375_1561395_+	hypothetical protein	NA	NA	NA	NA
WP_002163153.1\|1562002_1562554_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_068521766.1\|1562630_1564820_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_002163141.1\|1565316_1567551_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_002163149.1\|1567645_1568329_+	Fe2+-dependent dioxygenase	A0A127KM56	Cyanophage	3.9e-22	32.9
WP_002163151.1\|1568370_1568766_-	transcriptional repressor	NA	NA	NA	NA
WP_031944153.1\|1569164_1569680_-	hypothetical protein	NA	NA	NA	NA
WP_010326927.1\|1569770_1570796_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_005803535.1\|1570883_1571606_-	type 1 glutamine amidotransferase	A0A2K9L2L9	Tupanvirus	1.3e-07	22.9
WP_005068685.1\|1571868_1572099_+	hypothetical protein	NA	NA	NA	NA
WP_005803532.1\|1572249_1572624_+	TonB C-terminal domain-containing protein	NA	NA	NA	NA
WP_005803531.1\|1572892_1573162_+	hypothetical protein	NA	NA	NA	NA
WP_005803530.1\|1573467_1573926_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	8.7e-34	49.3
WP_002114613.1\|1574112_1574313_+	hypothetical protein	NA	NA	NA	NA
WP_002114626.1\|1574490_1575063_+	lysozyme	I2GUG4	Acinetobacter_phage	5.2e-52	69.0
WP_103254430.1\|1575146_1575563_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002114620.1\|1575673_1575988_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002114610.1\|1576564_1576807_+	hypothetical protein	NA	NA	NA	NA
WP_002114622.1\|1576990_1578097_+\|capsid	minor capsid protein	A0A0D4DBL9	Acinetobacter_phage	4.4e-148	70.2
WP_002114625.1\|1578259_1578523_+	hypothetical protein	NA	NA	NA	NA
WP_002114611.1\|1578579_1579434_-	DMT family transporter	NA	NA	NA	NA
WP_068521906.1\|1579656_1580526_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002114618.1\|1580715_1580847_+	hypothetical protein	NA	NA	NA	NA
WP_002114606.1\|1581121_1581409_+	hypothetical protein	NA	NA	NA	NA
WP_004994718.1\|1581522_1582548_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4

DBSCAN-SWA_4

2134148 : 2155502

Acinetobacter_phage(46.67%)

terminase,head,tail,integrase

attL 2145776:2145789|attR 2156199:2156212

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032014797.1\|2134148_2135171_-	phage protein	Q775C7	Bordetella_phage	1.6e-88	50.0
WP_032023956.1\|2135182_2135830_-	hypothetical protein	A0A2I7RHR0	Vibrio_phage	7.0e-13	39.6
WP_032014801.1\|2135798_2136128_-	hypothetical protein	NA	NA	NA	NA
WP_032014803.1\|2136124_2137816_-\|head,tail	head-tail connector protein	G9L6C2	Escherichia_phage	2.4e-68	32.2
WP_032014805.1\|2137817_2138072_-	hypothetical protein	NA	NA	NA	NA
WP_032014807.1\|2138149_2139772_-\|terminase	terminase	Q775B9	Bordetella_phage	1.4e-187	60.7
WP_032014808.1\|2139755_2140028_-	hypothetical protein	NA	NA	NA	NA
WP_032014809.1\|2140247_2140457_-	hypothetical protein	NA	NA	NA	NA
WP_032014811.1\|2140449_2141190_-\|terminase	terminase small subunit	A0A1Y0SUQ3	Pseudomonas_phage	3.7e-50	48.6
WP_025466602.1\|2141190_2141400_-	hypothetical protein	NA	NA	NA	NA
WP_031946179.1\|2141411_2141840_-	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	1.6e-50	73.4
WP_032014813.1\|2141832_2142585_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	2.2e-58	50.8
WP_068525379.1\|2142586_2143468_-	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_032014817.1\|2143464_2143830_-	hypothetical protein	NA	NA	NA	NA
WP_032014819.1\|2143826_2144405_-	hypothetical protein	NA	NA	NA	NA
WP_050676540.1\|2144401_2145259_-	hypothetical protein	NA	NA	NA	NA
WP_031946186.1\|2145255_2145477_-	hypothetical protein	NA	NA	NA	NA
WP_057071016.1\|2145535_2145892_-	hypothetical protein	J7I452	Acinetobacter_phage	4.2e-44	79.7
2145776:2145789	attL	NA	NA	NA	NA
WP_057071015.1\|2145900_2146089_-	hypothetical protein	NA	NA	NA	NA
WP_057071014.1\|2146192_2146918_+	helix-turn-helix domain-containing protein	A0A0P0I8E0	Acinetobacter_phage	4.9e-63	51.3
WP_068525136.1\|2146920_2147226_+	hypothetical protein	NA	NA	NA	NA
WP_068525138.1\|2147388_2147763_+	hypothetical protein	NA	NA	NA	NA
WP_031946191.1\|2147830_2148709_+	DUF2303 family protein	I6NVL7	Burkholderia_virus	1.8e-27	34.2
WP_032014827.1\|2148838_2149411_+	hypothetical protein	NA	NA	NA	NA
WP_057071010.1\|2149412_2149667_+	hypothetical protein	NA	NA	NA	NA
WP_032014831.1\|2149675_2150656_+	YqaJ viral recombinase family protein	A0A0A7RWR9	Clostridium_phage	2.7e-48	36.0
WP_032014833.1\|2150667_2151600_+	hypothetical protein	A0A2H4J6I3	uncultured_Caudovirales_phage	1.3e-52	66.0
WP_068525142.1\|2151672_2153154_+	ATP-dependent helicase	A0A075DXT4	Acinetobacter_phage	6.7e-67	34.9
WP_000214186.1\|2153150_2153384_+	protein ninH	NA	NA	NA	NA
WP_032014837.1\|2153380_2153761_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	1.4e-05	44.9
WP_032014839.1\|2153757_2154105_+	hypothetical protein	NA	NA	NA	NA
WP_032014841.1\|2154101_2154305_+	hypothetical protein	NA	NA	NA	NA
WP_032014843.1\|2154325_2154577_+	hypothetical protein	NA	NA	NA	NA
WP_002117952.1\|2154542_2155502_-\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	6.5e-47	35.3
2156199:2156212	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2287551 : 2296133

uncultured_Caudovirales_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019767836.1\|2287551_2289117_-	alkyl hydroperoxide reductase subunit F	A0A1W6JK46	Lactococcus_phage	6.0e-26	29.8
WP_002114296.1\|2289292_2289814_-	chromate transporter	NA	NA	NA	NA
WP_001017026.1\|2289813_2290374_-	chromate transporter	NA	NA	NA	NA
WP_002114463.1\|2290475_2291393_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002114162.1\|2291433_2292147_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	7.3e-88	68.9
WP_002114266.1\|2292133_2293180_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_002114427.1\|2293190_2293664_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	7.3e-36	50.6
WP_002114199.1\|2293668_2293998_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	5.3e-25	51.9
WP_002114534.1\|2294082_2294511_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.8e-41	61.3
WP_000784879.1\|2294580_2294742_-	DUF1427 family protein	NA	NA	NA	NA
WP_004832869.1\|2294924_2296133_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5

DBSCAN-SWA_6

2575850 : 2584331

Acinetobacter_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002117452.1\|2575850_2576078_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	8.1e-17	61.7
WP_002117455.1\|2576421_2577354_-	hypothetical protein	A0A1W6JP29	Morganella_phage	3.6e-42	34.2
WP_002117445.1\|2577593_2578211_+	LysE family translocator	NA	NA	NA	NA
WP_004994718.1\|2578285_2579311_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_002119903.1\|2579397_2579943_-	glycosyl hydrolase 108	A0A0N7IRF5	Acinetobacter_phage	4.3e-72	69.1
WP_002119864.1\|2579973_2580363_-	hypothetical protein	A0A0P0IYC0	Acinetobacter_phage	3.0e-51	76.7
WP_002119927.1\|2580572_2580827_-	hypothetical protein	NA	NA	NA	NA
WP_002119885.1\|2581500_2582172_+	LexA family transcriptional regulator	A0A1B1P9J5	Acinetobacter_phage	1.2e-63	55.8
WP_002119938.1\|2582324_2582558_-	hypothetical protein	NA	NA	NA	NA
WP_005802637.1\|2583065_2584331_+	exodeoxyribonuclease VII large subunit	M1NLU2	Moumouvirus	8.1e-13	29.5

DBSCAN-SWA_7

2645048 : 2688724

Acinetobacter_phage(68.57%)

tRNA,transposase,integrase,terminase

attL 2638078:2638093|attR 2694431:2694446

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2638078:2638093	attL	NA	NA	NA	NA
WP_068525240.1\|2645048_2647685_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.7e-76	38.4
WP_002121611.1\|2647971_2649177_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0R6PHZ3	Moraxella_phage	7.2e-104	50.5
WP_001289330.1\|2649338_2649833_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	4.8e-46	61.5
WP_002121526.1\|2649836_2651135_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	1.5e-155	60.8
WP_002051611.1\|2651212_2651959_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.8e-12	33.3
WP_002045824.1\|2652096_2653260_-	glutathione-dependent formaldehyde dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	5.5e-08	26.5
WP_005070343.1\|2653701_2654118_+	hypothetical protein	NA	NA	NA	NA
WP_042783478.1\|2654230_2654701_-	hypothetical protein	NA	NA	NA	NA
WP_002121608.1\|2654714_2655140_+	hypothetical protein	NA	NA	NA	NA
WP_002121625.1\|2655136_2656162_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_002121548.1\|2656282_2656501_+	hypothetical protein	NA	NA	NA	NA
WP_148728148.1\|2656532_2658344_+	site-specific DNA-methyltransferase	A0A2R3ZYF2	Campylobacter_phage	4.8e-51	34.4
WP_148728149.1\|2658336_2658699_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_004994718.1\|2658625_2659651_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_002121604.1\|2662665_2663211_-	N-acetylmuramidase	A0A0P0IW03	Acinetobacter_phage	6.6e-97	96.1
WP_000433912.1\|2663253_2663643_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	8.6e-67	99.2
WP_002121538.1\|2663710_2667136_-	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	94.7
WP_000835159.1\|2667128_2667491_-	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	6.2e-51	79.2
WP_025464104.1\|2667487_2667994_-	DUF1833 family protein	J7HXQ5	Acinetobacter_phage	8.6e-91	97.6
WP_000277438.1\|2667993_2668392_-	hypothetical protein	J7I0X8	Acinetobacter_phage	2.4e-72	98.5
WP_002121607.1\|2668456_2668618_-	hypothetical protein	NA	NA	NA	NA
WP_002121623.1\|2669122_2673457_-	tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	70.2
WP_001275792.1\|2673587_2673851_-	hypothetical protein	NA	NA	NA	NA
WP_000721572.1\|2673852_2674533_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
WP_000966688.1\|2674631_2675036_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
WP_000838146.1\|2675128_2675311_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
WP_025464105.1\|2675636_2676152_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	2.8e-73	96.4
WP_002121543.1\|2676222_2677140_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.9e-166	97.7
WP_023187966.1\|2677192_2678521_-	hypothetical protein	A0A0D4DCQ4	Acinetobacter_phage	1.2e-86	49.1
WP_002121621.1\|2678520_2678874_-	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	1.5e-57	94.0
WP_002121567.1\|2678942_2679341_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	1.2e-68	94.7
WP_000539743.1\|2679342_2679711_-	hypothetical protein	A0A0P0IDX0	Acinetobacter_phage	1.1e-55	98.1
WP_002121581.1\|2679682_2680087_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.9e-61	88.1
WP_023187965.1\|2680824_2681193_-	hypothetical protein	A0A0P0I456	Acinetobacter_phage	7.2e-63	95.9
WP_002121501.1\|2681192_2681573_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	8.2e-54	84.9
WP_002121513.1\|2681576_2682107_-	HeH/LEM domain protein	A0A0N7IRE4	Acinetobacter_phage	4.2e-40	91.7
WP_002121495.1\|2682149_2683121_-	hypothetical protein	A0A2H4JIE6	uncultured_Caudovirales_phage	4.4e-136	72.7
WP_005802767.1\|2684035_2685328_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	4.9e-215	86.3
WP_000729387.1\|2685287_2685803_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
WP_002121497.1\|2685861_2686503_-	hypothetical protein	J7I4N9	Acinetobacter_phage	2.2e-123	96.2
WP_002121499.1\|2686471_2686906_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	1.4e-78	97.9
WP_001136775.1\|2686965_2687421_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7
WP_004994718.1\|2687698_2688724_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
2694431:2694446	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2692469 : 2702300

Acinetobacter_phage(54.55%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001277128.1\|2692469_2692946_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
WP_002118340.1\|2692942_2693344_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	8.1e-68	98.5
WP_032015116.1\|2693504_2694479_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	4.3e-147	82.1
WP_000654847.1\|2694480_2694726_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
WP_000566258.1\|2694729_2695179_+	DUF551 domain-containing protein	A0A0P0HSE1	Acinetobacter_phage	3.4e-83	97.2
WP_000048743.1\|2695175_2695460_+	hypothetical protein	A0A0P0HSI5	Acinetobacter_phage	2.2e-43	94.7
WP_002163156.1\|2695463_2695721_+	hypothetical protein	A0A0P0J0B1	Acinetobacter_phage	1.2e-40	88.1
WP_000362184.1\|2695722_2695938_+	hypothetical protein	A0A0R6PG25	Moraxella_phage	3.7e-11	55.9
WP_002115333.1\|2696147_2697428_+	aspartate kinase	NA	NA	NA	NA
WP_000906487.1\|2697674_2697929_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7
WP_002163155.1\|2697996_2698563_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.4e-25	43.1
WP_078224857.1\|2698633_2699074_-	hypothetical protein	NA	NA	NA	NA
WP_002163173.1\|2699263_2699821_+	cytochrome b	NA	NA	NA	NA
WP_002163181.1\|2699865_2700864_-	adenosine deaminase	NA	NA	NA	NA
WP_002163170.1\|2700980_2702300_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.1e-60	36.0

DBSCAN-SWA_9

2728326 : 2785858

Faecalibacterium_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004994718.1\|2728326_2729352_+\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_002163168.1\|2729380_2730568_+	outer membrane porin, OprD family	NA	NA	NA	NA
WP_002163172.1\|2730801_2731878_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_002115351.1\|2731890_2732835_+	oxidoreductase	NA	NA	NA	NA
WP_005802836.1\|2732878_2733571_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_004994718.1\|2733779_2734805_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.0e-25	30.4
WP_000693745.1\|2735203_2737159_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	2.1e-129	41.1
WP_010326927.1\|2737516_2738542_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_002120570.1\|2738886_2740458_+	carboxypeptidase regulatory-like domain protein	NA	NA	NA	NA
WP_002120484.1\|2740553_2741012_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002120512.1\|2741081_2742314_-	3-(3-hydroxy-phenyl)propionate transporter MhpT	NA	NA	NA	NA
WP_170825830.1\|2742563_2743403_+	p-hydroxycinnamoyl CoA hydratase/lyase	NA	NA	NA	NA
WP_002120481.1\|2743440_2744892_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_170825831.1\|2744973_2746860_+	AMP-binding protein	NA	NA	NA	NA
WP_002120514.1\|2746933_2748073_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_002120553.1\|2748184_2749405_+	OprD family porin	NA	NA	NA	NA
WP_002120536.1\|2749462_2749999_+	DUF3237 domain-containing protein	NA	NA	NA	NA
WP_002120534.1\|2750039_2750429_+	PaaI family thioesterase	NA	NA	NA	NA
WP_002120498.1\|2750462_2752214_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_002120549.1\|2752286_2753000_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_002120529.1\|2753241_2754828_-	aldehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
WP_002120561.1\|2754858_2755770_-	5-dehydro-4-deoxyglucarate dehydratase	NA	NA	NA	NA
WP_002120503.1\|2756036_2757371_-	glucarate dehydratase	NA	NA	NA	NA
WP_002120540.1\|2757656_2759015_+	MFS transporter	NA	NA	NA	NA
WP_002120551.1\|2759085_2760633_+	galactarate dehydratase	NA	NA	NA	NA
WP_001181015.1\|2760758_2761655_+	DMT family transporter	NA	NA	NA	NA
WP_002120545.1\|2761670_2762741_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002120537.1\|2762870_2764331_+	coniferyl aldehyde dehydrogenase	NA	NA	NA	NA
WP_002120579.1\|2764485_2765106_-	hypothetical protein	NA	NA	NA	NA
WP_002120510.1\|2765229_2766636_-	amino acid permease	NA	NA	NA	NA
WP_002120521.1\|2767092_2768187_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_002120524.1\|2768183_2769419_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.9e-23	29.1
WP_002120489.1\|2769554_2769977_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_002120548.1\|2770305_2771736_+	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
WP_002120573.1\|2771764_2772535_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_002120532.1\|2772590_2773310_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_000191916.1\|2773375_2774083_+	cache protein	NA	NA	NA	NA
WP_002120563.1\|2774269_2775601_+	APC family permease	NA	NA	NA	NA
WP_087554624.1\|2775643_2776803_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.7e-49	38.4
WP_171490076.1\|2776860_2778306_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_005802857.1\|2778454_2779813_+	amino acid permease	NA	NA	NA	NA
WP_002120526.1\|2780190_2780550_+	hypothetical protein	NA	NA	NA	NA
WP_002120567.1\|2780707_2781388_-	DUF799 domain-containing protein	NA	NA	NA	NA
WP_002120559.1\|2781384_2781753_-	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_002120578.1\|2781770_2782442_-	CsgG/HfaB family protein	NA	NA	NA	NA
WP_002120495.1\|2783593_2784103_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_148728153.1\|2784108_2784663_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.2e-38	49.4
WP_085944217.1\|2784692_2785858_-\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-164	99.3

DBSCAN-SWA_10

3303142 : 3311345

uncultured_Caudovirales_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000394712.1\|3303142_3304366_-	ImmA/IrrE family metallo-endopeptidase	A0A222YXG1	Escherichia_phage	4.1e-22	47.1
WP_000770669.1\|3304355_3304628_-	type II toxin-antitoxin system HigB family toxin	NA	NA	NA	NA
WP_000835370.1\|3305035_3305854_-	hypothetical protein	NA	NA	NA	NA
WP_002132853.1\|3306150_3307218_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	4.6e-94	59.2
WP_001191832.1\|3307322_3308276_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.2e-61	42.8
WP_001052988.1\|3308294_3308999_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-92	72.5
WP_000068658.1\|3309003_3310044_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_000670223.1\|3310051_3310525_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.6e-36	51.3
WP_000373080.1\|3310531_3310855_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.2e-21	61.0
WP_000213577.1\|3310910_3311345_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.3e-41	62.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043054

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP043052

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection