CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP043180	Acinetobacter baumannii strain PG20180064 chromosome, complete genome	4 crisprs	csa3,WYL,DEDDh,cas3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043180_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043180_1

120553-120637

Orphan

Consensus_repeat	Method
GCTTGTCTTGCACCAAAGTTAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043180_1

>merge|NZ_CP043180|1|120553-120637|CRISPRCasFinder
GCTTGTCTTGCACCAAAGTTAAAAGATTATCAATCTTCTTTACTCTACGCGCAGTTTCACTGCTTGTCTTGCGCCAAAGTTAAAA

>NZ_CP043180|1|1|120553-120637|CRISPRCasFinder
GCTTGTCTTGCACCAAAGTTAAAA	GATTATCAATCTTCTTTACTCTACGCGCAGTTTCACT
GCTTGTCTTGCGCCAAAGTTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043180.1\|WP_031963197.1\|121117_122026_+\|DUF1853-family-protein	unknown	unknown	gnl\|CDD\|378094
NZ_CP043180.1\|WP_000729762.1\|132030_132567_-\|purine-binding-chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
NZ_CP043180.1\|WP_001984830.1\|112452_114627_+\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP043180.1\|WP_001984826.1\|122124_122268_+\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|227797
NZ_CP043180.1\|WP_000505931.1\|129905_131984_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP043180.1\|WP_096640405.1\|125238_129759_-\|Hpt-domain-containing-protein	unknown	unknown	gnl\|CDD\|223716
NZ_CP043180.1\|WP_001016580.1\|122393_123527_+\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
NZ_CP043180.1\|WP_005134808.1\|118133_118919_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP043180.1\|WP_002010643.1\|109664_109868_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_001005337.1\|107766_109242_-\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP043180.1\|WP_000490937.1\|109341_109482_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_096640403.1\|115460_118007_+\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|99797
NZ_CP043180.1\|WP_000101096.1\|132627_132990_-\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP043180.1\|WP_001047593.1\|110378_111083_+\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP043180.1\|WP_000125649.1\|114727_115303_+\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NZ_CP043180.1\|WP_009519710.1\|123664_124546_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP043180.1\|WP_001259501.1\|120644_121013_-\|YbaN-family-protein	unknown	unknown	gnl\|CDD\|377291
NZ_CP043180.1\|WP_161325545.1\|124777_125206_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000077304.1\|119988_120492_-\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
NZ_CP043180.1\|WP_000003701.1\|111110_112325_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878

Protein	Function_ID	Function_description	E-value
NZ_CP043180.1\|WP_031963197.1\|121117_122026_+\|DUF1853-family-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	3.70376e-41
NZ_CP043180.1\|WP_000729762.1\|132030_132567_-\|purine-binding-chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	2.92747e-31
NZ_CP043180.1\|WP_001984830.1\|112452_114627_+\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP043180.1\|WP_005134808.1\|118133_118919_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	2.76995e-38
NZ_CP043180.1\|WP_096640405.1\|125238_129759_-\|Hpt-domain-containing-protein	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	3.00253e-117
NZ_CP043180.1\|WP_000505931.1\|129905_131984_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	5.99961e-71
NZ_CP043180.1\|WP_001984826.1\|122124_122268_+\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|227797	COG5510, COG5510, Predicted small secreted protein [Function unknown].	4.44613e-07
NZ_CP043180.1\|WP_001016580.1\|122393_123527_+\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP043180.1\|WP_001005337.1\|107766_109242_-\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
NZ_CP043180.1\|WP_096640403.1\|115460_118007_+\|PepSY-domain-containing-protein	gnl\|CDD\|99797	cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	4.03238e-130
NZ_CP043180.1\|WP_000101096.1\|132627_132990_-\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.79368e-36
NZ_CP043180.1\|WP_001047593.1\|110378_111083_+\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.03168e-34
NZ_CP043180.1\|WP_000125649.1\|114727_115303_+\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	0.00838382
NZ_CP043180.1\|WP_009519710.1\|123664_124546_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	2.13401e-10
NZ_CP043180.1\|WP_001259501.1\|120644_121013_-\|YbaN-family-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	4.46882e-39
NZ_CP043180.1\|WP_000077304.1\|119988_120492_-\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	5.23632e-26
NZ_CP043180.1\|WP_000003701.1\|111110_112325_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.41627e-94

>NZ_CP043180.1|WP_000077304.1|119988_120492_-|L,D-transpeptidase
MSQFKLEDADILIDLANQTLSLPKHNKFYVVSTGKNGIGEQENTGKTPRGWHRVAKKFGMQSPKNTVFIARQPTGEVYSSELAAQFPERDWILSRILWLDGLEEGFNKGEGHDTMQRYIYIHGTPDKEPMGVPMSHGCIRMRNEEIIELFDLVSEDALVYLSEQSLT
>NZ_CP043180.1|WP_005134808.1|118133_118919_+|YdcF-family-protein
MQVSKWIRIFLAVIGSILFLDGLFLAFLNKIHVGTLVPLVLGAFFCLYALFYYHLERFFFYHYRLHTLWRFGWLCFWIWLIGLGYFFNFIKENKDASQNLPAVKAIIVLGSGVENGQPSAILAKRLDTAAPVTLSQPQAKVILTGGLDFSEKEPEALVMSRYLEQHFHIAKDRMILEDKSTSTELNLKNSKPLLEQAHISVNQPIAIVTSDFHTPRAAAIAKKQGYTQVYMVAAETPLITRYNAWLREYFAYASGWLLNEY
>NZ_CP043180.1|WP_096640403.1|115460_118007_+|PepSY-domain-containing-protein
MFKKFLFQIHWFLGISAGLILSIMGVTGAIYSYDQQILKWLNTDSYVVQVQSSPKLTPAQLYQHFTTIQPEIKINSITIAKDPTASSVVNIEKEGERRGYNMMVNPYTAQVLPEVQGRKLLLLIQQIHRNLTAGEFGKQITGACALMLIYFVLSGLYLRWPKKHSARQWLAVKPKLKGRNFIWDLHAVVGTWVIVFYLLFACTGLYWSYDWWRSGMFKVLGVEQPKMQGHGGSGRNKDQLPKIQLDNAQLITALNQTWSGFNNQIGRDYSTLTVNLPKKDDGKIELSFVDATPQHERARNQAVYNYKTANIEKMELYEDKKLNQKIMSSMLPVHRGSFFGPVYQFVAMLASLAMPLFFVTGWMLYLKRRKQKKLTQAARQSLAGHYIDQNAKPWLITYATQTGVAEQLAWSTATSLQEAHQPVQVKSVQQLTEADLQQHEQILFVISTYGTGEAPDLASNFAKKLLKTNLKLQHVKYAVLALGSKEYPDTYCSFGHTVDEWLKNNGAKALFDIIEVDNANPADIQNWNQALVKATKLDLHAVNIEKVFDNWTLQQRDLLNPNSLGQPAYNIELTANHEAIWQAGDIAEIQPGNSPERINKFLQHHHILKNAVVDSLQVSIEKALWNKDLTGEIEPFANLDHLLEQLPTLPTREYSIASIPSQQVLRLVVRQQHDESDDLGLGSGWLTQHTEINQSVALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLHTRTRHNYTENWLIFGERQRAHDFFYASTIEAWQTMGMLKRLDLAFSRDQEQRVYVQDIIRQNAAELVNWIERGAVLYVCGSIEGMASGVDQALIHILGEEQVDELRQQGRYRRDVY
>NZ_CP043180.1|WP_000125649.1|114727_115303_+|SdpI-family-protein
MTAKTLYAYTLQPVPYEVSEAEQRNAQLLIWRSTNKISTKIWAIMGVILALAILGLIFIKNYSTVICWVAIVCVVLYYLGRKYGLEWYVKRKMNEFPVQEIKGIRLGVQPHGIVMRQQMGLQEGVGTIGWKNIYEWYNTPDFILVNFKVKDPKGQEQQGAYILPKRMDSKNFSFNTIRKHLKESVGEPKTL
>NZ_CP043180.1|WP_001984830.1|112452_114627_+|TIGR01666-family-membrane-protein
MKSWFKRLKRATYNTSFMYNVRMLIAFSGTAFVPYFLGHQLATIPLTLGVVAAGLSDIDDRFSVRIMNLIYTYIGFFITAASVQLLFPYPMLFALGLIASCIGWILLGSLGRRYATISYGCLVVSVYTMLGVHLFDQWYIQPALLVAGAAWYGLIATISFLLFPVRQLQDKLAASYASLGDFLFAKSNLFDVDMTPASYQQSMIDLSLENGKLITIFNDLKTALLTRLKGDRGQKGTRRSLHYYFVAQDIHERADSAHIDYQKLAKIFQHSDILFRFQRILAIQGKACQELNECILQRKPYIHNKRFKQSFENLRLSLVKLRDDQQYDLLWVNALFALYRNLKSIDSQLLNLETEQHIQSDKVKQAENQLKDDDLKGWNDIVVRIKQNLTPESVLFRHAIRVSIVLFIGYVFIQMTHIEYGYWIMLTALFVSQPNFNATKRRLRLRIVGTLVGIIVGLSIVFLVPSVEGQLVMLILSGVLFFELRSKQYAQATAFITILALINFNLDGSAVAAAIPRFVDTLIGCALAWFGVTFIWPDWKFRRLPRSIRRSLQAQCNYLAEVVKQYHEGHNHALNYRIVRRAAHNTDAEVASLISTLATEPDFDPTRKSDIFEFLCLNHTFLSYIAALGAHREKIQDQAVLNVLDQALDDIQGALLRDEMPDLTAQNMLQTIRQRLSQNDEDDQKSLIILQQLSLMLSVLNRFSMLKQRLSHDLDNDASELASL
>NZ_CP043180.1|WP_000003701.1|111110_112325_-|multidrug-effflux-MFS-transporter
MSEQTAQRQYSIGWIMLLALLTALGPLSIDMYLPALPQMAHDFGVSTQMVANTLPAYFFGLAIGQLVYGPLSDRIGRKKPLYFGLALYAVASLFCVLATNEWSLIAARILQALGGCVGVVMARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPMIGAWILIWFPWQAIFIALSIVGAICWLCVHFFFKETLAVDKRLKLSLYQVATLYGAIFKDASFRLPMFAGCLTGAALFCYISSAPAVFMDQYGLNQQEFAYVFGLNAFGIMLMSSLNKHLTTRVEITKRLKAGSMVQVTGASIVLIAGLISAAPLWLVMLGLFLAISGIGLTGPNAMALAMSKQGARAGTASAIMGSMQFACGLLGGVLLNFLIWSASLNMGVMMVLFTLSGFIVVLKAIRQAKSQSLS
>NZ_CP043180.1|WP_001047593.1|110378_111083_+|nitroreductase
MNLEQVRLVDEAITSRHSVRAFLSTPIEPEVIKDILRVASRAPSGTNTQPWKVYVVTGHKRDEMVERVCAAQIEVSKNPELAEQYKETFAYYPEKWVSPFIDRRRENGWGLYGLLDIKKGEKEKMAAQQLRNFKLFDAPVGIFFTVNKAMGIGSKMDIAMMIQNVMVAAKARGLDTCPQAAWNHFHPLVLDILGAADDEELVCAIALGHADPEHIVNTFITPREPVENFAVFLD
>NZ_CP043180.1|WP_002010643.1|109664_109868_-|hypothetical-protein
MSLPLINKQFMKQGLAITIATMKMNVTHATTEPQEIQQLGTDLNALFFNEKEKGTDSRVMTMACYSL
>NZ_CP043180.1|WP_000490937.1|109341_109482_-|hypothetical-protein
MFSGAMNLFYLKGAFSHVTFKGLVLGMMLLKLVTVIAIQVTLKVFP
>NZ_CP043180.1|WP_001005337.1|107766_109242_-|alanine:cation-symporter-family-protein
MNEQLNATLMSWVQFFNEPLWDFLVIFLLAVGIFYTVLTGAVQIRMFLQSIRVMKSSRTEGEDEHGLTPFQAFVTGLASRVGVGNIAGVAIAIAIGGPGAVFWMWVTAVLGMSSAFIESTLAQLFKVRDSNSKQFRGGPAYYITQGLRSKTFGVIFALALIFTYGFVFNSVQINAIANASSHAWGWDKANLIAHLGGVDLEISWVGLALVVMVALAIFGGIKRIAKFAEMFVPLKAGLYLSVALYIALSNYAILPDVLKLIVTEAFHFNAAAGGFFGAAVSMAMMQGIKRGLFSNEAGMGSAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCTSTAIIILVSGVYQDAGFVGVELTQRALETQVGHWGADFLAVLLFLFCYSAVLGNYAYAESNVQFINNNPKVMFIFRIFVLVMVYFGAIGSVPLVWSMADLFMGIMATINLVAILLLTPMARTLLKDYRAQLKQGIKEPVFKINKYPELKKKVDSDIW
>NZ_CP043180.1|WP_001259501.1|120644_121013_-|YbaN-family-protein
MRTLFWRTLVVIFITLGIIGAILPGMPTTVFLILAAWAASKGWPQMDAWLLNHPKYGPTLRDWRANGTVPRKAKWIATIMMTASGILMLFTSAPFWVKVFTDTTMLVVAIWLWLRPEPKLKD
>NZ_CP043180.1|WP_031963197.1|121117_122026_+|DUF1853-family-protein
MNIASIKTSYFEPWLQFSHPMVRQLAFTIASPNLLSQLPCSLTIRHSFQLHTDKNWEQHFQNYFPRLKQLDEAPEPLLQFMSRLKSTRLGLRFENLLWFWLLEDQYHPYQLLGHSIQKIDGAKTLGELDFLVLNQNTQEIEHWEVALKYYLGEGQLNLEQWIGLNRQDTLSKKLYHFTDKQFQFSEALGFKVQQRFAVLKGQLYLPLNLPQEQPIPEWVNLKRRLGTWGTEIPKSDFYRLERHEWLCPHQKASSNTAYWWTDGLYCQNINETRFYMFRHPALLSLKPSLIKNNGVLQETTSL
>NZ_CP043180.1|WP_001984826.1|122124_122268_+|entericidin-A/B-family-lipoprotein
MMKKVLVASVMVAFVLTGCNTFKGFGQDVSKAGDAVTNTAQKTENKM
>NZ_CP043180.1|WP_001016580.1|122393_123527_+|succinyl-diaminopimelate-desuccinylase
MNHSDTLSLSLELLQQPSVTPIDHTCQTIMAERLAKVGFHIEPMRFGDVDNLWARRGTEGPVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVGELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLTDIYEQILENLLA
>NZ_CP043180.1|WP_009519710.1|123664_124546_-|alpha/beta-fold-hydrolase
MSIHKELYILETDDHVEFALWKVAKSENTLIKKEAIFLSHGAFSDKTVCMGIAVYLANHGYICFILEWRGHGTSPKTDIPFNFETVALYEYKAAFHYIYHHFNMDSLHCVTHSGGGLCLTMFLINYPEYLKNIQSITFIACQAFGAVNDSFDFIKLFSAKLVVKGLGQIPANKFKLGRVNESYYTMQPWFNWNLKQNFISEFKNIDYKKHMSSIRAPIYSISGSGDKFIAPVKGCYKYLEAFENHNNVFREFGYSNNNLENYSHSRIVLSQNAAKEVWPTILQWIDKNSKEVL
>NZ_CP043180.1|WP_161325545.1|124777_125206_-|hypothetical-protein
MDQQELQHLITVSTGFIDAYIIECNDQVPMLLPQNIVLSAMDVKNGVKHIEWHDVKLPVYSVHNAIDQHAVALVIEGEDISQRFALICKTMPVSTRLRISEIVDEMDEHEAEQHPAVFKYVRMQDQRYYIPNLEYIEKTLGL
>NZ_CP043180.1|WP_096640405.1|125238_129759_-|Hpt-domain-containing-protein
MKEILKTLTEAMTLPEDSYSEQDTEFLEIFIEEIEEIFVDLQPLINKWMQSENIATLTEIRRHFHTLKGSGRMIGAKSSAELAWTVEDTLNRVINQSLQLTPTIQSYVQLVFKFYFLKLVDNFKQKRAHTLDFRPLILLGQQLQQQQSLEPALEELLQLSNTLTAETVTGLELDYIEQDSLAEPIIQATHTEIEINLDETLTLFMEEAEEHLATIHQFLDQELHQYDSYNALIRALHTLRGSSAMAQVETIFEASTKVEHLFKILLQEELSSHSEEILLLQEYREFVRDSLELLSRYSSSEQLEARLQQFNQSWDSYVEQHGDRTDPLMPSHGLVSQLLQLDVSELLDAELDFEKGIRNEFPDYLERLSEQADLLLQHTHSQAMLGLHEYTSQLKESYEVLLDKPALLQSDYIFEIYQKAHQQLIQLFDALAAGQRVGVVKQHQSILEELKLYTQYIPDISNDLPQQDSTSFEPISNIEQEPEVVATVENFSDSVDWTVLGQSVQQDRQYISSTQVNRNFDADLLDIFLEEAEELLEGIDTDLNIWVGEQENFAALNNLMRYLHTLKGGANMVQATYLGLIAHELESIYERLIQKQLVATSDLIDFIRLVQDDLADRLQVMREQQLDYAAPYTINALKRAGQNSNFQPLPVVEAFDTESEIFSEQEVISEIIIDEIPVELEPALAELETHHDQVFDTAVTELATPVEMITTVTSQESEIAADEQDIEAVVEQTFLEEATELLEMAESLLKQWFEQRTNRSILLQLQRAVHSLKGGARMVGLEAVQAIAYQLESAFEQFALHHFNSNIYDHLLESAIAWLKDAIFNHNYQHFDGLQQSLENIQFFETTIQIPTKLTRADLFSSEPVMTFIQGDGTEPPPMMGAWEQTERLDQNNEMIRVSADLIEKMIDLSGENSINRSRIEMDLSQFSHTLVEMELAIQRLADQLRRMEGELETQIIAKHGIEHSRYTDFDPLEMDQYSSLNQLSKSLAESASDLVDFKNTLSDKIRDTESLLLQQSRIQAEIQEGLMRTRLVPFSRLLPRLQRIVRQTSTALNRPAELFVNNTEGELDRNILERLVIPLEHMLRNAIDHGLEDRAQRQQANKPETGRIELNIQRQGTDVVVVFSDDGQGIDVEKVRQKALLAGLIKPEQDLEQQDILQLIFHPGLSTAEQVTQISGRGVGLDVVQSDIKSLGGHVSVESVYGQGTTFTIRVPTTVAVSDALMVKVADQQFAIPLAQIDRIIRVSPASLEQYFESPQELFEYENKRYPLRYLSEFVGNQPIPRLNGVMYSLPVLMIKANNGQTVALLVDQLIGSRAQIVVKPIGQQFSSIGAIAGATILGDGQVCLILDGQNIARQIQSTQRHKQLSEAVYRHRESDERRLIMIVDDSVTVRKVTSRLLERQGYDVVTAKDGVDAIEQLENIKPDLMLLDIEMPRMDGFEVLNLVRHHDMHQYMPIIMITSRTGEKHRERAFSLGVSQYMGKPFQEEELLENIDALLVASDSEVKS
>NZ_CP043180.1|WP_000505931.1|129905_131984_-|methyl-accepting-chemotaxis-protein
MGFKLKKKSGNRGATGKSSVNFIAKIQSKIEQFASLFGESEKSKPILYAALLCLVCALISLAYLFYNVPRHNQLIRSLGELRLLSQTISKQATEATESGSQEAITKLQQSKKDFDENLLEIENIHGKSTDEYQKVEKIWGEVSKNIDLISSHQRVLNQLYDTNISISETVPEIQAEYNLMVDQMARQGLPSSQVIIAKNQVFIAERILRSINSVLSGTDGNVSTSDFSVDIETFGTYLNAELNGNAELGVDRIADPALRESLESIKSEYDKVLKSAAATVLKNGSQIVNVRQASSQIFSKSDVMLESLGHLSDVARKNWLTLFLGAVLILSLGGLIFSVFKLITLRSVMDKQRVARLQEEYDRNQNAILRLLDEIADLADGDLRSYATVSEDFTGAIADSINFAIDQLRDLVSRIHETSQEVARYTQDTQSITNQLAEASEHQAQEIAGASTAMNEMAQSIDQVSANASESAEVAQRSVQIASNGAQVVNRSIEGMDTIREQIQETSKRIKRLGESSQEIGNIVSLINDIADQTNILALNAAIQASMAGEAGRGFAVVADEVQRLAERSASATKQIETLVKTIQTDTNEAVISMEQTTTEVVRGANLAKDAGIALDEIQKVSGDLAKLIASISDAAKLQSASASHIATTMTVVQEITSQTTTATFDTARSVSELANMAESLRESVTDFKLPD
>NZ_CP043180.1|WP_000729762.1|132030_132567_-|purine-binding-chemotaxis-protein-CheW
MAANGFIELLRLSKRGNKNYASVQNEAQRWSGIAFEMRGQYFVAPLGEVSEVIYPPKYTPVPNTQSWVKGLANIRGRLLSVSDLAHFISGQRSSFSSTQKVLCISHHDQYVGLVVDQVLGIQHFNKKSFFSQSSDLEENLKEYCQGYFHQHNQHWHVFLFSRLLQNPHYMNASTKFIN
>NZ_CP043180.1|WP_000101096.1|132627_132990_-|response-regulator
MARILIVDDSPTETFRFKEILTKHGYDVLEASNGADGVTLAKAEQPDLVLMDVVMPGVNGFQATRQITRDEDTKHIPVVIVSTKDQATDRVWGKRQGAIDYLIKPIEEKQLIDVIKQFLN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043180_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043180_2

2402355-2402518

Orphan

Consensus_repeat	Method
CGGTTATCATTTTGCTGTTGTTG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP043180_2

>merge|NZ_CP043180|2|2402355-2402518|CRISPRCasFinder
TGGTTGTTATTTGAGTTTTGTTGGCCAGAATCTTTTTGATTAGATCCTTGTTGTTGGCCGCGGTTATCATTTTGCTGTTGTTGCTGGTTATTTTGTTGCTGTTGATCGTTTTGCTGTTGGTTACCGTGTTGCTGTTGATTACGGTTGTCATTTTGCTGTTGTTG

>NZ_CP043180|2|2|2402355-2402518|CRISPRCasFinder
TGGTTGTTATTTGAGTTTTGTTG	GCCAGAATCTTTTTGATTAGATCCTTGTTGTTGGCCG
CGGTTATCATTTTGCTGTTGTTG	CTGGTTATTTTGTTGC
TGTTGATCGTTTTGCTGTTGGTT	ACCGTGTTGCTGTTGATTA
CGGTTGTCATTTTGCTGTTGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043180.1\|WP_001984002.1\|2399427_2399718_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000482091.1\|2402850_2403330_-\|CinA-family-protein	unknown	unknown	gnl\|CDD\|224463
NZ_CP043180.1\|WP_096640908.1\|2412493_2412949_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP043180.1\|WP_001136759.1\|2401100_2401529_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_085941324.1\|2405109_2407254_+\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP043180.1\|WP_002057748.1\|2411725_2412337_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP043180.1\|WP_001124839.1\|2411041_2411653_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP043180.1\|WP_096640906.1\|2409226_2410462_+\|stress-induced-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP043180.1\|WP_000132045.1\|2401921_2402239_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000432325.1\|2407308_2408187_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187613
NZ_CP043180.1\|WP_096640984.1\|2395841_2397125_+\|DcaP-like-protein	unknown	unknown	gnl\|CDD\|371763
NZ_CP043180.1\|WP_000498480.1\|2401615_2401837_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_148746042.1\|2397170_2398409_-\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238868
NZ_CP043180.1\|WP_096640904.1\|2398520_2399426_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP043180.1\|WP_096640898.1\|2393161_2394856_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP043180.1\|WP_000251637.1\|2400687_2400831_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_001029891.1\|2394926_2395598_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP043180.1\|WP_021510338.1\|2408328_2408742_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000795915.1\|2410522_2410759_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_032030718.1\|2403645_2405055_+\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634

Protein	Function_ID	Function_description	E-value
NZ_CP043180.1\|WP_000482091.1\|2402850_2403330_-\|CinA-family-protein	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	5.88094e-21
NZ_CP043180.1\|WP_085941324.1\|2405109_2407254_+\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0
NZ_CP043180.1\|WP_002057748.1\|2411725_2412337_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.08536e-22
NZ_CP043180.1\|WP_001124839.1\|2411041_2411653_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	6.03039e-39
NZ_CP043180.1\|WP_096640906.1\|2409226_2410462_+\|stress-induced-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	6.37807e-19
NZ_CP043180.1\|WP_096640908.1\|2412493_2412949_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.94492e-40
NZ_CP043180.1\|WP_000432325.1\|2407308_2408187_-\|glucose-1-dehydrogenase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.33703e-161
NZ_CP043180.1\|WP_148746042.1\|2397170_2398409_-\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	4.24641e-93
NZ_CP043180.1\|WP_096640904.1\|2398520_2399426_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.40622e-67
NZ_CP043180.1\|WP_096640898.1\|2393161_2394856_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP043180.1\|WP_096640984.1\|2395841_2397125_+\|DcaP-like-protein	gnl\|CDD\|371763	pfam11854, MtrB_PioB, Putative outer membrane beta-barrel porin, MtrB/PioB. MtrB-PioB is a family of bacterial putative outer membrane porins. This family, is secreted as part of the pio (phototrophic iron oxidation) operon that has been found to couple the oxidation of ferrous iron [Fe(II)] to reductive CO2 fixation using light energy. PioABC is found in Rhodopseudomonas palustris and MtrB-PioB is likely to be a beta-barrel porin. Similar to other outer membrane porins, PioB and MtrB are predicted to have long loops protruding into the extracellular space and short turns on the periplasmic side.	0.000177316
NZ_CP043180.1\|WP_001029891.1\|2394926_2395598_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.71001e-20
NZ_CP043180.1\|WP_032030718.1\|2403645_2405055_+\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.23943e-18

>NZ_CP043180.1|WP_000132045.1|2401921_2402239_-|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDM
>NZ_CP043180.1|WP_000498480.1|2401615_2401837_+|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATTPSVQFKKEVFDDPNSANQYLSHNFNMPPFF
>NZ_CP043180.1|WP_001136759.1|2401100_2401529_+|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP043180.1|WP_000251637.1|2400687_2400831_+|hypothetical-protein
MVRIFCAVSMVLAIAMGMSACQDRNSRNDGMHEASDPATSHDMNKNS
>NZ_CP043180.1|WP_001984002.1|2399427_2399718_-|hypothetical-protein
MFFLYRFVLVSLLTIGVLNLMGCRPMSKNEFNTRCVWAGHDLSACNCIYNSLEQHYSPQFVESLPKLSLQNIDAKMNFVETMNQTMQQCQLSASKH
>NZ_CP043180.1|WP_096640904.1|2398520_2399426_+|LysR-family-transcriptional-regulator
MSYFDINRSGELAIFIRVVELGSFSAVARACNMTPSAVSKLISRLEKRLGVRLLNRSTRQFQLTSEGCQFYEQGIQILNDLDELEQAVTANHIPKGRIRIHTSFSYWTHFLLPCISLFNQRYPEIELEAHLSDEVINLVEQRIDVAIRTGPLKSSNLVVRSLGSTYKQYVCSPVYIEKYGCPEYTDELHEHQLLDVSYQRQNKTWLFKKATQEISLTPSKVLKVNHGEAILQLALAGAGIAQLNEFQIRNALQQKQLVKILEDWNIHASEEFHAVWIGHDKYVPNRVRTFLDFLVEHASIN
>NZ_CP043180.1|WP_148746042.1|2397170_2398409_-|SGNH/GDSL-hydrolase-family-protein
MKLYQATLFSLVLFTSFAQADVENSQWITTWSTSPQKVWNKDFVFPTLIPEQVSNQTIRQMSKISLGGEAVRLVFTNQYGKQPLYIDQTTIGLANAVTLKSKSTYPVYFSGQLKARILPGKQLISDPIQLPVPDHAQLVVNSFIQKPTTFKTFHWDAKQTSWLITGNQTANLNTPSSAKTTTARLLLSAVEVKPKRKAHVVAVVGDSITDGATATLDANTRWTDFLAKRLSAHHVAVINSGISGNRLLTDGMGDRVLKRLNSEVFQYSGVKTLIVLVGINDISWPGTAFAPKQQIPSFEALTQGYRRVVSEAHKHNIQVIVATLLPFSGALPNTPLDNYYQPNKDQLRQRINHWMRTSHTFDGVLDLDEGLKDPKHPNRLNPIYDSGDHLHPNDRGNQHMAELVDLDQIIKN
>NZ_CP043180.1|WP_096640984.1|2395841_2397125_+|DcaP-like-protein
MKILNTTVQKSLLAVSVTLLMSSAFADQVNPEIEQLRQEIKELRAMLQTNMEAQKSLAQKRVEQAAPVVTQAPQPIQQTLTKSGAEFNLYGYIRADASYQIKGASTMYNNISGVPLENTPEESAQKDQLHSTVYVTRFGLNFKTPTAVGDVGGKLEMDFFGAATRDQFRIRHAYLTFDKWLIGQTWSTFIAPEYYPETIDAGTFVGSALLRSPLVRYSDNLTANTSFAVSVEDPKYTAATDPDNKMRLPALVGRLNHKFANGSMLSGRSFVAEKRTNNDSEWAWGVGLGGKYQITPDTLLKADYYHVKGDGRFLLWSNSGYAIDDQNNMHSNEFDTVSLGITHQFTPQIRSTLGYGYMKAKDDNRFAELQRTSTTQNKQLWQGWVNALYNPYKPITLGIEYVYGERETFDNRNGIDNRFNMIASYDF
>NZ_CP043180.1|WP_001029891.1|2394926_2395598_+|class-I-SAM-dependent-methyltransferase
MAKDFNSPKVVEGYDAHIRKLIPGYEVIHQQVDAILQSVLPPDAHILIVGCGTGYELEYLLKRHPNWQFTAVDPSLIMLQKAQEQVEILGKSAQVTFVHGETSALPLESSFDAALSILVAHFIADDIKPAFFKDIYDRLKEKAPVLTYDLMTCVNLQQLQALRYLCLAQGLTEEQCQKMLERMAEDFFSLTTEGYIKLLEKTGFESVQPYTQILTYQGFMAKK
>NZ_CP043180.1|WP_096640898.1|2393161_2394856_+|AMP-binding-protein
MQQERLSYASGPSTQPLLGMTIGEQFDQACQQYAEKEAIVSFHQNRRLTYKALQDEVNAFACSLLKLGLKKGDRLAIWSPNCVEWTITQFAAFKAGIILVNLNTAYKSHELEYVLNKVSCKGLIIASQFKTTDYQELLTKIAPELTTCTDKVLSSERLPHLKFVIKIDDQQHTGIYRFSDLLTTPTSEQLEQLKQLARQLQFDETINIQFTSGTTGNPKGTMLTHHNILNNGYFVGEGIRLTPQDKVCISVPLFHCFGMVMGNLACVTHGSTMVYPSAVFNPLETLKAIHQERCTAAYGVPTMFIATLEHEQFNDFDLSSLRTGIMAGSPCPREIMQRVIDRMHMSEITICYGMTETSPVSVQSSVNDSIDKRVSTVGHVHPHVEIKIVDLEGQIVPQGTLGELCVRGYSVMAGYWGEEEKTREVIDGAGWMHTGDIAEMDQEGFIKIKGRIKDVVIRGGENLFPKEIEDFLYTHPDVSDVQVIGLPDAKYGEELCACIILHEHHQVDEDSIRQFCKEHISHNKVPRYVRFFNEFPMTASGKAQKFKLQEIMRAELNLTGNIFD
>NZ_CP043180.1|WP_000482091.1|2402850_2403330_-|CinA-family-protein
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGDILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLRGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP043180.1|WP_032030718.1|2403645_2405055_+|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKEKKARDFLAKEIDKLEMKEIDFPSDINLIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNKYKDKELFLTKLKRGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTDHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSNFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSNDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP043180.1|WP_085941324.1|2405109_2407254_+|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEQGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLNYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP043180.1|WP_000432325.1|2407308_2408187_-|glucose-1-dehydrogenase
MENTTNQYPSEVPAQVQPHQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLEEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFAMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP043180.1|WP_021510338.1|2408328_2408742_-|hypothetical-protein
MMQPTNTNSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLYIIKSKNIETEDIKKILDNIVVKNSKNKDDLKNIVEAETVIKEILDLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP043180.1|WP_096640906.1|2409226_2410462_+|stress-induced-protein
MANTRYEDDNNSSGTSNRGFASMDPERVREIASKGGRAAHASGNAHEFTSEEAREAGRAAHASGNAHEFTSEEAREAGALSHKNDDRNGRGRSRYDDDEDDDRGRSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRHDDDDEDNDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGRGQNSRNQKRDAYGRFTS
>NZ_CP043180.1|WP_000795915.1|2410522_2410759_-|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP043180.1|WP_001124839.1|2411041_2411653_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTDNQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFQPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP043180.1|WP_002057748.1|2411725_2412337_-|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLITPPTPNQSGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIGQI
>NZ_CP043180.1|WP_096640908.1|2412493_2412949_+|Lrp/AsnC-family-transcriptional-regulator
MDRIDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNFVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVAKDLPAFQRLYDEKLSAIPSVQRLISTIVMKDVVPERLFPIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043180_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043180_3

2409374-2409459

Orphan

Consensus_repeat	Method
TCAGAAGAAGCTCGTGAAGCTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043180_3

>merge|NZ_CP043180|3|2409374-2409459|CRISPRCasFinder
TCAGAAGAAGCTCGTGAAGCTGGCCGTGCTGCACATGCCAGTGGTAACGCACATGAATTTACCTCAGAAGAGGCTCGTGAAGCTGG

>NZ_CP043180|3|3|2409374-2409459|CRISPRCasFinder
TCAGAAGAAGCTCGTGAAGCTGG	CCGTGCTGCACATGCCAGTGGTAACGCACATGAATTTACC
TCAGAAGAGGCTCGTGAAGCTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043180.1\|WP_096640914.1\|2418273_2419233_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381147
NZ_CP043180.1\|WP_000482091.1\|2402850_2403330_-\|CinA-family-protein	unknown	unknown	gnl\|CDD\|224463
NZ_CP043180.1\|WP_001136759.1\|2401100_2401529_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_085941324.1\|2405109_2407254_+\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP043180.1\|WP_001124839.1\|2411041_2411653_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP043180.1\|WP_000132045.1\|2401921_2402239_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_096640908.1\|2412493_2412949_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP043180.1\|WP_096640918.1\|2420395_2420872_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380097
NZ_CP043180.1\|WP_000432325.1\|2407308_2408187_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187613
NZ_CP043180.1\|WP_000498480.1\|2401615_2401837_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_096640916.1\|2419279_2420350_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NZ_CP043180.1\|WP_002057748.1\|2411725_2412337_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP043180.1\|WP_000251637.1\|2400687_2400831_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_021510338.1\|2408328_2408742_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000608481.1\|2421157_2422048_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176163
NZ_CP043180.1\|WP_000795915.1\|2410522_2410759_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000108365.1\|2402344_2402566_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP043180.1\|WP_096640912.1\|2414818_2418277_+\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP043180.1\|WP_032030718.1\|2403645_2405055_+\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP043180.1\|WP_096640910.1\|2413006_2414653_-\|allantoin-permease	unknown	unknown	gnl\|CDD\|224374

Protein	Function_ID	Function_description	E-value
NZ_CP043180.1\|WP_096640914.1\|2418273_2419233_+\|response-regulator-transcription-factor	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	5.04798e-55
NZ_CP043180.1\|WP_000482091.1\|2402850_2403330_-\|CinA-family-protein	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	5.88094e-21
NZ_CP043180.1\|WP_096640910.1\|2413006_2414653_-\|allantoin-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	9.32295e-23
NZ_CP043180.1\|WP_085941324.1\|2405109_2407254_+\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0
NZ_CP043180.1\|WP_001124839.1\|2411041_2411653_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	6.03039e-39
NZ_CP043180.1\|WP_096640908.1\|2412493_2412949_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.94492e-40
NZ_CP043180.1\|WP_096640918.1\|2420395_2420872_-\|hypothetical-protein	gnl\|CDD\|380097	pfam18050, Cyclophil_like2, Cyclophilin-like family. This entry represents a family of cyclophilin-like proteins found in a range of bacterial species.	4.01404e-36
NZ_CP043180.1\|WP_000432325.1\|2407308_2408187_-\|glucose-1-dehydrogenase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.33703e-161
NZ_CP043180.1\|WP_096640916.1\|2419279_2420350_-\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	2.15868e-45
NZ_CP043180.1\|WP_002057748.1\|2411725_2412337_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.08536e-22
NZ_CP043180.1\|WP_000108365.1\|2402344_2402566_-\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	5.30417e-06
NZ_CP043180.1\|WP_000608481.1\|2421157_2422048_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176163	cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.00734e-111
NZ_CP043180.1\|WP_032030718.1\|2403645_2405055_+\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.23943e-18
NZ_CP043180.1\|WP_096640912.1\|2414818_2418277_+\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	1.9282e-58

>NZ_CP043180.1|WP_021510338.1|2408328_2408742_-|hypothetical-protein
MMQPTNTNSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLYIIKSKNIETEDIKKILDNIVVKNSKNKDDLKNIVEAETVIKEILDLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP043180.1|WP_000432325.1|2407308_2408187_-|glucose-1-dehydrogenase
MENTTNQYPSEVPAQVQPHQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLEEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFAMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP043180.1|WP_085941324.1|2405109_2407254_+|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEQGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLNYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP043180.1|WP_032030718.1|2403645_2405055_+|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKEKKARDFLAKEIDKLEMKEIDFPSDINLIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNKYKDKELFLTKLKRGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTDHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSNFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSNDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP043180.1|WP_000482091.1|2402850_2403330_-|CinA-family-protein
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGDILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLRGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP043180.1|WP_000108365.1|2402344_2402566_-|hypothetical-protein
MSTTNNQANQRNNQQQQQQQNDNRNQQQHGNQQQNDQQQQNNQQQQQNDNRGQQQGSNQKDSGQQNSNNNQQR
>NZ_CP043180.1|WP_000132045.1|2401921_2402239_-|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDM
>NZ_CP043180.1|WP_000498480.1|2401615_2401837_+|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATTPSVQFKKEVFDDPNSANQYLSHNFNMPPFF
>NZ_CP043180.1|WP_001136759.1|2401100_2401529_+|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP043180.1|WP_000251637.1|2400687_2400831_+|hypothetical-protein
MVRIFCAVSMVLAIAMGMSACQDRNSRNDGMHEASDPATSHDMNKNS
>NZ_CP043180.1|WP_000795915.1|2410522_2410759_-|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP043180.1|WP_001124839.1|2411041_2411653_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTDNQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFQPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP043180.1|WP_002057748.1|2411725_2412337_-|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLITPPTPNQSGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIGQI
>NZ_CP043180.1|WP_096640908.1|2412493_2412949_+|Lrp/AsnC-family-transcriptional-regulator
MDRIDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNFVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVAKDLPAFQRLYDEKLSAIPSVQRLISTIVMKDVVPERLFPIG
>NZ_CP043180.1|WP_096640910.1|2413006_2414653_-|allantoin-permease
MTENDWEIDVMSVSEHPNLDTVQGADSQKAVNETLEDYTLRYAPHSFRRWSPKVVAITALGGIAYLADFSIGASIGMSYGTTNAIFSILFAAIIIFLTGIPLAYYAARYNIDLDLITRGAGFGYIGSVLTSIIFASFTFIFFALEGSIMAQGLLLGLGIPLWAGYLISTVMVIPLVIYGMKALSKLQVWTTPLWLVLMIGPVAYLIYQEPALVSQFATFTGHEGFAPVDMAAIMLGAGICLSLIMQIGEQIDYLRFMPAKTKENSKAWWAAVISAGPGWVILGAIKQIIGAFLGFYLLTKIPGVNSTEPVQQFNAAFHDMLPGWAALTLAVILVVISQIKINVTNAYSGSLAWTSAYTRISKHYPGRIVFVIVNLAIALALMEGNMFAVLGKILGFYSNFAIAWVVVVATDISINKYVLKLSPKEPEYRRDMLYNVNPVGMVAFLVSAGLSIAAFFGLLGSFLAPYSPIIALVLAFVLTPIMGLLTKGKYYIKSHDDGVKEPRYDAEGTPVATVYHCRVCEQGYERPDIMFSHKHNGTICSLCKTLDA
>NZ_CP043180.1|WP_096640912.1|2414818_2418277_+|response-regulator
MSVMPDSSRPQQAPQRVIKTRREYNIWVADESIEDYALRYAPTSVRKWSPWTVTNTAISTVSFLAMEAIGATMLWQYGFSNALWAAIVVCTIIFLTSWPISYYAAKYNVDVDLLTRGAGFGYIGSTITSLIYASFTFILLAFEAAIMAMALELALGIPQVIGYLISALVILPLVVKGIGFINKVQAITQPIWLLLLLLPWFFVLWKQPQILSSSLHFVGAVSNSTDFNLYYFGAACTLIFSFVIQIGEQADYLRFLPQKEKNRTAWRFAVFLGGPSWIIFGFLKVLMGMLLMVLAFQLFIPVSELDNPTYLYWVAYQQFIPNPQLALILTLALVCLAQIKINMTNAYAGSLAWSNFFARLTHSHPGRIVWLLFNVFIAIVLMEMGISHAVERILGLYSNIALAWIGAVVADLIICKPLGLSPKGIEFRRAYLYDINPVGVGALLIASVLSMLSYLGFFGLMAKGLASFIALGSAVLCVPVIAYLTKGKYYIARQPEEIQATSVANCVVCERDYELADMAGCPAYNGTICSLCCSLEARCHDLCKPDARWSVQLKKAIWHYLPERWASRLNSRVSLYLLLTLGLSIVLAVSLSLVYIQEKTYLETINAAAVPQLFTLFVKIYTILFLLMSVAAWWLVLNDESRRNAEIETHQQTALLIDEIAAHEVTSKDLQDARIAAERANDAKSRYVIGISHELRTPLNSILGYSQLLQKQEQLSEQGKMALGVISRSGQHLTSLIDGLLDLARIETGKISLNVVDVHFPNFIEQIIQMFQPQFEQKNLQFVYEIGENLPHYVRTDKKRLEQVLINLLGNALKFTTSGTITLKVEYRFQTAYFEIRDTGCGIAEADLERIFNPFERGSNVVQGGFTGTGLGLPIVKLLVDLLGGQLSVTSQLNQGSQFKIKFYLPSKEVVHPISNVYSNQITGYQGERKRILVVDNEAVDRGLVANFLKPLGFMIEEAESGIDCLRRVPIFQPNLILMDLNMPLMGGWETARLLRQNNITNVPILIISANAGEREVNPQDAVLSEDFMLKPIDLNLLLSKIGDKLGLVWIDSKSDANLENNEVQTLDVKVFKQVAVHTPIKQPENNDLIDLPQSLQQLNDLIGQGYIRGIQQTLMQCRQNFPEHNELWEQLEQAIQKFDLKHAQRLIQDKQ
>NZ_CP043180.1|WP_096640914.1|2418273_2419233_+|response-regulator-transcription-factor
MSTQHVSFQQASPNEQAVILIVDDVPENLGLLHESLDQAGYRVLVTTDGLSAIEIAHRCLPDMILLDGNMPHMDGFESCIQLKASPITQFIPVIFMTGLSETEHIVRGFQVGGVDYVTKPLNIEEVLARVKTHLAHAKLLQQQKQVIDATETAILALDVHGKIVWKTQKASDLLNQYLPELEGFEAGLKAWFSDLEHEKDSKKLTSCFYSTPSQQLQLLLLTPWETEPSVAKNYLIQIKTSTPALEMNDILKYCPQLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHIFEKLCVENRTAAVAHINSLVQEFH
>NZ_CP043180.1|WP_096640916.1|2419279_2420350_-|alpha/beta-hydrolase
MTTSPLFKKLKTHTVVAICAATIGLFSSTSAMAADMSNGANNFYQSQQVTIQKVTFKNQYNMDIVGNLVIPKNLNKKTKAYAIIIGHPMGAVKEQSSMLYAQKLAEQGFVTLAIDQSFWGESAGQPRNVVAPDIYAEAFSAAVDYLGTQSFIDPNNIGVLGICGSGSFVISAAKIDPRMKAIATVSMYDMGAANRNGLRHSQTLEQRKQIVAEAAAQRYIEFKGGETKYTSGTTHELTADTHPIQREFYDFYRTPRGEYTPKGSSRELTTHPTLTSNVKFLNFYPFNDIETISPRPMLFITGDQAHSKEFSEEAYKLAGQPKELYYVKGAGHVDLYDRVDLIPFNKLTSFFKQNLK
>NZ_CP043180.1|WP_096640918.1|2420395_2420872_-|hypothetical-protein
MASYKFFKGLVSLCFLFSVTSASYAIKPQGKNQQRVSMMKIRIDIDGTQQPLFATLAITPTVEDFIKQLPLTLTLKDYDATEKISDLPTKLTTQNAPDGYAGKAGDLTYYAPWGNLAFFYKDSAVGYANGLIFLGKLDAIPHAFKQKQPIKISISQIE
>NZ_CP043180.1|WP_000608481.1|2421157_2422048_+|LysR-family-transcriptional-regulator
MINKENYNDLYAFLMVAREGSFTKAAGKMGISQSALSHTIRGLEERLGMLLLTRTTRSVSPTAAGERLKQTISASFDQIDNELSLLTSFRDQPAGTVRINASSHAIREVLIPKLKKIAGDYPDVQVEVTAYSGMVDIVAERFDAGVRFGSRVADGMIAVRISPDVKMAVIATPAYFEQYGIPHTPKDLINHQCIGYRLTTQGSVYAWEFVKDGQETKVKIQGQWIFNESYEIAQAVRAGFGLAYIPEDLIREDLKEGKLIQVLAEYSIQFPGYHLYYPHRRQLSPALRLVIDVLRE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043180_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043180_4

3020354-3020503

Orphan

Consensus_repeat	Method
AGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043180_4

>merge|NZ_CP043180|4|3020354-3020503|CRISPRCasFinder
AGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACCATGTTCATCTTGCGCTTCGCCAAAGCTTTAGTCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAAC

>NZ_CP043180|4|4|3020354-3020503|CRISPRCasFinder
AGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAAC	CATGTTCATCTTGCGCTTCGCCAAAGCTTTAGTCGCTTTGTCTTGCTC
AGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATATAAATTAACCATAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043180.1\|WP_000955082.1\|3019104_3019431_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000156920.1\|3021290_3021722_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341391
NZ_CP043180.1\|WP_000121842.1\|3023596_3023920_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000954523.1\|3024163_3025066_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176162
NZ_CP043180.1\|WP_001202778.1\|3025118_3025913_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP043180.1\|WP_000616034.1\|3020106_3020340_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000949688.1\|3028437_3028683_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000102943.1\|3017105_3017702_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP043180.1\|WP_096639929.1\|3016210_3016882_-\|DUF2057-domain-containing-protein	unknown	unknown	gnl\|CDD\|378258
NZ_CP043180.1\|WP_077163451.1\|3020817_3021150_+\|DUF2750-domain-containing-protein	unknown	unknown	gnl\|CDD\|378546
NZ_CP043180.1\|WP_000138830.1\|3023208_3023550_+\|Grx4-family-monothiol-glutaredoxin	unknown	unknown	gnl\|CDD\|188046
NZ_CP043180.1\|WP_085916945.1\|3015301_3015601_+\|cyd-operon-YbgE-family-protein	unknown	unknown	gnl\|CDD\|370577
NZ_CP043180.1\|WP_096639930.1\|3021772_3022981_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235056
NZ_CP043180.1\|WP_000838063.1\|3027758_3028178_+\|heme-binding-protein	unknown	unknown	gnl\|CDD\|225734
NZ_CP043180.1\|WP_096639927.1\|3014040_3015186_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
NZ_CP043180.1\|WP_001187345.1\|3017890_3018997_-\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP043180.1\|WP_000185571.1\|3019531_3019891_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043180.1\|WP_000270276.1\|3015199_3015301_+\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|369733
NZ_CP043180.1\|WP_148746056.1\|3015613_3016138_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP043180.1\|WP_001186685.1\|3026265_3027567_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	unknown	unknown	gnl\|CDD\|185331

Protein	Function_ID	Function_description	E-value
NZ_CP043180.1\|WP_000156920.1\|3021290_3021722_+\|CBS-domain-containing-protein	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.93176e-56
NZ_CP043180.1\|WP_000954523.1\|3024163_3025066_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176162	cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.44498e-97
NZ_CP043180.1\|WP_001186685.1\|3026265_3027567_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	gnl\|CDD\|185331	PRK15433, PRK15433, branched-chain amino acid transporter carrier protein BrnQ.	7.47656e-171
NZ_CP043180.1\|WP_001202778.1\|3025118_3025913_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	5.65907e-151
NZ_CP043180.1\|WP_000102943.1\|3017105_3017702_-\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.21707e-108
NZ_CP043180.1\|WP_096639929.1\|3016210_3016882_-\|DUF2057-domain-containing-protein	gnl\|CDD\|378258	pfam09829, DUF2057, Uncharacterized protein conserved in bacteria (DUF2057). This domain, found in various prokaryotic proteins, has no known function.	2.33546e-28
NZ_CP043180.1\|WP_077163451.1\|3020817_3021150_+\|DUF2750-domain-containing-protein	gnl\|CDD\|378546	pfam11042, DUF2750, Protein of unknown function (DUF2750). This family is conserved in Proteobacteria. The function is not known.	1.42209e-20
NZ_CP043180.1\|WP_000138830.1\|3023208_3023550_+\|Grx4-family-monothiol-glutaredoxin	gnl\|CDD\|188046	TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. [Energy metabolism, Electron transport].	2.75898e-66
NZ_CP043180.1\|WP_085916945.1\|3015301_3015601_+\|cyd-operon-YbgE-family-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	3.65946e-19
NZ_CP043180.1\|WP_096639930.1\|3021772_3022981_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235056	PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.	0
NZ_CP043180.1\|WP_000838063.1\|3027758_3028178_+\|heme-binding-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	5.66012e-31
NZ_CP043180.1\|WP_096639927.1\|3014040_3015186_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	4.96399e-150
NZ_CP043180.1\|WP_001187345.1\|3017890_3018997_-\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	4.65167e-180
NZ_CP043180.1\|WP_000270276.1\|3015199_3015301_+\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|369733	pfam08173, YbgT_YccB, Membrane bound YbgT-like protein. This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in E. coli. Members have a consensus motif (MWYFXW) which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to Proteobacteria.	2.3152e-06
NZ_CP043180.1\|WP_148746056.1\|3015613_3016138_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.25955e-06

>NZ_CP043180.1|WP_000616034.1|3020106_3020340_+|hypothetical-protein
MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA
>NZ_CP043180.1|WP_000185571.1|3019531_3019891_-|hypothetical-protein
MTNTIDGFVFDNPPKEEQIIELAHYHRKLLDEAIFHQEIHLGDYCLAQRKRVFDYARQLDPNQKAWFYQVYDGELRKIADEDELHPADAEEGLSIFAMLLVLVIIAAILYFSVIRSLMG
>NZ_CP043180.1|WP_000955082.1|3019104_3019431_-|hypothetical-protein
MLTFKENFLKLKSELKADQCFNLVVIIIIGCIFMLSYLALLRPVNSEQYQRIVQLSRQATYPRTQDMAELIMAQSEIHRAEYLKLMHAYQFEHDHIKQYPALAQEDTQ
>NZ_CP043180.1|WP_001187345.1|3017890_3018997_-|signal-recognition-particle-docking-protein-FtsY
MQQQSNMQNKFLIDAEIGDDDVTLPNLPAIDVPIVESPVKQEVKAEEVVEASPSTEPEQPKSGFFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAALFETEK
>NZ_CP043180.1|WP_000102943.1|3017105_3017702_-|nitroreductase-family-protein
MSTFLDKIKNRRTIYAIGKNVALDRTKIEETIREAVKHSPSAFNSQSSRVVTLYGESHAKFWNLVREALRKIVPADAFAGTNAKIDSFVAGVGTVLFYEDQAVVKSLQEQFELYADNFPVWSEHSSAIAQFATWTALSELGLGASLQHYNPIVDADAAEAFDVPATWKLRAQLVFGSVEAPAGEKAFISDEDRFKTFN
>NZ_CP043180.1|WP_096639929.1|3016210_3016882_-|DUF2057-domain-containing-protein
MTLRLSVAAMGLLLSGSVFSAVTITAPEEIVILAVNGQEVNSGLFRSSKNNYKVDAGETSLSVRYQEYFEHLSGEHDIVKSGVVTIQTPALKDGQTYKLAMVDAPKQFEQAKKYAEQPTVALYNSNNELIVQQTGANNEARPWFASGLLGKVTDFTTKSSKQQPDAVYAAAKPTTTQAIAPVATTMPATGVAQTNDQRLAEIWKKSSKAERQKFMAWLAEQSN
>NZ_CP043180.1|WP_148746056.1|3015613_3016138_-|GNAT-family-N-acetyltransferase
MIKLNFRLAEFNDIPTLVELINQSYREQQGRSWTTEVEYVKGQRINKEQLKHQLELPNSVLLIGEIDSSKVVTCIGLTFQSNTVEIGTFCTDPHVQNMKIGRSVLEYAEQFALHKVPELDSAIMYVLNVRSELIAYYERRGYIKTGNHEPYPLDANVGLPLIPIKLIEMKKDLK
>NZ_CP043180.1|WP_085916945.1|3015301_3015601_+|cyd-operon-YbgE-family-protein
MMATAMTASNQRKAQAFAMAISFLLALPLAVILLVHPSLMLDANGHYNHSQLMLVMVGISGGFIYGVGFVPHFWLWKWLFSPWIAWPLMLLGYYIWFLT
>NZ_CP043180.1|WP_000270276.1|3015199_3015301_+|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGILMACFAGVLSALYIEHHQNLDEE
>NZ_CP043180.1|WP_096639927.1|3014040_3015186_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MIEYELLKIIWWVLVGVLLIGFALTDGFDMGSMALMPFVGKTDNERRAAINTIAPHWDGNQVWFITAGGALFAAWPMVYAVAFSGMYWALLLVLFALFLRPVGFDYRSKLENTQWRNSWDWGLCIGGAVPALVFGVAFGNLFLGIPFSLDSTLRSEYSGSFFALLNPFALICGIVSLSMLCAHGGAWLMLRTDGALKQRSAKATQIMAAIFLVCFLVIGAWLYFGQVPGYSYAAAVDPNAALNPLAKEVVTNNNLGWMNNYSSYPITTVAPALAILGAIIAFLTASKAKAGLSFAGTSLMIVGAILTAGFALFPFLLPSSVNPNSSLTMWDAVSSHRTLGVMTVAACIFVPIILIYTSWSYYKMWGVITNKHIESNSHSLY
>NZ_CP043180.1|WP_077163451.1|3020817_3021150_+|DUF2750-domain-containing-protein
MIKIYILRTMMYCGVLWGLFDEGWAIKSDQEDFIFPFWLNGVQAHRYAKTHWPNYKPRKITPKDFHESLLPTLTRLKVTPALFNSSHRKLKLSTQQMHHFFFNHPKWQVA
>NZ_CP043180.1|WP_000156920.1|3021290_3021722_+|CBS-domain-containing-protein
MTIVAQVIKNKSEQAIFTISPEATVLEAITIMAEKGIGALVVAEGEQVVGILSERDYTRKVTLMERSSYSTTVAEIMTAKVITVGLNNTVEECLQLMTDRHLRHLPVLDNGKLVGFISIGDLVKAAMEDQKVLIEQLKQYISG
>NZ_CP043180.1|WP_096639930.1|3021772_3022981_-|aspartate-aminotransferase-family-protein
MTDITLAPVQPDQPTHLMATYGRQAISFVRGRGAYLYTQDGTEYLDALTGIAVCGLGHAHPAIAEAIAEQAATLVHTSNLFEIPWQTAAAQKLAEVSGMEEIFFSNSGAESNEGAIKIARKFGTQQGISLPKIIVAEQSFHGRTLATLSATGNKKVQDGFAPLVEGFIRVPFGDIEAIQEAALQHPDIVAILIEPIQGEGGINTAPQGFSYLEEVRQICNQHNWLMMLDEIQTGNGRTGKYFAYQHTNIIPDVLTTAKGLGNGFPVGAVMTQGKAVGLLGPGSHGSTYGGTVLGSRVVYTVIDTIQKENAVENAAVVGNYIVDQLRAQLSDKNVQVRGFGMMIGVQLPKDCAELVAIARDEYKLIINVTAGSVVRLLPPINMTQAQADILLERLVALITNYL
>NZ_CP043180.1|WP_000138830.1|3023208_3023550_+|Grx4-family-monothiol-glutaredoxin
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
>NZ_CP043180.1|WP_000121842.1|3023596_3023920_-|hypothetical-protein
MSYQLVELENATANIICPICKLAVIDWTQEQYVQPCEHTVFIAMDLGFEFVADRFEEVMKQNVDELHEDPNMNIFDAITTTPYKNLSILKADLGVDGLFRYVGISDC
>NZ_CP043180.1|WP_000954523.1|3024163_3025066_+|LysR-family-transcriptional-regulator
MLTDLDDFYCFALVVEHGGFSAAERVTDIPKSKLSRRVYNLEENLGVRLIQRSSRHFAVTDIGMDIYRHAQVMMNAAQAAHDLVDHLSIQPRGVVKVSVPVDIAQNQLPKILPAFLKKYPEIRLQLIVSNRRVDVINEGIDIALRVRSKLDDDPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELSDHRILSLSEEHLDQQFILHGPDNQLKKVKVSPTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVEHLSEHP
>NZ_CP043180.1|WP_001202778.1|3025118_3025913_-|type-I-methionyl-aminopeptidase
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICTSVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHAVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELSDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI
>NZ_CP043180.1|WP_001186685.1|3026265_3027567_+|branched-chain-amino-acid-transport-system-II-carrier-protein
MQQLRTGDIIALGFMTFALFIGAGNIIFPPIVAQQAGDHVWLAAIGFLITAVGLPVITIMALSRMQGSIEIISSPLGRIASLILTVVCYLSVGPLFATPRTATVSYEIGFSSYFGTSSSSLLIYSAIYFAFVTVVSLYPNKLLDTVGHVLAPLKIIALAILGIAAVMIPAGYVPAPINHYVNSPVSEGFVNGYLTMDTLGALVFGIVIIQAIYSRGVTDNKLVTKYAIIASLISGVGLTLVYLSLFKLGLGSHEVAPNAANGAVILHAYVQHAFGNMGSLFLTGLIFLACMVTAIGLTCACAEYFAQLTKLPYKLLVFILVGFSFIISNLGLTKLIAVSVPVLSAIYPPAIVVIMLSFFWKFWHKPSFIVGSVTSIALIFGIIDGLKVAGFGDYLPNFLQHLPLNEQNLAWLIPSLVVLVVTTLIDKVKHKSI
>NZ_CP043180.1|WP_000838063.1|3027758_3028178_+|heme-binding-protein
MKSKYYLTLADAEFLMEEAQKYAIEHNFKVSIAIVDETSSLLLMKRLDGASPLTTHLCLEKAKCSSMSGRPSKFYEELLQNGRLGFLSMPSAKGMLEGGKAIIYEGQILGAIGVSGVQSFEDAEIAQHAIDVFLKKQSS
>NZ_CP043180.1|WP_000949688.1|3028437_3028683_+|hypothetical-protein
MLSLHFNKQVFINTLNSKDSVVYGVTTLALMLTLLFQGMIKGNLKPEYFMYAMVVSFVFCVWAFVDHKMRKLAKRRLSQQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1847718 : 1896778

Acinetobacter_phage(90.2%)

capsid,tail,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001292274.1\|1847718_1850148_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	8.4e-277	62.7
WP_096639814.1\|1850633_1851200_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_057094438.1\|1851459_1851801_+	hypothetical protein	NA	NA	NA	NA
WP_001166305.1\|1851908_1852022_+	hypothetical protein	NA	NA	NA	NA
WP_000088975.1\|1852830_1853094_-	hypothetical protein	NA	NA	NA	NA
WP_000004581.1\|1853094_1853817_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	1.7e-55	88.2
WP_148746094.1\|1853813_1854197_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	3.8e-06	46.4
WP_038346601.1\|1854199_1854445_-	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	7.4e-40	98.8
WP_148745980.1\|1854446_1855448_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.9e-106	64.6
WP_032057913.1\|1855462_1856230_-	hypothetical protein	NA	NA	NA	NA
WP_148745981.1\|1856241_1856565_-	hypothetical protein	A0A0P0IRC4	Acinetobacter_phage	1.5e-53	93.5
WP_148745982.1\|1856557_1856848_-	hypothetical protein	A0A0P0IDU2	Acinetobacter_phage	9.6e-47	92.7
WP_148745983.1\|1856847_1857291_-	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	9.2e-73	95.9
WP_140991205.1\|1857492_1858011_-	hypothetical protein	NA	NA	NA	NA
WP_148745984.1\|1858018_1859020_-	hypothetical protein	A0A0P0IRH5	Acinetobacter_phage	5.9e-51	37.2
WP_148745985.1\|1859084_1859774_-	helix-turn-helix domain-containing protein	A0A2H4JAJ5	uncultured_Caudovirales_phage	7.6e-58	73.1
WP_001217697.1\|1859901_1860078_+	hypothetical protein	NA	NA	NA	NA
WP_032000213.1\|1860074_1860338_+	hypothetical protein	NA	NA	NA	NA
WP_148745986.1\|1860520_1860844_+	hypothetical protein	NA	NA	NA	NA
WP_148745987.1\|1861117_1861366_+	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	1.4e-30	92.3
WP_148745988.1\|1861362_1861659_+	hypothetical protein	A0A0P0HSJ2	Acinetobacter_phage	5.8e-47	96.9
WP_148745989.1\|1861655_1862012_+	hypothetical protein	A0A0P0IVS7	Acinetobacter_phage	1.1e-55	96.6
WP_125276410.1\|1862011_1862941_+	YdaU family protein	A0A0P0I481	Acinetobacter_phage	2.4e-171	99.0
WP_023897136.1\|1862933_1863683_+	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	6.2e-138	99.6
WP_025469904.1\|1863679_1863793_+	putative phage replication protein	A0A0D4DCC7	Acinetobacter_phage	2.4e-09	83.8
WP_148745990.1\|1863789_1864188_+	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	8.0e-60	88.5
WP_001277128.1\|1864184_1864661_+	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
WP_000861102.1\|1864632_1864887_+	hypothetical protein	NA	NA	NA	NA
WP_148745991.1\|1865132_1865351_+	hypothetical protein	NA	NA	NA	NA
WP_001984397.1\|1865564_1866116_+	hypothetical protein	NA	NA	NA	NA
WP_148745992.1\|1866490_1866946_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	1.3e-82	97.4
WP_148745993.1\|1867006_1867474_+	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	8.8e-66	79.4
WP_148745994.1\|1867442_1868084_+	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	2.2e-120	94.4
WP_148745995.1\|1868142_1868658_+	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	7.7e-47	63.0
WP_148745996.1\|1868617_1869910_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	8.3e-215	86.3
WP_000301499.1\|1869949_1871290_+	DUF4055 domain-containing protein	A0A0P0IDW1	Acinetobacter_phage	1.2e-248	97.1
WP_148745997.1\|1871299_1872406_+\|capsid	minor capsid protein	A0A0P0IR98	Acinetobacter_phage	5.1e-189	89.4
WP_000965230.1\|1872415_1872844_+	hypothetical protein	A0A0D4DBV9	Acinetobacter_phage	7.3e-67	92.3
WP_148745998.1\|1872942_1873185_+	hypothetical protein	A0A0P0IY55	Acinetobacter_phage	3.1e-38	96.2
WP_001290162.1\|1873200_1873416_+	hypothetical protein	NA	NA	NA	NA
WP_148745999.1\|1873538_1874090_+	hypothetical protein	A0A2I7RHW2	Vibrio_phage	6.2e-18	68.4
WP_148746000.1\|1874177_1874969_+	hypothetical protein	A0A0P0J090	Acinetobacter_phage	1.9e-76	65.5
WP_096639734.1\|1874982_1875933_+	methyltransferase	A0A0P0HSG2	Acinetobacter_phage	1.4e-171	94.6
WP_000524488.1\|1875976_1876312_+	hypothetical protein	A0A0N7IRE4	Acinetobacter_phage	2.7e-53	100.0
WP_029423740.1\|1876315_1876696_+	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	9.1e-53	84.9
WP_096639733.1\|1876695_1877064_+	glutamate 5-kinase	A0A0P0I456	Acinetobacter_phage	1.4e-58	88.5
WP_004743760.1\|1877126_1877657_+	hypothetical protein	A0A0D4DCP9	Acinetobacter_phage	3.9e-70	71.0
WP_096639732.1\|1877708_1878116_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	4.8e-52	73.9
WP_096639812.1\|1878087_1878456_+	HK97 gp10 family phage protein	A0A0D4DBN1	Acinetobacter_phage	7.7e-57	86.9
WP_096639731.1\|1878457_1878856_+	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	2.3e-67	92.4
WP_096639730.1\|1878923_1879277_+	hypothetical protein	A0A0D4DCF7	Acinetobacter_phage	6.9e-55	91.5
WP_148746001.1\|1879278_1880691_+\|tail	phage tail protein	A0A0N7IRE5	Acinetobacter_phage	2.4e-66	38.9
WP_096639728.1\|1880743_1881661_+	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	4.0e-163	95.1
WP_025079739.1\|1881731_1882241_+	hypothetical protein	A0A0P0J095	Acinetobacter_phage	6.4e-62	83.8
WP_096639727.1\|1882742_1883036_+	DUF4258 domain-containing protein	A0A0P0IE58	Acinetobacter_phage	1.7e-38	83.5
WP_000274930.1\|1883050_1883509_+	helix-turn-helix domain-containing protein	A0A0P0IRJ4	Acinetobacter_phage	3.5e-75	88.2
WP_148746002.1\|1883612_1884122_+	hypothetical protein	A0A0S0N7I7	Pseudomonas_phage	8.8e-19	34.9
WP_148746003.1\|1884192_1889181_+	tape measure protein	A0A220VZA0	Acinetobacter_phage	0.0e+00	95.6
WP_031993486.1\|1889271_1889859_+	hypothetical protein	NA	NA	NA	NA
WP_148746004.1\|1889894_1890371_+	hypothetical protein	NA	NA	NA	NA
WP_118979151.1\|1890431_1890830_+	hypothetical protein	J7I0X8	Acinetobacter_phage	4.5e-71	97.0
WP_065708837.1\|1890829_1891336_+	DUF1833 family protein	A0A0P0IKN4	Acinetobacter_phage	1.9e-90	95.8
WP_101427496.1\|1891332_1891695_+	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	5.8e-57	88.3
WP_148746005.1\|1891687_1895125_+	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	92.8
WP_000433923.1\|1895199_1895589_+	hypothetical protein	J7I481	Acinetobacter_phage	4.3e-66	99.2
WP_001076396.1\|1895951_1896134_+	hypothetical protein	NA	NA	NA	NA
WP_031977123.1\|1896232_1896778_+	N-acetylmuramidase	A0A0B5KTG2	Acinetobacter_phage	1.8e-94	93.9

DBSCAN-SWA_2

3112991 : 3160953

Acinetobacter_phage(91.84%)

capsid,integrase,holin,tail

attL 3133521:3133538|attR 3168967:3168984

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148746061.1\|3112991_3114290_+	DUF4113 domain-containing protein	A0A2H4JBL5	uncultured_Caudovirales_phage	1.8e-161	62.8
WP_118978914.1\|3114333_3114741_+	hypothetical protein	NA	NA	NA	NA
WP_118978915.1\|3114742_3115003_+	hypothetical protein	NA	NA	NA	NA
WP_118978916.1\|3115215_3115761_-	N-acetylmuramidase	A0A0P0IW03	Acinetobacter_phage	3.5e-98	97.8
WP_000200152.1\|3115818_3116043_-	hypothetical protein	NA	NA	NA	NA
WP_001014418.1\|3116023_3116317_-\|holin	holin	NA	NA	NA	NA
WP_148746062.1\|3116386_3119824_-	hypothetical protein	A0A0P0HSH9	Acinetobacter_phage	0.0e+00	94.4
WP_118978802.1\|3119816_3120179_-	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	3.7e-56	85.8
WP_118978801.1\|3120175_3120682_-	DUF1833 family protein	A0A0P0IKN4	Acinetobacter_phage	2.1e-89	94.6
WP_118978800.1\|3120681_3121080_-	hypothetical protein	J7I0X8	Acinetobacter_phage	7.0e-72	97.0
WP_171490958.1\|3121144_3121306_-	hypothetical protein	NA	NA	NA	NA
WP_148746063.1\|3121616_3127106_-	tape measure protein	J7I4Q7	Acinetobacter_phage	0.0e+00	72.1
WP_118978787.1\|3127175_3127685_-	hypothetical protein	A0A0S0N7I7	Pseudomonas_phage	1.9e-21	38.6
WP_118978790.1\|3127882_3129193_-	DUF4325 domain-containing protein	NA	NA	NA	NA
WP_148746064.1\|3129367_3129685_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	5.3e-22	57.5
WP_148746100.1\|3129612_3130122_-	hypothetical protein	A0A0D4DBX8	Acinetobacter_phage	1.3e-62	83.3
WP_058062021.1\|3130192_3131110_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.6e-164	95.7
WP_148746065.1\|3131206_3132193_-\|tail	phage tail protein	A0A0D4DCQ4	Acinetobacter_phage	2.7e-88	48.6
WP_118978783.1\|3132192_3132543_-	hypothetical protein	J7I469	Acinetobacter_phage	4.3e-49	85.5
WP_024433193.1\|3132611_3133010_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	2.7e-68	93.9
WP_118978788.1\|3133011_3133380_-	HK97 gp10 family phage protein	A0A0D4DBN1	Acinetobacter_phage	3.1e-58	90.2
WP_118978781.1\|3133351_3133756_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	6.7e-62	86.5
3133521:3133538	attL	NA	NA	NA	NA
WP_118978780.1\|3133819_3134482_-	hypothetical protein	NA	NA	NA	NA
WP_118978779.1\|3134519_3134888_-	glutamate 5-kinase	A0A0P0I456	Acinetobacter_phage	2.7e-62	95.1
WP_106440306.1\|3134887_3135268_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	1.0e-51	82.5
WP_148746066.1\|3135271_3135607_-	HeH/LEM domain protein	A0A0N7IRE4	Acinetobacter_phage	3.0e-52	98.2
WP_148746067.1\|3135650_3136601_-	methyltransferase	A0A0P0HSG2	Acinetobacter_phage	4.9e-172	94.9
WP_032048608.1\|3136614_3137406_-	hypothetical protein	A0A0P0J090	Acinetobacter_phage	1.3e-90	73.4
WP_000589038.1\|3137493_3137808_-	hypothetical protein	A0A0S3UFT8	Pseudomonas_phage	5.2e-14	50.5
WP_001291453.1\|3137859_3138012_-	hypothetical protein	NA	NA	NA	NA
WP_000004552.1\|3138027_3138258_-	hypothetical protein	NA	NA	NA	NA
WP_017817021.1\|3138254_3139361_-\|capsid	minor capsid protein	A0A0P0IR98	Acinetobacter_phage	7.1e-191	90.8
WP_148746068.1\|3139370_3140714_-	DUF4055 domain-containing protein	A0A0P0IDW1	Acinetobacter_phage	3.5e-248	97.3
WP_002047119.1\|3140753_3142046_-	Terminase-like family protein	A0A1B1P9C9	Acinetobacter_phage	4.9e-215	86.3
WP_000729387.1\|3142005_3142521_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
WP_148746069.1\|3142579_3143221_-	hypothetical protein	J7I4N9	Acinetobacter_phage	8.2e-123	95.3
WP_148746070.1\|3143189_3143657_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	1.8e-55	70.3
WP_001039312.1\|3143710_3144055_-	hypothetical protein	NA	NA	NA	NA
WP_001017704.1\|3144980_3145199_-	hypothetical protein	NA	NA	NA	NA
WP_148746071.1\|3145259_3145670_-	hypothetical protein	NA	NA	NA	NA
WP_000508252.1\|3145865_3146630_-	hypothetical protein	A0A0P0IKQ5	Acinetobacter_phage	7.3e-86	91.8
WP_148746072.1\|3146712_3147213_-	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	6.5e-91	96.4
WP_000100164.1\|3147209_3147605_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	1.5e-66	96.2
WP_000462876.1\|3147604_3147997_-	hypothetical protein	J7HXM5	Acinetobacter_phage	1.2e-07	57.8
WP_000647822.1\|3147989_3148343_-	hypothetical protein	A0A0P0I8A5	Acinetobacter_phage	1.0e-29	55.6
WP_148746073.1\|3148339_3149140_-	hypothetical protein	A0A0P0IDV1	Acinetobacter_phage	1.4e-140	93.2
WP_148746074.1\|3149142_3150024_-	replication protein	A0A0P0IKQ2	Acinetobacter_phage	2.2e-134	93.2
WP_079344408.1\|3150016_3150241_-	hypothetical protein	A0A0P0I444	Acinetobacter_phage	1.9e-34	97.3
WP_148746075.1\|3150312_3150585_-	hypothetical protein	A0A0P0J0B9	Acinetobacter_phage	1.7e-40	96.7
WP_000041063.1\|3150773_3151130_-	hypothetical protein	J7I452	Acinetobacter_phage	8.8e-58	98.3
WP_000165919.1\|3151139_3151325_-	hypothetical protein	J7HXD2	Acinetobacter_phage	1.4e-27	98.4
WP_031978388.1\|3151402_3152167_+	LexA family transcriptional regulator	J7I4M9	Acinetobacter_phage	8.0e-141	98.0
WP_000370480.1\|3152181_3152358_+	hypothetical protein	A0A0P0IKK4	Acinetobacter_phage	1.2e-23	100.0
WP_003113565.1\|3152601_3153105_+	hypothetical protein	NA	NA	NA	NA
WP_002132644.1\|3153101_3153581_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_118978912.1\|3153591_3153954_+	hypothetical protein	NA	NA	NA	NA
WP_000845537.1\|3154085_3154289_+	hypothetical protein	A0A0P0IKZ8	Acinetobacter_phage	1.2e-27	100.0
WP_000051959.1\|3154295_3154538_-	hypothetical protein	A0A0P0I4B0	Acinetobacter_phage	8.9e-38	98.8
WP_148746076.1\|3154725_3155166_+	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	6.3e-74	97.9
WP_000181035.1\|3155168_3155492_+	hypothetical protein	A0A0P0IRC4	Acinetobacter_phage	3.9e-57	100.0
WP_148746077.1\|3155503_3156268_+	hypothetical protein	NA	NA	NA	NA
WP_148746078.1\|3156282_3157245_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	1.4e-129	75.0
WP_118978926.1\|3157244_3157541_+	hypothetical protein	NA	NA	NA	NA
WP_000910240.1\|3157541_3157811_+	DNA-binding protein	A0A0N7IRE8	Acinetobacter_phage	1.9e-41	96.6
WP_000365984.1\|3157948_3158560_+	hypothetical protein	NA	NA	NA	NA
WP_148746079.1\|3158596_3159679_+	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	1.2e-30	28.6
WP_118978931.1\|3159690_3160953_-\|integrase	integrase family protein	A0A0P0IKP2	Acinetobacter_phage	6.1e-247	99.0
3168967:3168984	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3500326 : 3515124

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171292996.1\|3500326_3500902_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	2.1e-109	99.0
WP_096640844.1\|3500998_3503698_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	98.3
WP_096640846.1\|3503777_3506510_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	98.4
WP_096640875.1\|3506865_3507915_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.7e-189	99.7
WP_096640848.1\|3507924_3508731_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	4.8e-144	98.1
WP_000066126.1\|3508740_3509436_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
WP_096640850.1\|3509446_3510430_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.6e-184	96.6
WP_096640852.1\|3510436_3512812_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	97.3
WP_096640854.1\|3512813_3514313_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	4.7e-278	97.0
WP_001187845.1\|3514575_3515124_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	5.1e-97	99.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043180

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection