CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP043308	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-1, complete sequence	0 crisprs	NA	0	0
NZ_CP043307	Acinetobacter johnsonii strain Acsw19 chromosome, complete genome	2 crisprs	cas3,DEDDh,WYL,csa3	1	9
NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	4 crisprs	NA	4	0
NZ_CP043309	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-2, complete sequence	0 crisprs	csa3	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043307_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043307_1

779305-779441

Orphan

Consensus_repeat	Method
CTCCAAGGTTTACAGGGTGAGCAAGGTATCCAAGGTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043307_1

>merge|NZ_CP043307|1|779305-779441|CRISPRCasFinder
GCCACTGGAGCACAAGGTGAACAAGGTCTCCAAGGTTTACAGGGTGAGCAAGGTATCCAAGGTGTAAAAGGTGATACTGGAGCACAAGGTGAGCAAGGCCTCCAAGGTTTACAGGGCGAGCAAGGTATCCAAGGTGT

>NZ_CP043307|1|1|779305-779441|CRISPRCasFinder
GCCACTGGAGCACAAGGTGAACAAGGTCTCCAAGGTTT	ACAGGGTGAGCAAGGTATCCAAGGTGTAAAAGGTGATACTGGAGCACAAGGTGAGCAAGGC
CTCCAAGGTTTACAGGGCGAGCAAGGTATCCAAGGTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043307.1\|WP_010327326.1\|786704_787259_+\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|223728
NZ_CP043307.1\|WP_148825622.1\|774590_776645_-\|recombinase	unknown	unknown	gnl\|CDD\|378408
NZ_CP043307.1\|WP_010327331.1\|780325_781024_+\|outer-membrane-lipoprotein-chaperone-LolA	unknown	unknown	gnl\|CDD\|178807
NZ_CP043307.1\|WP_148825621.1\|773832_774444_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP043307.1\|WP_010327329.1\|783416_784793_+\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|182606
NZ_CP043307.1\|WP_005400359.1\|767012_767450_-\|heavy-metal-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|376657
NZ_CP043307.1\|WP_010327328.1\|784825_785305_+\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297
NZ_CP043307.1\|WP_148825625.1\|787324_788719_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP043307.1\|WP_004695441.1\|778123_778435_+\|50S-ribosomal-protein-L21	unknown	unknown	gnl\|CDD\|235510
NZ_CP043307.1\|WP_004695457.1\|782068_783340_+\|serine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235461
NZ_CP043307.1\|WP_171522859.1\|785831_786614_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181335
NZ_CP043307.1\|WP_148825626.1\|788984_790169_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341487
NZ_CP043307.1\|WP_094148967.1\|767453_767810_-\|YbjQ-family-protein	unknown	unknown	gnl\|CDD\|376657
NZ_CP043307.1\|WP_148825619.1\|769370_772550_-\|multidrug-efflux-RND-transporter-permease-subunit-AdeJ	unknown	unknown	gnl\|CDD\|273335
NZ_CP043307.1\|WP_148827068.1\|781197_781968_+\|DUF3298-domain-containing-protein	unknown	unknown	gnl\|CDD\|378702
NZ_CP043307.1\|WP_010327336.1\|767913_769371_-\|multidrug-efflux-RND-transporter-AdeIJK-outer-membrane-channel-subunit-AdeK	unknown	unknown	gnl\|CDD\|224455
NZ_CP043307.1\|WP_148825623.1\|776678_777656_-\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|182813
NZ_CP043307.1\|WP_004695443.1\|778454_778709_+\|50S-ribosomal-protein-L27	unknown	unknown	gnl\|CDD\|235464
NZ_CP043307.1\|WP_004695464.1\|785329_785716_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP043307.1\|WP_148825620.1\|772562_773807_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|184990

Protein	Function_ID	Function_description	E-value
NZ_CP043307.1\|WP_010327326.1\|786704_787259_+\|flavodoxin-family-protein	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	2.62605e-24
NZ_CP043307.1\|WP_148825622.1\|774590_776645_-\|recombinase	gnl\|CDD\|378408	pfam10136, SpecificRecomb, Site-specific recombinase. Members of this family of bacterial proteins are found in various putative site-specific recombinase transmembrane proteins.	0
NZ_CP043307.1\|WP_010327331.1\|780325_781024_+\|outer-membrane-lipoprotein-chaperone-LolA	gnl\|CDD\|178807	PRK00031, lolA, outer membrane lipoprotein chaperone LolA.	2.59357e-53
NZ_CP043307.1\|WP_148825621.1\|773832_774444_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	1.14058e-35
NZ_CP043307.1\|WP_010327329.1\|783416_784793_+\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|182606	PRK10637, cysG, siroheme synthase CysG.	0
NZ_CP043307.1\|WP_005400359.1\|767012_767450_-\|heavy-metal-binding-domain-containing-protein	gnl\|CDD\|376657	pfam01906, YbjQ_1, Putative heavy-metal-binding. From comparative structural analysis, this family is likely to be a heavy-metal binding domain. The domain oligomerizes as a pentamer. The domain is about 100 amino acids long and is found in prokaryotes.	4.39838e-20
NZ_CP043307.1\|WP_010327328.1\|784825_785305_+\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	7.86285e-77
NZ_CP043307.1\|WP_148825625.1\|787324_788719_-\|amino-acid-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	4.54781e-43
NZ_CP043307.1\|WP_004695441.1\|778123_778435_+\|50S-ribosomal-protein-L21	gnl\|CDD\|235510	PRK05573, rplU, 50S ribosomal protein L21; Validated.	3.17007e-56
NZ_CP043307.1\|WP_004695457.1\|782068_783340_+\|serine--tRNA-ligase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
NZ_CP043307.1\|WP_171522859.1\|785831_786614_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|181335	PRK08264, PRK08264, SDR family oxidoreductase.	1.83637e-81
NZ_CP043307.1\|WP_148825626.1\|788984_790169_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341487	cd14865, Fe-ADH-like, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains iron-containing alcohol dehydrogenase (Fe-ADH) which catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is a member of the iron-activated alcohol dehydrogenase-like family. It is distinct from other alcohol dehydrogenases which contains different protein domains. Proteins of this family have not been characterized.	0
NZ_CP043307.1\|WP_094148967.1\|767453_767810_-\|YbjQ-family-protein	gnl\|CDD\|376657	pfam01906, YbjQ_1, Putative heavy-metal-binding. From comparative structural analysis, this family is likely to be a heavy-metal binding domain. The domain oligomerizes as a pentamer. The domain is about 100 amino acids long and is found in prokaryotes.	3.71116e-50
NZ_CP043307.1\|WP_148825619.1\|769370_772550_-\|multidrug-efflux-RND-transporter-permease-subunit-AdeJ	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP043307.1\|WP_148827068.1\|781197_781968_+\|DUF3298-domain-containing-protein	gnl\|CDD\|378702	pfam11738, DUF3298, Protein of unknown function (DUF3298). This family of bacterial protein C-terminal regions is highly conserved but the function is not known. Several members are annotated as being endo-1,4-beta-xylanase-like, but this could not be confirmed, and the structure can be defined as a heat-shock cognate 70kd protein 44kd ATPase.	4.11911e-08
NZ_CP043307.1\|WP_010327336.1\|767913_769371_-\|multidrug-efflux-RND-transporter-AdeIJK-outer-membrane-channel-subunit-AdeK	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	2.20224e-99
NZ_CP043307.1\|WP_148825623.1\|776678_777656_-\|polyprenyl-synthetase-family-protein	gnl\|CDD\|182813	PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional.	2.8807e-104
NZ_CP043307.1\|WP_004695443.1\|778454_778709_+\|50S-ribosomal-protein-L27	gnl\|CDD\|235464	PRK05435, rpmA, 50S ribosomal protein L27; Validated.	4.79713e-51
NZ_CP043307.1\|WP_004695464.1\|785329_785716_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	5.12317e-29
NZ_CP043307.1\|WP_148825620.1\|772562_773807_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|184990	PRK15030, PRK15030, multidrug efflux RND transporter periplasmic adaptor subunit AcrA.	3.11821e-98

>NZ_CP043307.1|WP_004695443.1|778454_778709_+|50S-ribosomal-protein-L27
MATKKAGGSTKNGRDSNPKMLGVKIYGGQSVTAGNIIVRQRGTEFHAGQNVGMGRDHTLFATADGVVKFEVKGQFGRRYVTVEA
>NZ_CP043307.1|WP_004695441.1|778123_778435_+|50S-ribosomal-protein-L21
MYAVIQSGGKQHRVVEGETLKVELLKAETGATITFDDVLMLVNGDSIQIGAPVVAGATVTAEVVSHGRHDKIRIVKMRRRKHYRKQQGHRQWFTELKITAISG
>NZ_CP043307.1|WP_148825623.1|776678_777656_-|polyprenyl-synthetase-family-protein
MTIDFKQDILAPVAQDFATMDTFINEGITSKVALVMAVSKHVVEAGGKRMRPIMCLLAAKACGAEDLERQRKLAAIIEMLHTATLVHDDVVDESGLRRGRPTANATWNNQTAVLVGDFLISRAFDLLVDLGDMTLLKDFSTGTCEIAEGEVLQLQAQHQPETTEQTYLDIIHGKTSRLFELATEGAAILSGTPQYREPLRLFAGHFGNAFQIIDDILDYTSDAETLGKNIGDDLMEGKPTLPLISALKNTTGEEHNIVRRSIATGGTTDLDQVIAIVNSSGALDYCRQRAHEETEAALQALQALPDSQYRQALVNLTQLALHRIQ
>NZ_CP043307.1|WP_148825622.1|774590_776645_-|recombinase
MHIKFNDLFSQMQQQLEQPQAVLNDQLLIELVERIRPIDAYQTDEIHQKFQALIQALLITPDAASTLQSFVLRLISQYKQTSLYADTGILSLDGFWNQLSQRLGAHFLPLINDETQLQDLVRRVFPNRSDKYWLDNIRDSDWLQLLNLLNHGHANQKEKVKIRSEVIKAITVLSYRISGIGLYPEFINAHPELTEYESPFLVQNREIIEFIQQYKKAHQEAETSSVVAPPDASQALVMIEQCRDVVLKIRRATKRIGVSVSLTYLISLLEQCLDRVELLLNLIVEEGEAHYEAVSLLLVDITAAIYSERSVRSLLTTNSELIALQVTENASKTGEHYVSTDKQGFLAMYKSAAGAGVIIATMATLKILSARMIMAPLMQAFVYSMNYSLGFMLIHVLHFTVATKQPAMTAAALAATVQQRKGSKTAQIAELAALIINIIRTQFIAILGNISIAIPVAAFITWAWATGMHEPLLNHAKAAKVLHDLNPFTSLAIPHAAIAGVCLFLSGLLAGYFDNMAVYRKVGPRLKAHPRLKKIMGQERLDKFAGYIERNLGALAGNFLFGIMLGSMGTIGYILGLPLDIRHIAFASANFIQGLMNINGSPEIGLIIVSFLGVLAIGLTNLFVSFTLTIIVALRARRVRFEQWKPLAKLVLTHFLTRPSDFFWPPKVPLEVEESSNNTKHHTK
>NZ_CP043307.1|WP_148825621.1|773832_774444_-|phosphatase-PAP2-family-protein
MPYLLLFIGIILFIISVLALSIQPLTALDLAMVEYFSTLRTEPIDKLAILLSALGGMPFVLFLTTLWCFHRAWYKKYRDVVFIGLGVVGSIASAWLLKFLISRPRPPEMFHLVTSYGASFPSAHSMYAATLACLAIFLSRPFPAHRYVVCIALLWMLMMGISRVYLGVHFPSDVLAGWSISIIWISLLYILCGRYTQLNTNYF
>NZ_CP043307.1|WP_148825620.1|772562_773807_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MMSAKLWAPALTACALATSIALVGCSKDPKDAQQAGASQQMPPTEVGVIVAQPQNVEQSVELSGRTTAFEISEVRPQTSGIILKRLFAEGSYVREGQALYELDSRTNRATFDNAKAALLQQEANLSTLRTKLNRYQQLVSSNAVAKQDYDDLVGQVNVAEAQVAAARAQVKNAEVDLGYSTIRSPISGQTNRSTVTAGALVTANQTEPLVTIQRLDPIYVDINQSSSELLRLRQQLSKGSLDSSNNTRVKLKLEDGSDYPVEGRLAFSDASVNPDTGTVTIRAVFPNPNHLLLPGMFANAQIVQGVIPNAMLVPQIAVTRTPTGQAMAMIVNDKGVVEPRQITTVGIQGQDWIVTEGLKTGEKVIVDGIAKVKAEQKVVAKPYQPQAAAPQAPTTDAKKTEAGAKTEQKATSNA
>NZ_CP043307.1|WP_148825619.1|769370_772550_-|multidrug-efflux-RND-transporter-permease-subunit-AdeJ
MAQFFIHRPIFAWVIALVIMLAGILTLTKMPVAQYPTISPPSVTISATYPGASAQTVENTVTQIIEQQMNGLDGLRYISSNSAGNGQASINLNFEQGIDPDIAQVQVQNKLQSATALLPEDVQRQGLKVTKSGASFMQVLAFYSPDGSLSAADIKDYVNSNISEPLSRVAGVGEVQVFGGSYAMRIWLDPAKMTSLQITPSDVATAINAQNSQVAVGQLGGAPSVQGQVLNATVNAQSMLQTPEQFRNIFLKNTASGAQVRLGDVARVELGSDNYQFDSKFNGKAAGGVAIKLATGANALDTAAAVEKRLSELRKNYPNGLKDQLAYDTTPFIKLSIESVVHTLIEAVVLVFIVMFLFLQNWRATIIPTLAVPVVVLGTFAVINIFGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMQEEHLDPVAATEKSMQQISGALVGITSVLTAVFVPMAFFAGTTGVIYRQFSITLVTAMILSLIVALTFTPALCATLLKQHDPNKAESNNIFARFFRWFNSSFEKLSVKYQGGVNRMTHHKVFSGVVYLLVIAGLVGLYKALPSSFLPDEDQGVVMTLVQLPPSASLERTDKVITTMTDYFMNKEKEHVESIFTVSGFSFTGVGQNAGLAFIKLKDWSERTTPESQIGAIIQRGMALNMIVKDASYIMPLQLPAMPELGVSAGFDIQLKDASGQGHEKLIAARNAILGMAAQDKRLTGVRPNGQEDTPQYQISIDQAQAGAMGVSIADINTTMSMAWGGSYINDFVDRGRVKKVYVQGEANARMMPEDLNKWYVRNSSGTMVPFSAFATGEWTYGSPRLERYNGVSSVNIQGTPAPGVSSGDAMLAMEEIIGKLPSMGLQGFDYEWTGLSLEERDSGNQTAPLLVLSMLIVFLCLAALYESWSIPVSVLLVVPLGILGAFALTWLGMIIKGDPNLSFNIYFQVAIVAVIGLSAKNAILIVEFAKELQEQGEDLFDATLHAAKMRLRPIIMTTLAFGFGVLPLALSTGAGAGSQHSVGFGVLGGVISSTLLGIFFIPVFFVWIRSIFKYKPKKQNNQEQTS
>NZ_CP043307.1|WP_010327336.1|767913_769371_-|multidrug-efflux-RND-transporter-AdeIJK-outer-membrane-channel-subunit-AdeK
MQKVWSISGRSIAVSALALALTACQSMRGPEPVAQADIPTGYIGSTTGPSVAEQGYKDFFADQRLVQVIELALANNRDLRTATLNIQRAQQAYQISENNQLPTIGASGSVLRQDTLSSSKPMTTYNVGLGVTAYELDFWGRVRSLKDNALDSYLATQSARDATQISLIGQVAQAWLSYSFANANLKLADQTLKAQLESYNLNKKRFDVGIDSEVPVRQAQISVETARNDVANYKTQLAQAQNLLNLLVGQPVPANLLSPQPVKRITQSTALTAGLPSDLLNNRPDVRAAEYQLSAAGANIGAAKAQLYPTISLTGTAGYASTDLSDLFKSGAFVWSLGPSLDIPIFDWGTRRANVKISETDQKIALSDYEKTIQTAFREVNDALAVRENIGDRLAAQRRLVDATNTTYKLSTARFRAGIDNYLTVLDAQRTSYSAEQGLLLLEQANLNNQVEVYKTLGGGVKANTTDQVVKQPSSSDVKYNKTAN
>NZ_CP043307.1|WP_094148967.1|767453_767810_-|YbjQ-family-protein
MLLSNLESVPGHRISQQLDVVYGSTVRSKHVGRDFLAGLKNIVGGELTAYTELLEESRQEAMNRMIAKAQGLGANAIVGIRFSTSNIAQGASELFVYGTAVRVTPLDNHLPDPFPTQA
>NZ_CP043307.1|WP_005400359.1|767012_767450_-|heavy-metal-binding-domain-containing-protein
MESLVFQLLIFAVLFSVGFGFGRYNERKHLAELEQNEKRLAYITVGNLRKVSFEQSGHMISSNVVISHDYFKYVLATVQNFFGGRLTSYESVVDRARREAIVRLKLEAEKHGATHIACMRLATTEMGMQGGMVEVFAYGTAIQNP
>NZ_CP043307.1|WP_010327331.1|780325_781024_+|outer-membrane-lipoprotein-chaperone-LolA
MKMLRKTLCAMTVGVVTLGPVMSSTVFAAPVAASEQQATTSLVKQLSGIQSISSNFEQTTKVTNSSKAPKKQGLSAQHMNQTFKGVMKVERPGKFYWETTSPAKQTIVTSGKTVWIYDPDLQQAVRQTLDEQVANTPALLLSGNTEQIRKSYRITQPNQSKTYYTLYPKSDDGAFQSLTISFGAKNAPTLMILEDSLGQTTYVRFNNTKVNTNIPASTFNFTPPKGTDIIDQ
>NZ_CP043307.1|WP_148827068.1|781197_781968_+|DUF3298-domain-containing-protein
MILCTGLLSACQPQNDSNAAKSEETTKPAQVTQTLPLIEAKVRPLQLAHSIACDEEGCTQYQLYSLETNVPWINQYFDERMKKANPVAFESLKQSKPQIDENMLSETLSDVRYVAQRGKYADFVLMYYHYPARAAHGMYHNEYITLDLATKKRVALSDIVVDKTESQLLDALYGANSMWLSDHNISREQLKLTDNYYMSAKGVVFVYPLYELASYAEGMSELVLPYQQASGLIKAEYLPSFVDYAAEREKASKEKP
>NZ_CP043307.1|WP_004695457.1|782068_783340_+|serine--tRNA-ligase
MIDPKLLRNNIEAVNLALAKRGVQLNVEEWASLEARRKEIQSKTESLQAERNSGAKQVGQIKKAGGDASEIMTRMSAIGDEIKAAEVALSELQAELEAKSLSIPNLPDESVPEGKDESDNVEILTWGTPRTFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRAITQFMLNTHTLENGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTNFVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPEDSMQALEELTGHAEGILKALGLPYRKIILCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGDFQARRMKARYRADQKKTEFVHTLNGSGLAVGRTLLAVMENYQRADGSIEIPTVLRPYMGGAEYID
>NZ_CP043307.1|WP_010327329.1|783416_784793_+|uroporphyrinogen-III-C-methyltransferase
MDIFPISLKLQQQPCLIVGGGHIAYRKAVLLHKAGALIHVIAPDIDANLLQLVEESQGQYIQALYPAQIQLNDYRLVIAATDDYAVNTQVFEDCEALKILVNSVDDPPHCRFMVPAIVDRSPLVISVASNGTSPVLSRQIRTQLETSIPHGMGKLAEFSGKWRAAVKAKISNPDERRVFWEDLYASPLKEQVFHDNLTEADSLIEQALAEWKTPKGEVYLVGAGPGDPELLTLKALRLMQQADVVIYDRLVSPAIMELCRRDATKIYVGKARSNHAVPQEGINALLVEYASKGQRVCRLKGGDPFIFGRGGEEIQELFAAGVPFQVVPGITAASGCSAYAGIPLTHRDYAQSVRFLTGHLKEGSPELPWDELVYQNQTLVLYMGLVGLEKICEKLIEHGQRPDMPVALISKGTTLEQKVLVGTLADIASKVEENHIQAPTLTIIGDVVSLREQLQWQD
>NZ_CP043307.1|WP_010327328.1|784825_785305_+|tRNA-(cytidine(34)-2'-O)-methyltransferase
MIHVVLYEPEIPANTGNIIRLCANTGAQLHLVKPLGFELDDKKLKRAGLDYHEWARMQIWETFDECLANLAEKGVDINAIYPLTTKGTETPHTSDLNRPVALLMGPETRGLPEQVRMLFPKEHWIRLPMAENSRSLNLSNATAVIVYEAWRQQGFKPLA
>NZ_CP043307.1|WP_004695464.1|785329_785716_-|helix-turn-helix-transcriptional-regulator
MNKPMKFNIFHPDCPARLFFEKFADKWILLIVYTLDQESQHFNELKKNVLGISPKVLSQKLKILERDGFLTRTIHEDNVIRVEYALTEIGKDFAQNAYQMKDWVEANMLKVLKSRAGFDQKLEKTEPA
>NZ_CP043307.1|WP_171522859.1|785831_786614_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQRCHQTTLSQDTGNWMDHIMKVSEAVVFITGGNRGLGLAMAREARRQGAKKIYVGMRQIGSFQEEGLTPIQLDVNDKASIQQAAEQCADTTILVNNAGIALLNEHPVDASIITTTQKILETNLLGLMWVTQIFVPILQKNQQAYVVNILSDVSWEPSTVLTSYAISKAAAWSYTNSSRQWLSQFNIQVMGVHVGFIDTDLTRSLPIPKIASETVAQEIFQGIEQNAYEVLVGEKTQQLKQGLSAEVASYVKLKPDQASV
>NZ_CP043307.1|WP_010327326.1|786704_787259_+|flavodoxin-family-protein
MSNISVVFYSGYGHTKVIAQTFAQEIGANLVEIDPNGDISEQNWQTLDQSDAIVFGAPTYMGTAPWQFKKFADASSKKWFTRAWQDKIFGGFTNSASLNGDKQVTLIQLQTLASQHGGIWVSLGLLPANSKAATRQDVNNLGGSVGLLVQSPSDASTDEIPAGDLETTKAYAQRIAKMTKQFKG
>NZ_CP043307.1|WP_148825625.1|787324_788719_-|amino-acid-permease
MTNISGTQSAAKLQKTLGLWHIIIIGLAYIQPMTLFDTFGLVSEESHYHVPTSYIIALIAILFTSISYGHMIRRYPSSGSAYTYAQKSIHPNVGFMVGWSSWLDYLLSPMVNIILAVIYLEALFPDVNHWVWVVGLTAFMTAINLRGARFVANFNGLIVFVQLGVIAYFTWMVYSLLAGGVNADGTLVNAKYQLWSLEPFWNELTSLGALITGATLLCFSFTGFDSLSSLAEETKDTEKTLPKAIFLTALLAGVIFIISTYFMQIYFPNDPKTYFEDVAATQPDILQAVGGVAFKTVVLYFAIVTVMASGISAHAGVSRLMYVMGRDGVINKKIFGHISPKSFTPSYNILIVGAVALTAGFMDLDIVISMISFGALTAFTFVNLSVISRYALRDGRTKNIKDILSFVIIPMCGFLSIFAMWLEIEETALKFGLWWAMFGILYLGYKTKGFKQPAPQHNEFDDPL
>NZ_CP043307.1|WP_148825626.1|788984_790169_-|iron-containing-alcohol-dehydrogenase
MAKPYYEFFCPVKVIAGHAALEHIPFELATLGATRPLIITDKGVRANNLLAPIEAAFESTDAVIGAIFDDVPPDSSLETVRKAANLYREHQCDAIIAVGGGSVIDTSKATNILVSEGGDDLLKYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDPEKNVKLPFASYYLMPHAAILDPRMTQTLPPHLTAMTAMDAMTHAIEAYTCMAHNPISDAYATAAIKKVSNHLFNVLDNPNDANGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEFNKEVNGDKIAELLLPLAGPDIYAQTPAHLRADKAISTLLTMRDRLFTLTKLPRTLSETGKVTLEQLDEVAEKALNDGSIIYNPKEASLKDLKAILEKAW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043307_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043307_2

1301186-1301258

Orphan

Consensus_repeat	Method
CATTATGCAACATGTTGCATTAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043307_2

>merge|NZ_CP043307|2|1301186-1301258|CRISPRCasFinder
CATTATGCAACATGTTGCATTAAAAACAAATCTCGATTATAAAGATAAACATTATGCAACTTGTTGCATTAAA

>NZ_CP043307|2|2|1301186-1301258|CRISPRCasFinder
CATTATGCAACATGTTGCATTAAA	AACAAATCTCGATTATAAAGATAAA
CATTATGCAACTTGTTGCATTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043307.1\|WP_148825870.1\|1308858_1310499_+\|CTP-synthase	unknown	unknown	gnl\|CDD\|235437
NZ_CP043307.1\|WP_148825862.1\|1290084_1290939_+\|3'(2'),5'-bisphosphate-nucleotidase-CysQ	unknown	unknown	gnl\|CDD\|238816
NZ_CP043307.1\|WP_148825867.1\|1305184_1306354_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NZ_CP043307.1\|WP_004696602.1\|1297022_1297289_-\|30S-ribosomal-protein-S20	unknown	unknown	gnl\|CDD\|178943
NZ_CP043307.1\|WP_148825229.1\|1295460_1296765_-\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|379017
NZ_CP043307.1\|WP_148825866.1\|1304030_1305107_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223506
NZ_CP043307.1\|WP_148825868.1\|1306362_1307169_-\|2,5-didehydrogluconate-reductase-DkgB	unknown	unknown	gnl\|CDD\|183012
NZ_CP043307.1\|WP_094148191.1\|1301319_1303344_+\|NADPH-dependent-2,4-dienoyl-CoA-reductase	unknown	unknown	gnl\|CDD\|239240
NZ_CP043307.1\|WP_148825865.1\|1299675_1300587_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP043307.1\|WP_148825864.1\|1298738_1299518_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|239339
NZ_CP043307.1\|WP_004981883.1\|1303535_1303949_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP043307.1\|WP_094148196.1\|1311448_1312738_+\|phosphopyruvate-hydratase	unknown	unknown	gnl\|CDD\|234617
NZ_CP043307.1\|WP_094148194.1\|1307279_1308170_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176167
NZ_CP043307.1\|WP_062033117.1\|1298176_1298689_+\|ribonuclease-E-activity-regulator-RraA	unknown	unknown	gnl\|CDD\|236487
NZ_CP043307.1\|WP_058869883.1\|1300609_1301149_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378427
NZ_CP043307.1\|WP_148825869.1\|1308230_1308632_-\|internalin	unknown	unknown	gnl\|CDD\|237030
NZ_CP043307.1\|WP_005401052.1\|1310530_1311388_+\|3-deoxy-8-phosphooctulonate-synthase	unknown	unknown	gnl\|CDD\|235363
NZ_CP043307.1\|WP_148825863.1\|1297502_1298168_+\|nucleoside-diphosphate-sugar-epimerase	unknown	unknown	gnl\|CDD\|187560
NZ_CP043307.1\|WP_004696597.1\|1290993_1291725_+\|phosphoglycerate-mutase-family-protein	unknown	unknown	gnl\|CDD\|214859
NZ_CP043307.1\|WP_058951778.1\|1291865_1292306_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP043307.1\|WP_148825870.1\|1308858_1310499_+\|CTP-synthase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NZ_CP043307.1\|WP_148825862.1\|1290084_1290939_+\|3'(2'),5'-bisphosphate-nucleotidase-CysQ	gnl\|CDD\|238816	cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family. It has been proposed that CysQ helps control intracellular levels of PAPS, which is an intermediate in cysteine biosynthesis (a principal route of sulfur assimilation).	4.3685e-78
NZ_CP043307.1\|WP_148825867.1\|1305184_1306354_-\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	1.38112e-89
NZ_CP043307.1\|WP_004696602.1\|1297022_1297289_-\|30S-ribosomal-protein-S20	gnl\|CDD\|178943	PRK00239, rpsT, 30S ribosomal protein S20; Reviewed.	6.37939e-27
NZ_CP043307.1\|WP_148825229.1\|1295460_1296765_-\|IS4-family-transposase	gnl\|CDD\|379017	pfam13006, Nterm_IS4, Insertion element 4 transposase N-terminal. This family represents the N-terminal region of proteins carrying the transposase enzyme, DDE_Tnp_1 (that was Transposase_11), pfam01609, at the C-terminus. The full-length members are Insertion Element 4, IS4. Within the collection of E.coli strains, ECOR, the number of IS4 elements varies from zero to 14, with an average of 5 copies/strain.	6.22827e-28
NZ_CP043307.1\|WP_148825866.1\|1304030_1305107_+\|alpha/beta-hydrolase	gnl\|CDD\|223506	COG0429, COG0429, Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only].	3.45012e-37
NZ_CP043307.1\|WP_148825868.1\|1306362_1307169_-\|2,5-didehydrogluconate-reductase-DkgB	gnl\|CDD\|183012	PRK11172, dkgB, 2,5-didehydrogluconate reductase DkgB.	3.43195e-173
NZ_CP043307.1\|WP_094148191.1\|1301319_1303344_+\|NADPH-dependent-2,4-dienoyl-CoA-reductase	gnl\|CDD\|239240	cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provides a hydrid ion to the C5 atom of substrate, and Tyr and His are proposed to form a catalytic dyad that protonates the C4 atom of the substrate and completes the reaction.	0
NZ_CP043307.1\|WP_148825865.1\|1299675_1300587_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	7.07801e-24
NZ_CP043307.1\|WP_148825864.1\|1298738_1299518_+\|glutathione-S-transferase-N-terminal-domain-containing-protein	gnl\|CDD\|239339	cd03041, GST_N_2GST_N, GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.	1.16237e-36
NZ_CP043307.1\|WP_094148196.1\|1311448_1312738_+\|phosphopyruvate-hydratase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
NZ_CP043307.1\|WP_094148194.1\|1307279_1308170_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176167	cd08478, PBP2_CrgA, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.8704e-100
NZ_CP043307.1\|WP_062033117.1\|1298176_1298689_+\|ribonuclease-E-activity-regulator-RraA	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	2.03859e-90
NZ_CP043307.1\|WP_004981883.1\|1303535_1303949_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	3.25079e-05
NZ_CP043307.1\|WP_148825869.1\|1308230_1308632_-\|internalin	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	9.39855e-05
NZ_CP043307.1\|WP_005401052.1\|1310530_1311388_+\|3-deoxy-8-phosphooctulonate-synthase	gnl\|CDD\|235363	PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional.	0
NZ_CP043307.1\|WP_148825863.1\|1297502_1298168_+\|nucleoside-diphosphate-sugar-epimerase	gnl\|CDD\|187560	cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs. Atypical SDRs in this subgroup include CC3 (also known as TIP30) which is implicated in tumor suppression. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine rich NAD(P)-binding motif that resembles the extended SDRs, and have an active site triad of the SDRs (YXXXK and upstream Ser), although the upstream Asn of the usual SDR active site is substituted with Asp. For CC3, the Tyr of the triad is displaced compared to the usual SDRs and the protein is monomeric, both these observations suggest that the usual SDR catalytic activity is not present. NADP appears to serve an important role as a ligand, and may be important in the interaction with other macromolecules. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.12137e-50
NZ_CP043307.1\|WP_004696597.1\|1290993_1291725_+\|phosphoglycerate-mutase-family-protein	gnl\|CDD\|214859	smart00855, PGAM, Phosphoglycerate mutase family. Phosphoglycerate mutase (PGAM) and bisphosphoglycerate mutase (BPGM) are structurally related enzymes that catalyse reactions involving the transfer of phospho groups between the three carbon atoms of phosphoglycerate... Both enzymes can catalyse three different reactions with different specificities, the isomerization of 2-phosphoglycerate (2-PGA) to 3-phosphoglycerate (3-PGA) with 2,3-diphosphoglycerate (2,3-DPG) as the primer of the reaction, the synthesis of 2,3-DPG from 1,3-DPG with 3-PGA as a primer and the degradation of 2,3-DPG to 3-PGA (phosphatase activity). In mammals, PGAM is a dimeric protein with two isoforms, the M (muscle) and B (brain) forms. In yeast, PGAM is a tetrameric protein.	1.56824e-06
NZ_CP043307.1\|WP_058869883.1\|1300609_1301149_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|378427	pfam10400, Vir_act_alpha_C, Virulence activator alpha C-term. This structure is homo-dimeric, and the domain here is the C-terminal half of the structure, often associated with PadR upstream, (pfam03551), which is a transcriptional regulator.	4.23133e-17

>NZ_CP043307.1|WP_058869883.1|1300609_1301149_-|PadR-family-transcriptional-regulator
MSLAHVLLTSLIEKPSTGIELARRFDRSMGFFWNATHQQIYRELSAMQSKGWISTIEDDGATSRKKTYQAEQLGRTELADWLVKQSPPAQLREELMVRLRVEAQLGGNTVLPELERHLTLHKEKLQIYQSIFAKDFGHAEENDRTLYIHKMILQLGINLECGWIEWLETIIPALKNFEK
>NZ_CP043307.1|WP_148825865.1|1299675_1300587_-|alpha/beta-fold-hydrolase
MPHYLMPDGEKLYVREFGQGTPVLVLSGLGMQSWQWLPFLYQHRKKYRFYIPDWRGFGGSAQCKIPTLDAISSHWQDLNCFLNQYAYTAFHVIAYSMGATTAMHGMQYGRFQDHISSYLHIDQTPKISVDADWPHGLFAEKHADFKVILQNIADLLAQNAQYRLVSDLAASMRTELVKQWFAFIQLQATPSRTAALFQKAFQQPYLQKFMLPIQRLDYMAWYIQNYLDHQEDYRSALRQIDRPATFFIGEDSKLYPAQGQKLIASSVPHAKTVIFKKSGHTPLLSEPRKFSQEITRFLNATNI
>NZ_CP043307.1|WP_148825864.1|1298738_1299518_+|glutathione-S-transferase-N-terminal-domain-containing-protein
MVKHQIKVIQALFSGLAQGGRGVTGTPHPKQPEQPLKLYEFEGSPYCRRVREVLTLLNLDYEVYPCPKGGTKYRPLVKQLGGKTQFPFLLDENTDTKLYESEDIIHYLFEQYGRSGKAPKKYAHYPKTPYVAYVGTLVNGASGVWINKSIKDRVAPEQLLQLWGFEASPYTRVVRGLLTELELPFKFHNVPKERWQDQGPAVLRLKPGKYVPLAGGKREQVMQVMGRDIQVPYLVDPNTETALFESADIVAYLKQTYAA
>NZ_CP043307.1|WP_062033117.1|1298176_1298689_+|ribonuclease-E-activity-regulator-RraA
MVTTAFVTCDLLDDHPELDLQVVSPSMDGKFFRSYGARKTFGGEVVTVKCFEDNSRVKELLATDGTGKVLVVDGGASMRCALMGDLIAESAVKNHWNGVVIYGCVRDVDAIAELDLGVHALAAIPQKSNRKGVGEVDISLHFGGVTIQSGHYLYADNNGIVIAKEKLVDA
>NZ_CP043307.1|WP_148825863.1|1297502_1298168_+|nucleoside-diphosphate-sugar-epimerase
MTQNIEQAIVIGATGLVGINLIQQLQQLPSCSKILAVVRKHNVQLDHYDKVQQLELDDFLLLNHEDVQGYSHAFSCLGTTLKKAGSKEQFYAIDYVVNAHFAELFVLTKTHYVLISALGAQANSKVFYNRVKGELEETIRGLDLYKVSIMQPSLLIGQRNEDRMLEDIFQKAYTKLSHFIPKHFKYKPVTAEQVAHTMVEAAQTQTEKFEIYDNLRIQKTK
>NZ_CP043307.1|WP_004696602.1|1297022_1297289_-|30S-ribosomal-protein-S20
MANSAQAKKRARQNVKARKHNASLRSMVRTYIKRTVAAIAAGDYAVASEAYKTAVPVIDRMADKGIIHKNKAARHKSRLNAQVKALAN
>NZ_CP043307.1|WP_148825229.1|1295460_1296765_-|IS4-family-transposase
MNLSQNLDLTLKQTLPSLSQFSELIDLNWIEDCLDQTGKASIRKRKLPAEHVVWLVIGLALFRNQPIWYVVQQLQLVFGTAEYCVPSASVQARQRLGLEPMSALFSTLSQAWFKDSQQQYSNFHGLCVCAVDGVVWSMPHTEENFKHFGSSKGKTAAAPYPQVRATCLVNTNTHEMIDAQMGSMDQGELTLASQLKAPVRSITLFDRAYFSADFLVSWQSQAEESHWLMRAKDNLRYEVIHHNAAHDFQIKMPVSARAKKINPSLGDYWEARLIEVEYAGKIRCYITSLTDSKVYPFKDLAMLYIQRWEIEMCYREIKSDLQDARILRSKQPDLVYQELWGVFIAYNILRRQMRFIAEHAKVSPLRISFHVASMSIINILRHTPLESAGNLPKHLAQLFEQSKIFVLPEKRQRQCPRVVKIKAQKYPRKCQSIS
>NZ_CP043307.1|WP_058951778.1|1291865_1292306_-|hypothetical-protein
MINKFLPTLEKFQPTEQQYIEYFHAKGEKDILAKVISNMRGTAEIQASQGVDAWLGYGVYLPAIERIFALHQGETEAEFYDRTQYPADVVNAYTLSNHEIATLIAADKYNRIHQHSVAVNTSLWPLNDEGLSIDLLDFPNRLKAKI
>NZ_CP043307.1|WP_004696597.1|1290993_1291725_+|phosphoglycerate-mutase-family-protein
MALELLPPSMLKAIDLLPDAKTPVTLFTRHSIREVVTGQGLAGYDLQLTHQGRDLAEAWGSYLIDNTDRVIQHCISSPIQRCIDTAALMIQGADGQTLEPNTHRIEIIEQGLLVEPGSFVLDIKQAGPYFQRQGALGFINSFVNNALPGMKHPIHGVVDVLELIYNTHPNNPYGLSLAVSHDTILAAILAVISGRTIVTKEDWPKMMEGLFVWFEGDVFLESKLKWIWRGEMNELNIHEFQNL
>NZ_CP043307.1|WP_148825862.1|1290084_1290939_+|3'(2'),5'-bisphosphate-nucleotidase-CysQ
MFKPTTAPQDALILQLVPIVTQACEILRAEYQAYVAGGDFTVERKSDHSPVTQADYRVNQFITDALNNTFPHLPVLSEEGQHAHRQQWQSFWMLDPLDGTKEFLHQRPEFTINLSLIEGAHTTFAVLAIPCEQQIYFCPLQGQPLKYNIEKDVWSEYVPVENHSAVKVGLSQSSQSKPQYHVYLEQLEKLTPIQEYRAGSAYKFCMVLEDRVDIYPRFHPTSEWDTSAGQCLLERIGGGLVDFQGRPFVYNQRLSLLNGGFIAYRNNDMKKLALQALELMPSSA
>NZ_CP043307.1|WP_094148191.1|1301319_1303344_+|NADPH-dependent-2,4-dienoyl-CoA-reductase
MSNYPHLLAPLDLGFTTLKNRVLMGSMHVGLEEVEGGYDRMAAFYAERAAGGVGLIVTGGISPNDHGVTFHGGSKLDTLEEAEKHKVITQAVHDAGGKIALQILHTGRYSYQAENVAPSAIQAPINPVKPHALTSAEVNQTIADFVNCAKLSQVAGYDGVEIMGSEGYLINEFIAARTNHRDDEWGGSYENRIRFPIEIVKRTRAEVGENFIIIYRLSMLDLVEGGSTLEEVIQLAKEIEKAGATIINTGIGWHEARIPTIATKVPRAAFTWVTKKLKGSVQIPLVTSNRINTPEMAEHVLAQGDADMVSMARPMLADAEFVLKAEQGRSDEINTCIGCNQACLDQIFSMQIATCLVNPRACYETELIFKESAVKKNIAVIGAGPAGLSFATYAADRGHQVTVFDAASQIGGQFNIAKTIPGKEEFYETLRYFKRKIELQPNIKLVLNHTATYEELSAENYDDIVVATGVTPRELTIEGIDHPKVLSYIEVLRERKSVGKKVAIIGAGGIGFDTAEYLSHEGESGSLNPQKFYDEWGIDTSYAHVGGLKQPVLEQSDREIYLLQRKAKAVGASLGKTTGWIHRTGLKHRDVKMIAGASYDKIDDQGLHITVNDQPTVLEVDHVIICAGQESYTAMYDQLKADGKNVHLIGGAKEAGELDAKRAIRQGAELAATI
>NZ_CP043307.1|WP_004981883.1|1303535_1303949_+|nuclear-transport-factor-2-family-protein
MSLATTKQALVRWHDMVTTRDMSILNELLAEDVVFRSPVAFNPYPGKQVVFFILSNVIQVFENFTYHREFFTEDGLSVVLEFSANVGEKKLKGIDMIRFNEQGQIVDFEVMIRPKSGLEALAVQMGQRMAAFAPQAG
>NZ_CP043307.1|WP_148825866.1|1304030_1305107_+|alpha/beta-hydrolase
MNAVFSLLNQLSQTAWDRVTGAEQPKLYINPKGQIQETVGALTQLQEKYRPTPWLSNTHAHLLYFDVIRKRRIQLEYDHFDQLEMQDGGVTGIMWFGYDLPEATPTVVVMHTITGSPESMREVVRDLNRYTGWRVALCLRRGHADLPMPVPKMNLFGSTDDLREQIAFIQSTFPSSTLYAVGSSAGTGLLVRYLGEEGSQTPFKAAFALCPGYNTELGFVNVHPFYSKVMTKKLFKKFIFPYQQTWQETASVSQVLMTKTLAEFESSYYEMAGYVDYDSYKQATNPIYVFENVTIPLLILNAEDDPVCHIKNFEPYKDMIRQMPNIAVVTTKKGSHCGFYEGVLNTESWATKLIADFL
>NZ_CP043307.1|WP_148825867.1|1305184_1306354_-|MFS-transporter
MKINFPLLALAVGAFAIGTTEFSPMGFLPEIANDLSVSIPQAGLLISAYAVGVMIGAPLMTLWLTRFPKKTALILLMAIFTIGNVLATVAPDYMSLMGARLITSLNHGAFFGLGSVVAASVVPKDKQASAVAMMFMGLTIANIGGVPLATWLSQNTSWRMAFAAISILGIITMLALWKALPQDHDVVKPNVAKELRVLTRAPVVLALLTTVMSAGAMFALYTYIAPSLHVFMQASPQTITLMLVLTGIGFSIGNHLGGKFADLSLEKTLIGFLVLLMVMMLVFPVLAQTTVGAAIGLVIWGAAAFAVVPPLQMRVMSVAADAPGLASSVNIGAFNLGNALGAFAGATVLSMQLSYAAVSYAGAALSFMALILVLLQMKFGLSKKACEAV
>NZ_CP043307.1|WP_148825868.1|1306362_1307169_-|2,5-didehydrogluconate-reductase-DkgB
MNIVPQFGLGTFRLTGDTVIESVKTALEVGYRAVDTAQIYGNEAEVGQAIELSGINRQDLFLTTKIWTENFSAEKLIPSLKESLHKLKTDTVNLTLIHWPAPSTDVNITELMQNLLQAKQQGLTEHIGISNFNIELTQQAIESIGLENIATNQIELSPYLQNHQLVDFLQAQNIDVTSYMTLAYGKVLNDPVLMHIAQQHQVSTAQISLAWALQRGFAVIPSSTKREHLMSNLKAQEIQLSSEEMMEITQLDRNQREVSPEGLAPIWD
>NZ_CP043307.1|WP_094148194.1|1307279_1308170_+|LysR-family-transcriptional-regulator
MKSTIEELTAFVSIVDSGSIVKAAQQLDQTTSGVSRALQRLESKLNVTLLERTTRKLKLTYEGQQFLTKARKILLDLTEAEESLQNNDAEASGLIRIDSATPFVLHVIVPLIEEFMQRYPKIDIEITNHDQVIDLLEHKTDVAIRFGELADSSLHAKLLCKSRLYIVASPVYAQKHGLPKNAAELSSHTLLGFSQPAHLNTWPIQLEDEPLTIQAKIKCSNGETVRQLALQGAGIACLSRFMVEQDIQDGQFIALLEDQIQIKEQKIHAVYYQQNYVPKRIRLFIDFLAEKLKAYL
>NZ_CP043307.1|WP_148825869.1|1308230_1308632_-|internalin
MNKKLLICGAIAAGLLLTACVKKEAPQEDEQEQVEVVTTEQQQTVELQPLAASEPEIPAQVEVIREETPNTTTEIRRETPAPAPAAQPAPKAEAPKAEEKPTQARPSNTNPNTQTEDDAVAAAIAAATPALEN
>NZ_CP043307.1|WP_148825870.1|1308858_1310499_+|CTP-synthase
MTHFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRRAKMTKLNNFTSGRVYQDVLNKERRGDYLGGTVQVIPHITDNIKERVLRAGEGYDVAIVEIGGTVGDIESLPFMESVRQLMVELGHKRTMLMHLTLLPYIKSAAELKTKPTQHSVKELLSIGIQPDILICRTEYDVDADTTRKIALFTNVEARAVVVCKDARSIYQIPRTFYEQNVDDLICERFGFNDLPEADLTDWDNVVEALLNPEYTVRVAMVGKYVELPDAYKSVNEALLHAGIQNRVKVQIDYVNAEEIESQDVNEVLKDMDAILVPGGFGERGTEGKMQAIKFARENGVPFLGICLGMQLAVIEYARNVVGISDASSTEFNRSTKSPLIGLITEWLDERGEVQQRNVDSDLGGTMRLGAQKSELVEGTKTREVYGSADIIERHRHRYEMNNRFIPALEEAGMKISGYSPVQHLVETVEIPQHPWFIAVQFHPEFTSSPRDGHPLFASFIDAAKAQYKKAK
>NZ_CP043307.1|WP_005401052.1|1310530_1311388_+|3-deoxy-8-phosphooctulonate-synthase
MSQLKPQEIVRLGDIQMANHLPFVLFGGMNVLESKDLAFEIAETYVDICKRLEIPYVFKASFDKANRSSLNSFRGPGLEKGIEWLADIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTDAIINIKKAQFLAPHEMRHILHKCLEAGNDKLIICERGSAFGYNNLVVDMLGFDIMKEMNVPVFFDVTHALQTPGGRADSAGGRRAQITTLARAGMATGLAGLFLEAHPDPEKAKCDGPCALRMSQLEPFLAQLKELDTLVKGFKKLDTH
>NZ_CP043307.1|WP_094148196.1|1311448_1312738_+|phosphopyruvate-hydratase
MSQIVDIRAREILDSRGNPTIEADVILASGVVGRACAPSGASTGSREALELRDGDKARYLGKGVKTAVNNVNTIIRDALVGKSVFEQKDIDNTMIELDGTENKEKLGANATLAVSLAAARAAADEKKIPLFQYIADLRGQTILTMPVPMMNIINGGSHADNNVDIQEFMIEPVGFTSFSEALRAGAEIFHSLKSVLNKKGLNTAVGDEGGFAPNLRSNEEAITVILEAIGQTGYKAGSDIMLALDCASSEFYKNGQYILAGEGNKAFTSNQFSDYLAGLVNQYPIISIEDGLDESDWEGWSYLTSILGDKIQLVGDDLFVTNPKILQRGINEKVGNSILIKYNQIGTLTETLDAIYLAKENGYSTVISHRSGETEDSTIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEELTNAAYRGKAEFKGLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP043307_2	2.1\|1301210\|25\|NZ_CP043307\|CRISPRCasFinder	1301210-1301234	25	NZ_CP021332	Maritalea myrionectae strain HL2708#5 plasmid pHL2708Y3, complete sequence	138270-138294	4	0.84

1. spacer 2.1|1301210|25|NZ_CP043307|CRISPRCasFinder matches to NZ_CP021332 (Maritalea myrionectae strain HL2708#5 plasmid pHL2708Y3, complete sequence) position: , mismatch: 4, identity: 0.84

aacaaatctcgattataaagataaa	CRISPR spacer
cacaaatattgattataaagataat	Protospacer
 ****** *.**************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

905568 : 911785

Acinetobacter_phage(83.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010327245.1\|905568_906945_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.3e-18	38.4
WP_010327244.1\|907001_907361_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_171054237.1\|907447_907996_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	4.9e-92	94.0
WP_148825677.1\|908089_908776_-	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	3.0e-86	74.2
WP_062034010.1\|909323_910130_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.9e-122	83.2
WP_004695696.1\|910146_911193_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.7e-162	84.5
WP_171056750.1\|911209_911785_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	3.8e-103	93.2

DBSCAN-SWA_2

1157914 : 1168979

Tetraselmis_virus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058869901.1\|1157914_1158892_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	9.5e-38	31.1
WP_004982122.1\|1158895_1159435_+	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_148825793.1\|1159469_1160012_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_148825794.1\|1160001_1160568_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_004696348.1\|1160567_1161314_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-20	26.2
WP_148825795.1\|1161560_1162157_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	3.7e-24	40.8
WP_148825796.1\|1162149_1162761_+	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	2.0e-09	50.8
WP_004696353.1\|1162889_1163732_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.8e-35	33.9
WP_062033552.1\|1163873_1164539_-	O-methyltransferase	S5YRC3	Mycobacterium_phage	7.9e-28	37.3
WP_148825797.1\|1164672_1165392_-	peptidase M15	NA	NA	NA	NA
WP_004696359.1\|1165524_1165848_-	ferredoxin family protein	NA	NA	NA	NA
WP_148825798.1\|1166345_1168979_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	6.6e-33	24.8

DBSCAN-SWA_3

1295460 : 1355440

Staphylococcus_phage(10.0%)

protease,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148825229.1\|1295460_1296765_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_004696602.1\|1297022_1297289_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_148825863.1\|1297502_1298168_+	nucleoside-diphosphate sugar epimerase	NA	NA	NA	NA
WP_062033117.1\|1298176_1298689_+	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_148825864.1\|1298738_1299518_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_148825865.1\|1299675_1300587_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_058869883.1\|1300609_1301149_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_094148191.1\|1301319_1303344_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_004981883.1\|1303535_1303949_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_148825866.1\|1304030_1305107_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_148825867.1\|1305184_1306354_-	MFS transporter	NA	NA	NA	NA
WP_148825868.1\|1306362_1307169_-	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	5.4e-39	36.2
WP_094148194.1\|1307279_1308170_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_148825869.1\|1308230_1308632_-	internalin	NA	NA	NA	NA
WP_148825870.1\|1308858_1310499_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.1e-150	52.6
WP_005401052.1\|1310530_1311388_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	5.6e-50	41.2
WP_094148196.1\|1311448_1312738_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.2e-136	59.9
WP_005401054.1\|1312751_1313147_+	septum formation initiator family protein	NA	NA	NA	NA
WP_094148197.1\|1313106_1313826_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_004696637.1\|1313940_1315077_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_094148198.1\|1315158_1315644_-	hypothetical protein	NA	NA	NA	NA
WP_148825871.1\|1315700_1316975_-	MFS transporter	NA	NA	NA	NA
WP_148825872.1\|1317048_1318683_-	malate dehydrogenase (quinone)	NA	NA	NA	NA
WP_148825873.1\|1319174_1320839_-\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	2.2e-50	29.5
WP_148825874.1\|1320959_1322432_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_148825875.1\|1322424_1323051_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_148825876.1\|1323598_1325659_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	3.8e-20	26.9
WP_004981851.1\|1325671_1326286_+	MarC family protein	NA	NA	NA	NA
WP_004696655.1\|1326340_1326643_-	cyd operon YbgE family protein	NA	NA	NA	NA
WP_002120988.1\|1326646_1326748_-	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_004981849.1\|1326772_1327918_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_004696658.1\|1327914_1329495_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_148825877.1\|1329494_1329686_-	hypothetical protein	NA	NA	NA	NA
WP_148825878.1\|1330392_1331010_-	DUF1449 family protein	NA	NA	NA	NA
WP_010326961.1\|1331028_1331340_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_148827078.1\|1331354_1332359_-	adenosine kinase	NA	NA	NA	NA
WP_004696669.1\|1332498_1332948_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_171522825.1\|1333092_1336047_+	insulinase family protein	NA	NA	NA	NA
WP_005401069.1\|1336064_1337204_+	phospholipase A	NA	NA	NA	NA
WP_010326956.1\|1337266_1338616_-	potassium transporter TrkH	NA	NA	NA	NA
WP_004981828.1\|1338612_1339266_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_148825880.1\|1339416_1339911_+	hypothetical protein	NA	NA	NA	NA
WP_004696682.1\|1339951_1341490_-	threonine ammonia-lyase, biosynthetic	NA	NA	NA	NA
WP_148825881.1\|1341597_1342269_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_148825882.1\|1342396_1343080_+	DUF45 domain-containing protein	NA	NA	NA	NA
WP_171522869.1\|1343261_1344374_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.8e-20	40.6
WP_171522870.1\|1344481_1345537_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_004696694.1\|1345616_1346363_+	hypothetical protein	NA	NA	NA	NA
WP_004981811.1\|1346380_1346797_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.4e-13	45.2
WP_148825885.1\|1346807_1349084_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.1e-165	43.7
WP_005401079.1\|1349171_1349525_+	YnfA family protein	A0A218MNG8	uncultured_virus	1.4e-26	54.6
WP_004696701.1\|1349552_1350026_-	hypothetical protein	NA	NA	NA	NA
WP_148825886.1\|1350116_1351037_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_148825887.1\|1351158_1351809_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_004696708.1\|1352055_1352940_+	methylisocitrate lyase	NA	NA	NA	NA
WP_148825888.1\|1352942_1354079_+	2-methylcitrate synthase	NA	NA	NA	NA
WP_148825229.1\|1354135_1355440_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1735193 : 1772547

uncultured_Caudovirales_phage(40.74%)

protease,portal,tail,head,terminase,integrase

attL 1745136:1745151|attR 1774930:1774945

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_125274655.1\|1735193_1735490_-	anaerobic dehydrogenase	A0A1B2IBL3	Erwinia_phage	6.2e-17	41.4
WP_148826114.1\|1735490_1736000_-	glycoside hydrolase family protein	A0A0B5L5F7	Acinetobacter_phage	7.6e-47	57.4
WP_148826115.1\|1735989_1736271_-	hypothetical protein	NA	NA	NA	NA
WP_148826116.1\|1736498_1738214_-	hypothetical protein	NA	NA	NA	NA
WP_148826117.1\|1738272_1741143_-	hypothetical protein	A0A1B1P9G8	Acinetobacter_phage	1.1e-126	33.5
WP_148826118.1\|1741139_1741457_-	hypothetical protein	A0A1B1P9H4	Acinetobacter_phage	5.1e-09	31.1
WP_148826119.1\|1741456_1741933_-	DUF1833 family protein	A0A1B1P9F1	Acinetobacter_phage	2.9e-24	36.0
WP_148826120.1\|1741925_1742414_-	hypothetical protein	A0A1B1P9F0	Acinetobacter_phage	3.4e-12	31.5
WP_148826121.1\|1742470_1742707_-	hypothetical protein	NA	NA	NA	NA
WP_148826122.1\|1742709_1746381_-	transglycosylase SLT domain-containing protein	A0A2H4JDA4	uncultured_Caudovirales_phage	6.8e-153	35.1
1745136:1745151	attL	NA	NA	NA	NA
WP_148826123.1\|1747416_1747950_-\|tail	phage tail assembly chaperone family protein, TAC	NA	NA	NA	NA
WP_004694098.1\|1747959_1748430_-	hypothetical protein	NA	NA	NA	NA
WP_148826124.1\|1748496_1748853_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_148826125.1\|1749642_1749948_-\|head,tail	phage head-tail connector protein	A0A2H4J711	uncultured_Caudovirales_phage	1.2e-50	99.0
WP_148826126.1\|1751371_1752031_-\|head,protease	HK97 family phage prohead protease	A0A2H4JAI0	uncultured_Caudovirales_phage	2.8e-102	84.1
WP_148826127.1\|1752023_1753259_-\|portal	phage portal protein	A0A2H4J6S3	uncultured_Caudovirales_phage	1.1e-235	97.8
WP_148826128.1\|1753255_1754950_-\|terminase	terminase large subunit	A0A2H4J559	uncultured_Caudovirales_phage	1.8e-310	94.3
WP_148826129.1\|1755292_1755955_-	hypothetical protein	NA	NA	NA	NA
WP_148826130.1\|1756030_1756483_-\|terminase	terminase small subunit	A0A2H4J8R0	uncultured_Caudovirales_phage	2.4e-76	98.0
WP_171522827.1\|1756588_1756744_-	hypothetical protein	A0A2I7QLK0	Vibrio_phage	9.8e-06	60.0
WP_148826131.1\|1756740_1757031_-	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	6.1e-25	58.1
WP_171522828.1\|1757033_1757210_-	hypothetical protein	NA	NA	NA	NA
WP_171522829.1\|1757261_1757435_-	hypothetical protein	NA	NA	NA	NA
WP_148826133.1\|1757514_1757754_-	hypothetical protein	NA	NA	NA	NA
WP_148827083.1\|1758041_1758188_+	hypothetical protein	NA	NA	NA	NA
WP_148826134.1\|1758206_1758824_-	super-infection exclusion protein B	NA	NA	NA	NA
WP_148826135.1\|1758960_1759374_-	antitermination protein	NA	NA	NA	NA
WP_148826136.1\|1759384_1759819_-	hypothetical protein	G3EN88	Psychrobacter_phage	1.6e-21	41.8
WP_148826137.1\|1759811_1760090_-	hypothetical protein	NA	NA	NA	NA
WP_148826138.1\|1760086_1760485_-	FKBP-type peptidyl-prolyl cis-trans isomerase	A0A2H4J558	uncultured_Caudovirales_phage	4.9e-09	82.4
WP_148826139.1\|1760640_1761129_-	hypothetical protein	NA	NA	NA	NA
WP_148826140.1\|1761125_1761734_-	restriction endonuclease	NA	NA	NA	NA
WP_148826141.1\|1761730_1762573_-	replication protein	A0A0P0IKQ2	Acinetobacter_phage	5.5e-58	55.1
WP_148826142.1\|1762569_1763301_-	phage antirepressor KilAC domain-containing protein	G3EN85	Psychrobacter_phage	1.8e-28	37.6
WP_010326039.1\|1763347_1763848_-	hypothetical protein	NA	NA	NA	NA
WP_010326038.1\|1763915_1764146_-	helix-turn-helix domain-containing protein	A0A0R6PJ81	Moraxella_phage	1.0e-14	53.7
WP_148827084.1\|1764147_1764930_+	peptidase S24	A0A0R6PJ00	Moraxella_phage	7.6e-30	41.0
WP_148826143.1\|1765672_1766044_+	hypothetical protein	NA	NA	NA	NA
WP_148826144.1\|1766085_1766967_+	DUF2303 family protein	A0A142KC52	Gordonia_phage	1.4e-08	24.6
WP_005400136.1\|1767049_1767322_+	hypothetical protein	NA	NA	NA	NA
WP_004694173.1\|1767330_1767591_+	hypothetical protein	NA	NA	NA	NA
WP_062034570.1\|1767590_1767836_+	hypothetical protein	NA	NA	NA	NA
WP_148826145.1\|1767837_1768428_+	HNH endonuclease	A0A2H4JIA5	uncultured_Caudovirales_phage	4.1e-20	31.6
WP_148827085.1\|1768496_1768772_+	hypothetical protein	I2GUB3	Acinetobacter_phage	5.8e-09	45.9
WP_148826146.1\|1768764_1768989_+	hypothetical protein	NA	NA	NA	NA
WP_148826147.1\|1768981_1769299_+	hypothetical protein	NA	NA	NA	NA
WP_148826148.1\|1769295_1769583_+	hypothetical protein	A0A2H4J8T6	uncultured_Caudovirales_phage	2.5e-10	41.4
WP_058952524.1\|1769582_1769867_+	HTH domain-containing protein	NA	NA	NA	NA
WP_058952057.1\|1769863_1770883_-\|integrase	site-specific integrase	A0A0R6PHH4	Moraxella_phage	9.8e-70	41.9
WP_010326624.1\|1771165_1771534_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.6e-12	35.4
WP_148826149.1\|1771578_1771929_+	hypothetical protein	NA	NA	NA	NA
WP_148826150.1\|1771939_1772221_+	hypothetical protein	NA	NA	NA	NA
WP_004979945.1\|1772235_1772547_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	2.9e-17	43.1
1774930:1774945	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2019844 : 2025829

uncultured_Caudovirales_phage(66.67%)

terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148826312.1\|2019844_2021047_-\|capsid	minor capsid protein	B7SDN5	Haemophilus_phage	1.3e-23	37.2
WP_148826313.1\|2021047_2022514_-	DUF935 family protein	A0A2H4JHL1	uncultured_Caudovirales_phage	9.2e-194	68.8
WP_148826314.1\|2022526_2024203_-\|terminase	terminase	A0A2H4JGD8	uncultured_Caudovirales_phage	0.0e+00	91.4
WP_148826315.1\|2024199_2024706_-	DUF2280 domain-containing protein	A0A2H4JI35	uncultured_Caudovirales_phage	2.2e-62	75.0
WP_148826316.1\|2024751_2025393_-	hypothetical protein	A0A2H4JE07	uncultured_Caudovirales_phage	1.8e-106	83.6
WP_148826317.1\|2025352_2025829_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	5.6e-52	64.5

DBSCAN-SWA_6

2028855 : 2045743

Acinetobacter_phage(47.06%)

integrase

attL 2027532:2027548|attR 2043477:2043493

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2027532:2027548	attL	NA	NA	NA	NA
WP_148826319.1\|2028855_2029413_-	hypothetical protein	A0A1B1P9I8	Acinetobacter_phage	3.7e-63	61.6
WP_058869377.1\|2029424_2030096_-	metallophosphoesterase	A0A1J0MGN8	Acinetobacter_phage	8.8e-43	43.8
WP_148827090.1\|2030100_2030469_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	1.4e-37	65.3
WP_148826320.1\|2030501_2030759_-	hypothetical protein	NA	NA	NA	NA
WP_148826321.1\|2030755_2031364_-	restriction endonuclease	NA	NA	NA	NA
WP_148826322.1\|2031360_2032203_-	replication protein	A0A0P0IKQ2	Acinetobacter_phage	2.4e-61	54.2
WP_148827091.1\|2032199_2032868_-	phage antirepressor KilAC domain-containing protein	A0A059VF66	Pseudomonas_phage	3.5e-23	35.0
WP_058869369.1\|2033148_2033649_-	hypothetical protein	NA	NA	NA	NA
WP_086207688.1\|2033707_2033887_-	hypothetical protein	J7HXD2	Acinetobacter_phage	5.8e-10	57.6
WP_148826323.1\|2033986_2034715_+	helix-turn-helix domain-containing protein	A0A0P0I8E0	Acinetobacter_phage	1.7e-63	54.1
WP_148826324.1\|2034760_2035087_+	hypothetical protein	A0A0D4DCB9	Acinetobacter_phage	6.2e-26	56.2
WP_148826325.1\|2035191_2035665_+	hypothetical protein	A0A2H4J8G2	uncultured_Caudovirales_phage	1.6e-22	40.4
WP_148826326.1\|2035657_2036428_+	DUF1828 domain-containing protein	A0A2H4JC42	uncultured_Caudovirales_phage	4.4e-62	49.8
WP_115736954.1\|2036481_2037183_-	hypothetical protein	NA	NA	NA	NA
WP_148826327.1\|2037471_2037900_+	hypothetical protein	A0A0D4DBH9	Acinetobacter_phage	1.8e-25	45.7
WP_125280162.1\|2037899_2038208_+	hypothetical protein	NA	NA	NA	NA
WP_058869364.1\|2038252_2038927_+	hypothetical protein	A0A2D1GLT5	Escherichia_phage	1.6e-63	56.2
WP_148826328.1\|2038957_2039695_+	hypothetical protein	NA	NA	NA	NA
WP_148826329.1\|2039707_2040385_+	3'-5' exonuclease	A0A059VJT9	Pseudomonas_phage	2.0e-34	40.7
WP_148826330.1\|2040496_2040841_+	hypothetical protein	NA	NA	NA	NA
WP_148826331.1\|2040840_2041083_+	hypothetical protein	A0A2H4JCC5	uncultured_Caudovirales_phage	4.8e-07	46.8
WP_148826332.1\|2041086_2041686_+	HNH endonuclease	A0A1V0E8E4	Vibrio_phage	2.3e-18	34.6
WP_148826333.1\|2041682_2041892_+	hypothetical protein	NA	NA	NA	NA
WP_004693796.1\|2041888_2042140_+	hypothetical protein	NA	NA	NA	NA
WP_148826334.1\|2042128_2043352_-\|integrase	tyrosine-type recombinase/integrase	A0A291AWU1	Escherichia_phage	7.6e-101	45.1
WP_010326440.1\|2043775_2044252_-	acyl-CoA thioesterase	NA	NA	NA	NA
2043477:2043493	attR	NA	NA	NA	NA
WP_148826335.1\|2044363_2045743_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	3.8e-24	29.9

DBSCAN-SWA_7

2504767 : 2562609

Enterobacteria_phage(30.77%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148826576.1\|2504767_2505700_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	4.3e-56	40.9
WP_148826577.1\|2505733_2506060_-	hypothetical protein	NA	NA	NA	NA
WP_148826578.1\|2506371_2507304_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	6.7e-57	41.4
WP_148827107.1\|2507491_2508940_-	succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_004981443.1\|2508956_2510219_-	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_148826579.1\|2510796_2512299_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	4.9e-17	26.3
WP_058952237.1\|2512713_2514159_+	amino acid permease	NA	NA	NA	NA
WP_148826580.1\|2514273_2515497_-	heparin lyase I family protein	NA	NA	NA	NA
WP_148826581.1\|2517246_2518707_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_039889800.1\|2518699_2519704_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_004694789.1\|2519718_2519841_+	hypothetical protein	NA	NA	NA	NA
WP_148826582.1\|2519920_2521327_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_148826583.1\|2521459_2522386_-	HPP family protein	NA	NA	NA	NA
WP_148826584.1\|2522404_2523115_-	LrgB family protein	NA	NA	NA	NA
WP_148826585.1\|2523524_2525177_-	nitrite/sulfite reductase	NA	NA	NA	NA
WP_148826586.1\|2525246_2526068_-	hypothetical protein	NA	NA	NA	NA
WP_148826587.1\|2526363_2526825_-	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_148826588.1\|2526933_2527827_+	EamA family transporter RarD	NA	NA	NA	NA
WP_148826446.1\|2528581_2529514_+\|transposase	IS5-like element ISAha1 family transposase	Q1MVF0	Enterobacteria_phage	2.8e-55	40.8
WP_171522839.1\|2529536_2529824_-\|transposase	transposase	U5P429	Shigella_phage	4.8e-22	62.0
WP_062034202.1\|2529937_2530219_-\|transposase	IS3 family transposase	U5P4I9	Shigella_phage	2.0e-20	65.4
WP_000920558.1\|2530555_2530858_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_148826590.1\|2531191_2532022_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_000842149.1\|2532250_2533363_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	1.2e-33	30.1
WP_005105873.1\|2533384_2533660_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_148826591.1\|2534127_2535123_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_148826592.1\|2535112_2536129_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_148827108.1\|2536143_2537043_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_048881947.1\|2537178_2537919_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_148826593.1\|2537992_2538991_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000156169.1\|2539011_2539296_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_062034209.1\|2542217_2542820_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.3e-42	47.9
WP_148826594.1\|2542946_2543735_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_148826595.1\|2543731_2544943_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_148826596.1\|2545043_2545937_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_148826597.1\|2546050_2546623_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_148826598.1\|2546598_2547096_+	chalcone isomerase family protein	NA	NA	NA	NA
WP_148826599.1\|2547107_2547800_+	response regulator	W8CYM9	Bacillus_phage	9.8e-29	36.8
WP_148827109.1\|2547796_2549119_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_148826600.1\|2549154_2550204_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_148826601.1\|2550212_2550992_-	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_148826602.1\|2551016_2552213_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	9.9e-45	33.6
WP_148826603.1\|2552209_2553004_-	DUF1365 family protein	NA	NA	NA	NA
WP_062034221.1\|2553013_2554297_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_148826604.1\|2554293_2555280_-	fatty acid desaturase	NA	NA	NA	NA
WP_148826605.1\|2555414_2555963_-	lipocalin family protein	A0A2P1EMA7	Moumouvirus	1.4e-17	39.0
WP_148826606.1\|2556132_2556906_-	NAD(+) diphosphatase	NA	NA	NA	NA
WP_148827110.1\|2557289_2558813_+	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	1.0e-46	28.9
WP_081408287.1\|2558816_2558951_+	DUF2256 domain-containing protein	NA	NA	NA	NA
WP_058952279.1\|2558965_2559220_-	TIGR03643 family protein	NA	NA	NA	NA
WP_148826607.1\|2560786_2561674_+	hypothetical protein	NA	NA	NA	NA
WP_148826446.1\|2561676_2562609_-\|transposase	IS5-like element ISAha1 family transposase	Q1MVF0	Enterobacteria_phage	2.8e-55	40.8

DBSCAN-SWA_8

2776117 : 2781318

uncultured_Caudovirales_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148826713.1\|2776117_2777191_-	NAD(P)-binding domain-containing protein	A0A2H4J2Q2	uncultured_Caudovirales_phage	1.4e-95	61.3
WP_148826714.1\|2777292_2778246_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.7e-60	42.8
WP_148826715.1\|2778263_2778968_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-92	70.9
WP_148826716.1\|2778973_2780017_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_148826717.1\|2780024_2780498_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	8.7e-37	51.9
WP_004723201.1\|2780504_2780825_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	9.4e-27	64.8
WP_087550548.1\|2780883_2781318_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	8.5e-39	56.2

DBSCAN-SWA_9

2792675 : 2838865

uncultured_virus(10.0%)

tRNA,integrase,transposase,protease

attL 2782439:2782452|attR 2830096:2830109

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2782439:2782452	attL	NA	NA	NA	NA
WP_148826723.1\|2792675_2793377_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	4.6e-34	53.6
WP_171522843.1\|2793373_2793538_-	hypothetical protein	NA	NA	NA	NA
WP_148827114.1\|2793692_2793989_+	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_148826724.1\|2793954_2795091_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8L8	uncultured_Caudovirales_phage	7.8e-92	44.0
WP_148826725.1\|2795222_2796245_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_085940648.1\|2796617_2797708_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_001043260.1\|2797797_2798613_+	sulfonamide-resistant dihydropteroate synthase Sul2	NA	NA	NA	NA
WP_000251875.1\|2798699_2799002_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_001445143.1\|2798895_2799147_-	hypothetical protein	NA	NA	NA	NA
WP_001120888.1\|2799177_2800671_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001255015.1\|2800782_2801088_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000214119.1\|2801115_2802330_-	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	4.2e-19	28.7
WP_000480968.1\|2802765_2803602_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001082319.1\|2803601_2804405_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
WP_085940648.1\|2804506_2805596_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_148826726.1\|2805906_2807016_-	DUF695 domain-containing protein	NA	NA	NA	NA
WP_148826727.1\|2807115_2807883_-	ThiF family adenylyltransferase	S4VW33	Pandoravirus	1.2e-16	30.2
WP_148826728.1\|2807997_2810751_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_171522883.1\|2810878_2811694_-	TatD family hydrolase	NA	NA	NA	NA
WP_148826730.1\|2811706_2812657_-	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_148826731.1\|2812704_2813523_-	hypothetical protein	NA	NA	NA	NA
WP_004692398.1\|2813614_2815204_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	3.6e-10	31.2
WP_148826732.1\|2815372_2817451_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.2e-16	32.9
WP_010325906.1\|2817714_2819910_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	1.9e-171	46.1
WP_148826733.1\|2820151_2821168_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_148826734.1\|2821326_2822202_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_148826735.1\|2822262_2823594_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_148827115.1\|2823900_2825166_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.6e-98	49.4
WP_004979078.1\|2825775_2826993_+	acetate kinase	NA	NA	NA	NA
WP_148826736.1\|2827048_2829190_+	phosphate acetyltransferase	NA	NA	NA	NA
WP_148826737.1\|2829871_2830882_+	hypothetical protein	NA	NA	NA	NA
2830096:2830109	attR	NA	NA	NA	NA
WP_148826738.1\|2831556_2832462_-	EamA family transporter	NA	NA	NA	NA
WP_148827116.1\|2832641_2833511_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010325897.1\|2833533_2833812_-	hypothetical protein	NA	NA	NA	NA
WP_004692421.1\|2834495_2836022_+	fumarate hydratase	NA	NA	NA	NA
WP_148826739.1\|2836125_2836674_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_148826740.1\|2836679_2837396_-	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_010325894.1\|2837554_2838865_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	6.8e-132	55.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP043310

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043310_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043310_1

3080-3184

Orphan

Consensus_repeat	Method
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043310_1

>merge|NZ_CP043310|1|3080-3184|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTTCTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCATTTGTAGTTTAATGTCCGGTAAAAGTAGTTT

>NZ_CP043310|1|1|3080-3184|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCAT
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043310.1\|WP_148827141.1\|8300_8540_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000557944.1\|6138_6402_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099
NZ_CP043310.1\|WP_065995571.1\|6537_7017_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_000110201.1\|13219_13522_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000110201.1\|5524_5827_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000184943.1\|13583_13847_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238
NZ_CP043310.1\|WP_148827140.1\|1069_1501_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_020846814.1\|9702_10644_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_065995571.1\|14232_14712_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_000557944.1\|13833_14097_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099
NZ_CP043310.1\|WP_000184943.1\|5888_6152_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238

Protein	Function_ID	Function_description	E-value
NZ_CP043310.1\|WP_000557944.1\|6138_6402_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23
NZ_CP043310.1\|WP_065995571.1\|6537_7017_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_020846814.1\|9702_10644_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_000184943.1\|13583_13847_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46
NZ_CP043310.1\|WP_000557944.1\|13833_14097_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23
NZ_CP043310.1\|WP_065995571.1\|14232_14712_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_000184943.1\|5888_6152_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46

>NZ_CP043310.1|WP_148827140.1|1069_1501_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGNMTLEKWQKLEMLSSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLNLLEELPYYFIWWTKTVGNNRAVFYCW
>NZ_CP043310.1|WP_000110201.1|5524_5827_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_000184943.1|5888_6152_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000557944.1|6138_6402_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_065995571.1|6537_7017_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI
>NZ_CP043310.1|WP_148827141.1|8300_8540_-|hypothetical-protein
MSPGIFFEDFEKTENSITTWCIRSLLVIATRFDLYVRKESKAIKIKEEVILSNYRKNKFNELDTENEIKKLRNEAELIN
>NZ_CP043310.1|WP_020846814.1|9702_10644_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_000110201.1|13219_13522_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_000184943.1|13583_13847_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000557944.1|13833_14097_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_065995571.1|14232_14712_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043310_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043310_2

10765-10869

Orphan

Consensus_repeat	Method
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043310_2

>merge|NZ_CP043310|2|10765-10869|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTTCTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCATTTGTAGTTTAATGTCCGGTAAAAGTAGTTT

>NZ_CP043310|2|2|10765-10869|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCAT
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043310.1\|WP_148827141.1\|8300_8540_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000557944.1\|6138_6402_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099
NZ_CP043310.1\|WP_065995571.1\|6537_7017_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_000184943.1\|13583_13847_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238
NZ_CP043310.1\|WP_000110201.1\|13219_13522_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000110201.1\|5524_5827_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_004870774.1\|17113_17401_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000184943.1\|5888_6152_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238
NZ_CP043310.1\|WP_000110201.1\|20914_21217_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_148827134.1\|15670_16240_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_148827140.1\|1069_1501_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_020846814.1\|17397_18339_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_020846814.1\|9702_10644_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_148827135.1\|16447_16852_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_065995571.1\|14232_14712_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_004870770.1\|19050_20703_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP043310.1\|WP_000557944.1\|13833_14097_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099

Protein	Function_ID	Function_description	E-value
NZ_CP043310.1\|WP_000557944.1\|6138_6402_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23
NZ_CP043310.1\|WP_065995571.1\|6537_7017_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_020846814.1\|9702_10644_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_000184943.1\|13583_13847_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46
NZ_CP043310.1\|WP_000557944.1\|13833_14097_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23
NZ_CP043310.1\|WP_065995571.1\|14232_14712_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_004870770.1\|19050_20703_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.5527e-73
NZ_CP043310.1\|WP_020846814.1\|17397_18339_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_000184943.1\|5888_6152_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46

>NZ_CP043310.1|WP_020846814.1|9702_10644_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_148827141.1|8300_8540_-|hypothetical-protein
MSPGIFFEDFEKTENSITTWCIRSLLVIATRFDLYVRKESKAIKIKEEVILSNYRKNKFNELDTENEIKKLRNEAELIN
>NZ_CP043310.1|WP_065995571.1|6537_7017_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI
>NZ_CP043310.1|WP_000557944.1|6138_6402_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_000184943.1|5888_6152_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000110201.1|5524_5827_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_148827140.1|1069_1501_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGNMTLEKWQKLEMLSSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLNLLEELPYYFIWWTKTVGNNRAVFYCW
>NZ_CP043310.1|WP_000110201.1|13219_13522_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_000184943.1|13583_13847_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000557944.1|13833_14097_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_065995571.1|14232_14712_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI
>NZ_CP043310.1|WP_148827134.1|15670_16240_-|hypothetical-protein
MSPGIFFEDFEKTENSDYLHGVFGRCLVIATRFDSMCVRMSKAIKIKEEVILRIIEKQFNELDTENEIKKLRNEAEFNQLVEKTLSKYLTLDKSIRTLGLPEQLSAILHEARKSRNEIAHSLTRDLEGCIDTKIDNTILIKKIEKLIENIVEGDIIISILISIFNEDPILNSQNLSQYKDKIIDWVISP
>NZ_CP043310.1|WP_148827135.1|16447_16852_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGEYDIRKMAEIGDASSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLTFARGIAVLLYMVDKNGW
>NZ_CP043310.1|WP_004870774.1|17113_17401_-|hypothetical-protein
MRTKAELDAMSHQELKDYEQSLLALWTPRMAIESDIERLSTHHSELLEVFNQLKNPDAPKNSRLKDSILSLKYKIESLEGKLSDLIQDNRLNSAD
>NZ_CP043310.1|WP_020846814.1|17397_18339_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_004870770.1|19050_20703_-|MobA/MobL-family-protein
MAIYHFSVKTISRGNGRSAVACAAYRSSEKLVCDFYGKEQDYTRKTGVEFTKIYAPENTNTELLKRQTLWNEVEKVERRKDALLAREFEIAFPSELNAEQRENMLNELCRNLVKKYGVIVDAAIHAPHTDSGSDERNYHAHIMFTTRSINEQGGFSAKKYRDFSRDNGTETVSHWRESFAELCNHHLEQNGFDERVDHRSYEDQESDLEATQHEGPQATYLRRRGIFTEISLKNDEIKLRNLKIKKVIALDENIKVSEDLVQKVRSELQFQYSQAEYSEKTSQKLYEFQNEELSKLTTKLDTMSSAISELRKKEPLFFKTKWINQINDLIDQHNTQLDIQKHISGLSEIEKKERYSDHLNKWTEENQLLQPKKSFAKFDEPNITVKQRKLNDQISNIDHQISEISRRETEYQEYVRDQRLEIINSYIFEEDNYGNKYFSPQNGEKQKRLYAEEMEDLKIQELHAAFTKKIETEAQQEFSQKRAIQLENDRKDRESREQQLRKEREQQEQRYAQEREQQEHLAFVRRQEQEKQQRNEPKKPENDNNHDYTP
>NZ_CP043310.1|WP_000110201.1|20914_21217_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043310_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043310_3

18460-18564

Orphan

Consensus_repeat	Method
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043310_3

>merge|NZ_CP043310|3|18460-18564|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTTCTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCATTTGTAGTTTAATGTCCGGTAAAAGTAGTTT

>NZ_CP043310|3|3|18460-18564|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCAT
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043310.1\|WP_148827134.1\|23365_23935_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000184943.1\|21278_21542_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238
NZ_CP043310.1\|WP_148827141.1\|8300_8540_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000110201.1\|20914_21217_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_004870774.1\|24808_25096_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_000184943.1\|13583_13847_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238
NZ_CP043310.1\|WP_000110201.1\|13219_13522_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_004870770.1\|26744_28397_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP043310.1\|WP_020846814.1\|17397_18339_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_148827135.1\|24142_24547_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_148827134.1\|15670_16240_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_004870774.1\|17113_17401_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_065995571.1\|21927_22407_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_020846814.1\|9702_10644_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_000557944.1\|21528_21792_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099
NZ_CP043310.1\|WP_148827135.1\|16447_16852_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_020846814.1\|25092_26034_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_065995571.1\|14232_14712_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_004870770.1\|19050_20703_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP043310.1\|WP_000557944.1\|13833_14097_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099

Protein	Function_ID	Function_description	E-value
NZ_CP043310.1\|WP_000184943.1\|21278_21542_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46
NZ_CP043310.1\|WP_004870770.1\|26744_28397_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.5527e-73
NZ_CP043310.1\|WP_065995571.1\|21927_22407_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_020846814.1\|9702_10644_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_000184943.1\|13583_13847_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46
NZ_CP043310.1\|WP_000557944.1\|21528_21792_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23
NZ_CP043310.1\|WP_020846814.1\|25092_26034_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_065995571.1\|14232_14712_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_004870770.1\|19050_20703_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.5527e-73
NZ_CP043310.1\|WP_020846814.1\|17397_18339_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_000557944.1\|13833_14097_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23

>NZ_CP043310.1|WP_020846814.1|17397_18339_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_004870774.1|17113_17401_-|hypothetical-protein
MRTKAELDAMSHQELKDYEQSLLALWTPRMAIESDIERLSTHHSELLEVFNQLKNPDAPKNSRLKDSILSLKYKIESLEGKLSDLIQDNRLNSAD
>NZ_CP043310.1|WP_148827135.1|16447_16852_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGEYDIRKMAEIGDASSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLTFARGIAVLLYMVDKNGW
>NZ_CP043310.1|WP_148827134.1|15670_16240_-|hypothetical-protein
MSPGIFFEDFEKTENSDYLHGVFGRCLVIATRFDSMCVRMSKAIKIKEEVILRIIEKQFNELDTENEIKKLRNEAEFNQLVEKTLSKYLTLDKSIRTLGLPEQLSAILHEARKSRNEIAHSLTRDLEGCIDTKIDNTILIKKIEKLIENIVEGDIIISILISIFNEDPILNSQNLSQYKDKIIDWVISP
>NZ_CP043310.1|WP_065995571.1|14232_14712_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI
>NZ_CP043310.1|WP_000557944.1|13833_14097_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_000184943.1|13583_13847_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000110201.1|13219_13522_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_020846814.1|9702_10644_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_148827141.1|8300_8540_-|hypothetical-protein
MSPGIFFEDFEKTENSITTWCIRSLLVIATRFDLYVRKESKAIKIKEEVILSNYRKNKFNELDTENEIKKLRNEAELIN
>NZ_CP043310.1|WP_004870770.1|19050_20703_-|MobA/MobL-family-protein
MAIYHFSVKTISRGNGRSAVACAAYRSSEKLVCDFYGKEQDYTRKTGVEFTKIYAPENTNTELLKRQTLWNEVEKVERRKDALLAREFEIAFPSELNAEQRENMLNELCRNLVKKYGVIVDAAIHAPHTDSGSDERNYHAHIMFTTRSINEQGGFSAKKYRDFSRDNGTETVSHWRESFAELCNHHLEQNGFDERVDHRSYEDQESDLEATQHEGPQATYLRRRGIFTEISLKNDEIKLRNLKIKKVIALDENIKVSEDLVQKVRSELQFQYSQAEYSEKTSQKLYEFQNEELSKLTTKLDTMSSAISELRKKEPLFFKTKWINQINDLIDQHNTQLDIQKHISGLSEIEKKERYSDHLNKWTEENQLLQPKKSFAKFDEPNITVKQRKLNDQISNIDHQISEISRRETEYQEYVRDQRLEIINSYIFEEDNYGNKYFSPQNGEKQKRLYAEEMEDLKIQELHAAFTKKIETEAQQEFSQKRAIQLENDRKDRESREQQLRKEREQQEQRYAQEREQQEHLAFVRRQEQEKQQRNEPKKPENDNNHDYTP
>NZ_CP043310.1|WP_000110201.1|20914_21217_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_000184943.1|21278_21542_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000557944.1|21528_21792_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_065995571.1|21927_22407_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI
>NZ_CP043310.1|WP_148827134.1|23365_23935_-|hypothetical-protein
MSPGIFFEDFEKTENSDYLHGVFGRCLVIATRFDSMCVRMSKAIKIKEEVILRIIEKQFNELDTENEIKKLRNEAEFNQLVEKTLSKYLTLDKSIRTLGLPEQLSAILHEARKSRNEIAHSLTRDLEGCIDTKIDNTILIKKIEKLIENIVEGDIIISILISIFNEDPILNSQNLSQYKDKIIDWVISP
>NZ_CP043310.1|WP_148827135.1|24142_24547_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGEYDIRKMAEIGDASSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLTFARGIAVLLYMVDKNGW
>NZ_CP043310.1|WP_004870774.1|24808_25096_-|hypothetical-protein
MRTKAELDAMSHQELKDYEQSLLALWTPRMAIESDIERLSTHHSELLEVFNQLKNPDAPKNSRLKDSILSLKYKIESLEGKLSDLIQDNRLNSAD
>NZ_CP043310.1|WP_020846814.1|25092_26034_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_004870770.1|26744_28397_-|MobA/MobL-family-protein
MAIYHFSVKTISRGNGRSAVACAAYRSSEKLVCDFYGKEQDYTRKTGVEFTKIYAPENTNTELLKRQTLWNEVEKVERRKDALLAREFEIAFPSELNAEQRENMLNELCRNLVKKYGVIVDAAIHAPHTDSGSDERNYHAHIMFTTRSINEQGGFSAKKYRDFSRDNGTETVSHWRESFAELCNHHLEQNGFDERVDHRSYEDQESDLEATQHEGPQATYLRRRGIFTEISLKNDEIKLRNLKIKKVIALDENIKVSEDLVQKVRSELQFQYSQAEYSEKTSQKLYEFQNEELSKLTTKLDTMSSAISELRKKEPLFFKTKWINQINDLIDQHNTQLDIQKHISGLSEIEKKERYSDHLNKWTEENQLLQPKKSFAKFDEPNITVKQRKLNDQISNIDHQISEISRRETEYQEYVRDQRLEIINSYIFEEDNYGNKYFSPQNGEKQKRLYAEEMEDLKIQELHAAFTKKIETEAQQEFSQKRAIQLENDRKDRESREQQLRKEREQQEQRYAQEREQQEHLAFVRRQEQEKQQRNEPKKPENDNNHDYTP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043310_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043310_4

26155-26259

Orphan

Consensus_repeat	Method
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043310_4

>merge|NZ_CP043310|4|26155-26259|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTTCTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCATTTGTAGTTTAATGTCCGGTAAAAGTAGTTT

>NZ_CP043310|4|4|26155-26259|CRISPRCasFinder
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT	CTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCAT
TTGTAGTTTAATGTCCGGTAAAAGTAGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043310.1\|WP_000184943.1\|21278_21542_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|284238
NZ_CP043310.1\|WP_148827134.1\|23365_23935_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_004870774.1\|24808_25096_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_148827135.1\|31790_32195_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_148827134.1\|31012_31582_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_004870770.1\|26744_28397_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP043310.1\|WP_020846814.1\|17397_18339_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_004870770.1\|19050_20703_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP043310.1\|WP_000110201.1\|20914_21217_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043310.1\|WP_065995571.1\|21927_22407_-\|cysteine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224254
NZ_CP043310.1\|WP_000557944.1\|21528_21792_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|171099
NZ_CP043310.1\|WP_020846814.1\|25092_26034_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP043310.1\|WP_148827135.1\|24142_24547_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP043310.1\|WP_000184943.1\|21278_21542_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|284238	pfam06769, YoeB_toxin, YoeB-like toxin of bacterial type II toxin-antitoxin system. YoeB_toxin is a family of bacterial toxins that forms one component of the type II toxin-antitoxin system in E. coli whose antitoxin is represented by YefM, found in pfam02604. The plasmid encoded Axe-Txe proteins in Enterococcus faecium act as an antitoxin-toxin pair. When the plasmid is lost, the antitoxin is degraded relatively quickly by host enzymes. This allows the toxin to interact with its intracellular target, thus killing the cell or impeding cell growth. These toxins are highly potent protein synthesis inhibitors, specifically blocking the initiation of translation. In the case of YoeB, it binds to the 50 S ribosomal subunit in 70 S ribosomes and interacts with the A site leading to mRNA cleavage at this site. As a result, the 3'-end portion of the mRNA is released from ribosomes, and translation initiation is effectively inhibited.	5.80128e-46
NZ_CP043310.1\|WP_065995571.1\|21927_22407_-\|cysteine-hydrolase-family-protein	gnl\|CDD\|224254	COG1335, PncA, Amidases related to nicotinamidase [Secondary metabolites biosynthesis, transport, and catabolism].	1.97881e-14
NZ_CP043310.1\|WP_000557944.1\|21528_21792_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|171099	PRK11409, PRK11409, YoeB-YefM toxin-antitoxin system antitoxin YefM.	2.30515e-23
NZ_CP043310.1\|WP_020846814.1\|25092_26034_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_004870770.1\|19050_20703_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.5527e-73
NZ_CP043310.1\|WP_020846814.1\|17397_18339_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP043310.1\|WP_004870770.1\|26744_28397_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.5527e-73

>NZ_CP043310.1|WP_020846814.1|25092_26034_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_004870774.1|24808_25096_-|hypothetical-protein
MRTKAELDAMSHQELKDYEQSLLALWTPRMAIESDIERLSTHHSELLEVFNQLKNPDAPKNSRLKDSILSLKYKIESLEGKLSDLIQDNRLNSAD
>NZ_CP043310.1|WP_148827135.1|24142_24547_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGEYDIRKMAEIGDASSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLTFARGIAVLLYMVDKNGW
>NZ_CP043310.1|WP_148827134.1|23365_23935_-|hypothetical-protein
MSPGIFFEDFEKTENSDYLHGVFGRCLVIATRFDSMCVRMSKAIKIKEEVILRIIEKQFNELDTENEIKKLRNEAEFNQLVEKTLSKYLTLDKSIRTLGLPEQLSAILHEARKSRNEIAHSLTRDLEGCIDTKIDNTILIKKIEKLIENIVEGDIIISILISIFNEDPILNSQNLSQYKDKIIDWVISP
>NZ_CP043310.1|WP_065995571.1|21927_22407_-|cysteine-hydrolase-family-protein
MKPVLLIIDVQSTFNPPNWLIQKLEKLLPSVHSIATIELHDESIVPFKSQLNWAPSEFDECPLKVEKVFIKYGYSPTDDLIQYLKGLDTQQVYVCGIQTDTCVLAAGFRLFDAGLFPCLVTDLTVGSSLDRSGNLGIQLWKHHFRSITTSENLSSNTMI
>NZ_CP043310.1|WP_000557944.1|21528_21792_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MHVFTYTDARNNLKSVLDKVIDDVDVAFITRKEGGHAVVMGQDHYDSLMETLYLLSSPNNASRLNESIAQLRAGKTKHRELIEDDES
>NZ_CP043310.1|WP_000184943.1|21278_21542_-|Txe/YoeB-family-addiction-module-toxin
MTNRNVEWTDNAWDEYIYWQTQDKKILKRINTLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDERISIIQCRFHY
>NZ_CP043310.1|WP_000110201.1|20914_21217_+|hypothetical-protein
MSVETLEQKIAKQEERLRQLKAQKQAIAAREKKKNSDRQRKDDTRRKILLGAWVLNKLKNDESFKGQLTDFEKFLSTESKTEENRQKDKDLFNGVIWNNT
>NZ_CP043310.1|WP_004870770.1|19050_20703_-|MobA/MobL-family-protein
MAIYHFSVKTISRGNGRSAVACAAYRSSEKLVCDFYGKEQDYTRKTGVEFTKIYAPENTNTELLKRQTLWNEVEKVERRKDALLAREFEIAFPSELNAEQRENMLNELCRNLVKKYGVIVDAAIHAPHTDSGSDERNYHAHIMFTTRSINEQGGFSAKKYRDFSRDNGTETVSHWRESFAELCNHHLEQNGFDERVDHRSYEDQESDLEATQHEGPQATYLRRRGIFTEISLKNDEIKLRNLKIKKVIALDENIKVSEDLVQKVRSELQFQYSQAEYSEKTSQKLYEFQNEELSKLTTKLDTMSSAISELRKKEPLFFKTKWINQINDLIDQHNTQLDIQKHISGLSEIEKKERYSDHLNKWTEENQLLQPKKSFAKFDEPNITVKQRKLNDQISNIDHQISEISRRETEYQEYVRDQRLEIINSYIFEEDNYGNKYFSPQNGEKQKRLYAEEMEDLKIQELHAAFTKKIETEAQQEFSQKRAIQLENDRKDRESREQQLRKEREQQEQRYAQEREQQEHLAFVRRQEQEKQQRNEPKKPENDNNHDYTP
>NZ_CP043310.1|WP_020846814.1|17397_18339_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP043310.1|WP_004870770.1|26744_28397_-|MobA/MobL-family-protein
MAIYHFSVKTISRGNGRSAVACAAYRSSEKLVCDFYGKEQDYTRKTGVEFTKIYAPENTNTELLKRQTLWNEVEKVERRKDALLAREFEIAFPSELNAEQRENMLNELCRNLVKKYGVIVDAAIHAPHTDSGSDERNYHAHIMFTTRSINEQGGFSAKKYRDFSRDNGTETVSHWRESFAELCNHHLEQNGFDERVDHRSYEDQESDLEATQHEGPQATYLRRRGIFTEISLKNDEIKLRNLKIKKVIALDENIKVSEDLVQKVRSELQFQYSQAEYSEKTSQKLYEFQNEELSKLTTKLDTMSSAISELRKKEPLFFKTKWINQINDLIDQHNTQLDIQKHISGLSEIEKKERYSDHLNKWTEENQLLQPKKSFAKFDEPNITVKQRKLNDQISNIDHQISEISRRETEYQEYVRDQRLEIINSYIFEEDNYGNKYFSPQNGEKQKRLYAEEMEDLKIQELHAAFTKKIETEAQQEFSQKRAIQLENDRKDRESREQQLRKEREQQEQRYAQEREQQEHLAFVRRQEQEKQQRNEPKKPENDNNHDYTP
>NZ_CP043310.1|WP_148827134.1|31012_31582_-|hypothetical-protein
MSPGIFFEDFEKTENSDYLHGVFGRCLVIATRFDSMCVRMSKAIKIKEEVILRIIEKQFNELDTENEIKKLRNEAEFNQLVEKTLSKYLTLDKSIRTLGLPEQLSAILHEARKSRNEIAHSLTRDLEGCIDTKIDNTILIKKIEKLIENIVEGDIIISILISIFNEDPILNSQNLSQYKDKIIDWVISP
>NZ_CP043310.1|WP_148827135.1|31790_32195_+|hypothetical-protein
MKNFLTVLAIVGSTSSFAGLSEMMNIYNNPTIAPKYTACQSNLYCNGFTALSKQWDTIPKSYRYKGEYDIRKMAEIGDASSLYRGFSFGEEESTFYFIEAGADTYYQYDSKHKSDLTFARGIAVLLYMVDKNGW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP044477	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence	1465-1509	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP044487	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence	70-114	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	9932-9976	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	9568-9612	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP032282	Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence	2163-2207	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	3110-3154	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	10795-10839	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	18490-18534	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	26185-26229	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP032104	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence	6066-6110	1.0
NZ_CP043310_1	1.1\|3110\|45\|NZ_CP043310\|CRISPRCasFinder	3110-3154	45	NZ_CP044469	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence	4937-4981	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP044477	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence	1465-1509	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP044487	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence	70-114	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	9932-9976	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	9568-9612	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP032282	Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence	2163-2207	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	3110-3154	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	10795-10839	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	18490-18534	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	26185-26229	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP032104	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence	6066-6110	1.0
NZ_CP043310_2	2.1\|10795\|45\|NZ_CP043310\|CRISPRCasFinder	10795-10839	45	NZ_CP044469	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence	4937-4981	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP044477	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence	1465-1509	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP044487	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence	70-114	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	9932-9976	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	9568-9612	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP032282	Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence	2163-2207	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	3110-3154	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	10795-10839	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	18490-18534	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	26185-26229	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP032104	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence	6066-6110	1.0
NZ_CP043310_3	3.1\|18490\|45\|NZ_CP043310\|CRISPRCasFinder	18490-18534	45	NZ_CP044469	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence	4937-4981	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP044477	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence	1465-1509	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP044487	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence	70-114	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	9932-9976	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	9568-9612	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP032282	Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence	2163-2207	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	3110-3154	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	10795-10839	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	18490-18534	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	26185-26229	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP032104	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence	6066-6110	1.0
NZ_CP043310_4	4.1\|26185\|45\|NZ_CP043310\|CRISPRCasFinder	26185-26229	45	NZ_CP044469	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence	4937-4981	1.0

1. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044477 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

2. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044487 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

3. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

4. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

5. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032282 (Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

6. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

7. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

8. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

9. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

10. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032104 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

11. spacer 1.1|3110|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044469 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

12. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044477 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

13. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044487 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

14. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

15. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

16. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032282 (Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

17. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

18. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

19. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

20. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

21. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032104 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

22. spacer 2.1|10795|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044469 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

23. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044477 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

24. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044487 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

25. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

26. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

27. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032282 (Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

28. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

29. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

30. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

31. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

32. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032104 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

33. spacer 3.1|18490|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044469 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

34. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044477 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

35. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044487 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

36. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

37. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

38. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032282 (Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

39. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

40. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

41. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

42. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

43. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP032104 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

44. spacer 4.1|26185|45|NZ_CP043310|CRISPRCasFinder matches to NZ_CP044469 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence) position: , mismatch: 0, identity: 1.0

ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	CRISPR spacer
ctatgtccggtaaaagtagttttttaagtccattttgtccggcat	Protospacer
*********************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP043309

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13126 : 62451

Escherichia_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067783.1\|13126_13831_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-118	84.5
WP_005093369.1\|14142_14919_+	hypothetical protein	NA	NA	NA	NA
WP_033917445.1\|14918_15485_+	hypothetical protein	NA	NA	NA	NA
WP_033917444.1\|15486_18870_+	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	1.9e-37	26.3
WP_005093363.1\|18968_19724_+	multiubiquitin domain-containing protein	NA	NA	NA	NA
WP_005093361.1\|19698_20883_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_005093359.1\|20876_21350_+	hypothetical protein	NA	NA	NA	NA
WP_019838313.1\|21778_22672_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019838314.1\|22721_24074_-	MFS transporter	NA	NA	NA	NA
WP_033917443.1\|24342_25263_-	catechol 1,2-dioxygenase	NA	NA	NA	NA
WP_019838315.1\|25362_26652_-	salicylate 1-monooxygenase	NA	NA	NA	NA
WP_158660397.1\|26852_27749_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020753574.1\|28216_29482_+	CmlA/FloR family chloramphenicol efflux MFS transporter	S4TR35	Salmonella_phage	3.2e-25	29.0
WP_020753573.1\|29474_30680_+\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	4.2e-112	58.6
WP_081316864.1\|30612_32049_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_019838318.1\|32121_33213_+	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.1e-30	28.0
WP_148827133.1\|33526_34231_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.1e-115	83.2
WP_001067784.1\|35042_35747_+\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	1.9e-120	85.8
WP_033917554.1\|36180_37695_-	MFS transporter	NA	NA	NA	NA
WP_033917515.1\|37923_39321_-	AdeC/AdeK/OprM family multidrug efflux complex outer membrane factor	NA	NA	NA	NA
WP_033917518.1\|39400_42511_-	AdeB/AdeJ family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	9.4e-63	24.4
WP_033917516.1\|42510_43698_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_033917517.1\|43836_44568_+	efflux system response regulator transcription factor AdeR	NA	NA	NA	NA
WP_043041662.1\|44557_45637_+	two-component sensor histidine kinase AdeS	W8CYF6	Bacillus_phage	2.7e-25	28.0
WP_033917576.1\|45649_46612_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.1e-33	33.5
WP_015060246.1\|46867_47479_+	recombinase family protein	NA	NA	NA	NA
WP_000155092.1\|47668_48553_-	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_000052512.1\|48608_50084_-	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_000369781.1\|50576_50849_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000897307.1\|50841_51162_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_001180106.1\|51301_51721_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_000985609.1\|51800_52082_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	5.7e-12	43.3
WP_000286964.1\|52082_52385_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	9.5e-21	49.0
WP_000172759.1\|52533_53064_+	hypothetical protein	NA	NA	NA	NA
WP_004728120.1\|53152_53467_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_000438825.1\|53453_53741_-	BrnT family toxin	NA	NA	NA	NA
WP_000447788.1\|53970_54576_-	LysE family translocator	NA	NA	NA	NA
WP_085940648.1\|54648_55739_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_000073658.1\|55814_56642_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002002480.1\|57612_58455_-	carbapenem-hydrolyzing class D beta-lactamase OXA-58	NA	NA	NA	NA
WP_065995571.1\|59015_59495_-	cysteine hydrolase family protein	NA	NA	NA	NA
WP_148827134.1\|60201_60771_-	hypothetical protein	NA	NA	NA	NA
WP_148827135.1\|60978_61383_+	hypothetical protein	NA	NA	NA	NA
WP_001067790.1\|61746_62451_-\|transposase	IS6-like element IS1008 family transposase	A0A077SL39	Escherichia_phage	5.1e-118	84.5

DBSCAN-SWA_2

222406 : 258809

uncultured_Caudovirales_phage(18.18%)

integrase,transposase

attL 220677:220706|attR 264064:264093

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
220677:220706	attL	NA	NA	NA	NA
WP_117008103.1\|222406_223482_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_005005993.1\|223579_223954_+	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_003464986.1\|225250_225532_-	DUF427 domain-containing protein	NA	NA	NA	NA
WP_005005995.1\|225599_225872_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	7.5e-09	41.9
WP_002118292.1\|226325_227072_-	oxidoreductase	NA	NA	NA	NA
WP_003464980.1\|227064_227667_-	sulfite oxidase-like oxidoreductase	NA	NA	NA	NA
WP_080755359.1\|230010_230604_-\|integrase	phage integrase N-terminal SAM-like domain-containing protein	NA	NA	NA	NA
WP_039048263.1\|230783_231254_+	DM13 domain-containing protein	NA	NA	NA	NA
WP_010591688.1\|231782_232076_-	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_005006001.1\|232134_232566_-	heme-binding protein	NA	NA	NA	NA
WP_002118279.1\|232638_233652_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_005006003.1\|233697_234006_-	hypothetical protein	NA	NA	NA	NA
WP_002118270.1\|234097_235066_-	magnesium and cobalt transport protein CorA	NA	NA	NA	NA
WP_005006007.1\|235062_235767_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_003464967.1\|235907_236447_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_003464965.1\|236448_236892_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_074964445.1\|237412_238171_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.1e-32	36.4
WP_085944217.1\|238261_239426_+\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-164	99.3
WP_002122354.1\|239505_240858_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-37	25.8
WP_005028587.1\|241988_242135_-\|transposase	transposase	NA	NA	NA	NA
WP_005006017.1\|243148_244474_+	DNA cytosine methyltransferase	A0A1L5C2B8	Pseudoalteromonas_phage	7.4e-110	42.7
WP_005006018.1\|244842_246222_-	hypothetical protein	NA	NA	NA	NA
WP_005006020.1\|246372_246933_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	5.3e-33	44.4
WP_038350012.1\|246929_248219_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	5.9e-112	45.4
WP_033917550.1\|248353_248602_-	hypothetical protein	NA	NA	NA	NA
WP_004201168.1\|249215_249854_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_004201167.1\|249858_250224_-	bleomycin binding protein Ble-MBL	NA	NA	NA	NA
WP_004201164.1\|250227_251040_-	subclass B1 metallo-beta-lactamase NDM-1	NA	NA	NA	NA
WP_033917495.1\|251764_252193_-	hypothetical protein	NA	NA	NA	NA
WP_033917496.1\|253507_253933_-	hypothetical protein	NA	NA	NA	NA
WP_058952573.1\|254310_255459_-	hypothetical protein	I6XKU1	Burkholderia_virus	1.8e-27	28.3
WP_087554627.1\|255798_256824_+\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	9.3e-52	38.1
WP_000422636.1\|256924_257704_+	aminoglycoside O-phosphotransferase APH(3')-VIa	E4ZFP6	Streptococcus_phage	1.5e-30	35.1
WP_001988464.1\|257783_258809_+\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
264064:264093	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043307

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP043310

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP043309

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection