CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP043615	Lactobacillus buchneri strain MGB0786 chromosome, complete genome	2 crisprs	csa3,csn2,cas2,cas1,cas9,DinG,cas3,DEDDh	9	5
NZ_CP043613	Lactobacillus buchneri strain MGB0786 plasmid unnamed1, complete sequence	0 crisprs	NA	0	1
NZ_CP043614	Lactobacillus buchneri strain MGB0786 plasmid unnamed3, complete sequence	0 crisprs	NA	0	1
NZ_CP043616	Lactobacillus buchneri strain MGB0786 plasmid unnamed2, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043615_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043615_1

347830-348789

TypeII

Consensus_repeat	Method
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CRISPRCasFinder
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CRT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	PILER-CR

14 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP043615_1

>merge|NZ_CP043615|1|347830-348789|CRISPRCasFinder,CRT,PILER-CR
ATCTCTAACCTTATTGATTTAACATCCTTCTAAAACCAAATAAGTCGGCATTATCAATAAAGTACTGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACCTTTCAAGTAGGTGATTTCGTTAGTGGTTCGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACATGACGGCTGGCAACCTAAGCCACCTTATGGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACGCTGAACCAGCAACATCTGCAACAACGAATGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACTGTGATCTCACGTGTTTCGATCTTGTAATAGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACAAAGTAAAGGGTTAATCAAATACTCAAGTGGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACCTAAGCAACTAGAGAAAATTGATGGCAGGGGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACACGGCCCCAACTTGCTTAACGCCAGAAAGAGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACACCTCGCAGAGGATTATGGCAACGGGTAAAGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACTTGGCTTTAGTTTAGGTGTCTTTTGATGAAGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACTACTAAACCGGTTAAAGCTTCGTATATTTTGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACGGCGTGTTATACGATTAGACAAGTATGTTAGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACCCTTGCACAAAGCGGCCGCCACCTTTTTCCGGGTTTAACCTTATTGATTTAACATCCTTCTAAAACATTACTTTCGTAATAAGTCCCCACGGTATTGGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC

>NZ_CP043615|1|1|347830-348789|CRISPRCasFinder
ATCTCTAACCTTATTGATTTAACATCCTTCTAAAAC	CAAATAAGTCGGCATTATCAATAAAGTACT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CTTTCAAGTAGGTGATTTCGTTAGTGGTTC
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ATGACGGCTGGCAACCTAAGCCACCTTATG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	GCTGAACCAGCAACATCTGCAACAACGAAT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TGTGATCTCACGTGTTTCGATCTTGTAATA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	AAAGTAAAGGGTTAATCAAATACTCAAGTG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CTAAGCAACTAGAGAAAATTGATGGCAGGG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ACGGCCCCAACTTGCTTAACGCCAGAAAGA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ACCTCGCAGAGGATTATGGCAACGGGTAAA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TTGGCTTTAGTTTAGGTGTCTTTTGATGAA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TACTAAACCGGTTAAAGCTTCGTATATTTT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	GGCGTGTTATACGATTAGACAAGTATGTTA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CCTTGCACAAAGCGGCCGCCACCTTTTTCC
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ATTACTTTCGTAATAAGTCCCCACGGTATT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC

>NZ_CP043615|1|1|347830-348789|CRT
ATCTCTAACCTTATTGATTTAACATCCTTCTAAAAC	CAAATAAGTCGGCATTATCAATAAAGTACT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CTTTCAAGTAGGTGATTTCGTTAGTGGTTC
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ATGACGGCTGGCAACCTAAGCCACCTTATG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	GCTGAACCAGCAACATCTGCAACAACGAAT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TGTGATCTCACGTGTTTCGATCTTGTAATA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	AAAGTAAAGGGTTAATCAAATACTCAAGTG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CTAAGCAACTAGAGAAAATTGATGGCAGGG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ACGGCCCCAACTTGCTTAACGCCAGAAAGA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ACCTCGCAGAGGATTATGGCAACGGGTAAA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TTGGCTTTAGTTTAGGTGTCTTTTGATGAA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TACTAAACCGGTTAAAGCTTCGTATATTTT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	GGCGTGTTATACGATTAGACAAGTATGTTA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CCTTGCACAAAGCGGCCGCCACCTTTTTCC
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ATTACTTTCGTAATAAGTCCCCACGGTATT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC

>NZ_CP043615|1|1|347896-348789|PILER-CR
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CTTTCAAGTAGGTGATTTCGTTAGTGGTTC
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ATGACGGCTGGCAACCTAAGCCACCTTATG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	GCTGAACCAGCAACATCTGCAACAACGAAT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TGTGATCTCACGTGTTTCGATCTTGTAATA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	AAAGTAAAGGGTTAATCAAATACTCAAGTG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CTAAGCAACTAGAGAAAATTGATGGCAGGG
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ACGGCCCCAACTTGCTTAACGCCAGAAAGA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ACCTCGCAGAGGATTATGGCAACGGGTAAA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TTGGCTTTAGTTTAGGTGTCTTTTGATGAA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	TACTAAACCGGTTAAAGCTTCGTATATTTT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	GGCGTGTTATACGATTAGACAAGTATGTTA
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	CCTTGCACAAAGCGGCCGCCACCTTTTTCC
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC	ATTACTTTCGTAATAAGTCCCCACGGTATT
GGGTTTAACCTTATTGATTTAACATCCTTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043615.1\|WP_013728645.1\|344105_344996_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|226652
NZ_CP043615.1\|WP_013728641.1\|338605_339790_-\|DUF2075-domain-containing-protein	unknown	unknown	gnl\|CDD\|378274
NZ_CP043615.1\|WP_013728640.1\|338170_338527_-\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|227613
NZ_CP043615.1\|WP_013728655.1\|358623_359793_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043615.1\|WP_013728647.1\|345708_346419_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP043615.1\|WP_149315548.1\|350880_351177_-\|hypothetical-protein	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374655
NZ_CP043615.1\|WP_013728642.1\|339925_341494_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|224490
NZ_CP043615.1\|WP_041805737.1\|356336_356735_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043615.1\|WP_149315546.1\|337253_337928_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP043615.1\|WP_013728649.1\|348817_349489_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP043615.1\|WP_013728654.1\|357518_358550_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP043615.1\|WP_013728643.1\|341572_342844_-\|oligosaccharide-MFS-transporter	unknown	unknown	gnl\|CDD\|340862
NZ_CP043615.1\|WP_013728646.1\|345042_345624_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043615.1\|WP_013728650.1\|349485_349791_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP043615.1\|WP_013728648.1\|346686_347733_+\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|379207
NZ_CP043615.1\|WP_011373852.1\|351193_352114_-\|IS30-like-element-ISLsa1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP043615.1\|WP_013728644.1\|342869_343835_-\|family-43-glycosylhydrolase	unknown	unknown	gnl\|CDD\|350138
NZ_CP043615.1\|WP_013728653.1\|356989_357430_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP043615.1\|WP_149315547.1\|349768_350674_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP043615.1\|WP_149315549.1\|352178_356033_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653

Protein	Function_ID	Function_description	E-value
NZ_CP043615.1\|WP_013728645.1\|344105_344996_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|226652	COG4189, COG4189, Predicted transcriptional regulator [Transcription].	3.44066e-107
NZ_CP043615.1\|WP_013728641.1\|338605_339790_-\|DUF2075-domain-containing-protein	gnl\|CDD\|378274	pfam09848, DUF2075, Uncharacterized conserved protein (DUF2075). This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.	2.68281e-133
NZ_CP043615.1\|WP_013728640.1\|338170_338527_-\|YxeA-family-protein	gnl\|CDD\|227613	COG5294, COG5294, Uncharacterized protein conserved in bacteria [Function unknown].	3.93578e-11
NZ_CP043615.1\|WP_013728647.1\|345708_346419_-\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	7.53859e-18
NZ_CP043615.1\|WP_149315548.1\|350880_351177_-\|hypothetical-protein	gnl\|CDD\|374655	pfam16595, Cas9_PI, PAM-interacting domain of CRISPR-associated endonuclease Cas9. Cas9_PI is a family found at the C-terminal of bacterial type II CRISPR system Cas9 endonuclease. This domain adopts a novel protein fold that is unique to the Cas9 family. It is positioned in the structure-DNA-complex to recognize the PAM sequence on the non-complementary DNA strand of the crRNA. PAM sequence is protospacer-adjacent motifs on DNA. See family CRISPR-DR2, Rfam:RF01315. Cas9 carries two nuclease domains, HNH and RuvC, which cleave the DNA strands that are complementary and non-complementary to the 20 nucleotide guide sequence in crRNAs, respectively.	4.88154e-12
NZ_CP043615.1\|WP_013728642.1\|339925_341494_+\|amidohydrolase	gnl\|CDD\|224490	COG1574, COG1574, Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only].	3.46304e-112
NZ_CP043615.1\|WP_149315547.1\|349768_350674_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.42369e-98
NZ_CP043615.1\|WP_013728649.1\|348817_349489_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	6.49203e-99
NZ_CP043615.1\|WP_013728643.1\|341572_342844_-\|oligosaccharide-MFS-transporter	gnl\|CDD\|340862	cd06172, MFS_LacY, LacY proton/sugar symporter family of the Major Facilitator Superfamily of transporters. LacY proton/sugar family (also called LacY/RafB family) symporters are integral membrane proteins responsible for the transport of specific beta-glucosides into the cell accompanied by the import of a proton. Members include lactose permease (LacY), raffinose permease (RafB), and sucrose permease, which facilitate the transport of beta-galactosides, raffinose, and sucrose, respectively. The prototypical member, LacY, contains 12 transmembrane helices connected by hydrophilic loops with both N and C termini on the cytoplasmic face. The LacY/RafB permease family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.17191e-162
NZ_CP043615.1\|WP_149315546.1\|337253_337928_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.82084e-14
NZ_CP043615.1\|WP_013728650.1\|349485_349791_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.37156e-27
NZ_CP043615.1\|WP_013728648.1\|346686_347733_+\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|379207	pfam13472, Lipase_GDSL_2, GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.	4.31867e-13
NZ_CP043615.1\|WP_011373852.1\|351193_352114_-\|IS30-like-element-ISLsa1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.37768e-76
NZ_CP043615.1\|WP_013728644.1\|342869_343835_-\|family-43-glycosylhydrolase	gnl\|CDD\|350138	cd18817, GH43f_LbAraf43-like, Glycosyl hydrolase family 43 such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43. This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with alpha-L-arabinofuranosidase (EC 3.2.1.55) activity. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. Characterized enzymes belonging to this subgroup include Lactobacillus brevis (LbAraf43) and Weissella sp (WAraf43) which show activity with similar catalytic efficiency on 1,5-alpha-L-arabinooligosaccharides with a degree of polymerization (DP) of 2-3; size is limited by an extended loop at the entrance to the active site. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	0
NZ_CP043615.1\|WP_013728653.1\|356989_357430_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	9.76319e-53
NZ_CP043615.1\|WP_013728654.1\|357518_358550_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.97855e-91
NZ_CP043615.1\|WP_149315549.1\|352178_356033_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	8.9226e-139

>NZ_CP043615.1|WP_013728648.1|346686_347733_+|SGNH/GDSL-hydrolase-family-protein
MINFFNKHIKLFFAAFVVASISFGIYSHPTADKASVQVEYTTQTHPHAFALKKNAKLYTDVHLAKSVSAKKFLKTAWYRSQAAKLICGGKSKIVYRISSANQKYKFWVLNSAVTDITSKSYNVKLASAGNKYAGEKIGVFGDSIPAGWDGYHFYLNSSYPDWTAKYLGTNTAVENFACPSGRIVGNRYAYLGTTLVPQDLSAAIKAHRNDIKKMNVIFVHIGTNDYTNYSGSGSLKNVMRHLRYNIKLIQKLNPSAKIYGILPISRFDANGMNRDNMSDMYGYTYHDLRAAEARLYKSMGAKVVNFQQIAPNIITDSNKDITLKDHEIHPTAQTAQKLGYALAKSIVK
>NZ_CP043615.1|WP_013728647.1|345708_346419_-|alpha/beta-hydrolase
MNFKQVVFDKDKEIKLDIYDADSDVALPGIVVIPGGSYKTFKERDAARVALTFLTKGYQAFVVEYPVNEKKNYQDAKQSISMAFDYITDHAKDLNVDTDKLGVIGFSAGGQLAAAYSNQKDTKAKFAILGYPVLTQALDEKIGIHSEDVTKQVTKNTPPTFLFGARSDGLAPYIDHIYPYTEALFKNNVNFEVHEFATGGHGFSLANQFVGVVNRDRTDEHFAKWFPLCLEWLQSL
>NZ_CP043615.1|WP_013728646.1|345042_345624_+|hypothetical-protein
MREFILSFLDTQPNHVDLKTVQKLIDYGKNNKYTAPMLLTQLNQMDDAHEKVLTVTFDVDFIDGVKLFNNHATKWLTDKGKAYIQELKRAQNKAETIDFPKDDTQTESTEFDGYLSQLMSVGKSMKSQSERLTLQEFALELRHLLTDTKKLDKGALNKFKPFVDRNWNELSTPMTPILVELSRRFLIENSYDD
>NZ_CP043615.1|WP_013728645.1|344105_344996_+|ArsR-family-transcriptional-regulator
MDLDISQDSLEVYKALASPVRIQIIQTLSSKRMSVQELSKKLKLSSTIILMHLSKLEDAGIIGFEREGHSKISYLKVDNINVHFPTTIYPAFAEYETQVPVGQFTDYSVTPSCGLAGKNDYIGKVDNPKYFMSPERIKAGMIWWTNGFVEYQFPNYLEEKDKLEMLDLSMELGSEFPFSNNVWPSDITFYINDVEIGTWTSPGDFSDIRGKYTPAWVPDNVNQYGQLKVVRITDHGSYLDGQPFTDISIDDIDWKKPTFTVRFAIKDSAKHKGGCTIFGQGFGNYDQDIQMKLFHS
>NZ_CP043615.1|WP_013728644.1|342869_343835_-|family-43-glycosylhydrolase
MTVYTNPLIVQRADPYIYKHTDGYYYFTASVPAYNLIEIRRAKTLEGLAHAAPRTIWRKHESGPMSQLIWAPEIHYIDGKWFIYFAAAETTALDKNGMFQHRMFCIECDNADPMRSEDDWFEHGQVKTGMDSFSLDATCFEANDMLYYVWAQKDPDIKGNSNLYIAEMENPWTFKTKPVMLSKPEFDWETIGFWVNEGPAVIHRNGRFFLTYSASATDEHYAMGMLSIPDDQDLLDASNWTKSKKPVFQSDMATHQYGPGHNSFTVGEDGKTDILVYHCRDYTEIKGDPLYDPNRHTKVQPFTWNEDGTPNFGKPVPYNYD
>NZ_CP043615.1|WP_013728643.1|341572_342844_-|oligosaccharide-MFS-transporter
MDNSAKMPEKKEKKDFWGFPFTHFTYFFNWQIINGYLTLWLEQVAHLNGAEAGVVFSMMAGMSLLFQPAFGVISDKLLFKKNLIITIAIAAIFIGPYFQWLFIPFAHISNMFAAVITGIFLSFIFNGGVSVIEQYVQRASLANGFEYGHSRMGGSLAGMCASFLGGQLFIWKPYSIFWACTVSAIILTGLLIFSDKVHLENASAAGNTSDKIDWGQIGKIFKIKNFWYLSIFYIGASAIYDVFDQQFIIFFKTFFNTAAQGTQAYSYMTTAQIGLEFLLMFPMPWIINRIGSRNGLIAYGCILAIRIIGSALSPSLIWVIVLRLLAGLEMPLVLVSIMKYIAGAFDIGVYATVYALASNFAKQISVFIFSSVAGNLYDAIGFHQTYLILGAIVAVVTVFAAFALKKENPVQAGECDESGKPKE
>NZ_CP043615.1|WP_013728642.1|339925_341494_+|amidohydrolase
MPTFINGKIFTGIDQTTFVSAMTIEDGHVTWIGESDEINDSETIDLHGKTVLPGLIDVHTHPKYIADALHGVACTPPNVNSIKDMQAALRQSPAFGKGPDTWIEGWGFDETKLAEHRTPTVDDLDEISTTQPIFVYRSDCHSSIGNSKALELAGITATTPDPVGGFIGHFDDGRPNGYMKEVAATQLLIKAKSAQSYQGDVDNMANSSRHYLQNGIVAIGEMMGRIRPYDSLKLYQDAVKAGFKPKSSIYYVYDEVAGNTHLQPTNDDQLRVAGIKVFMDGSISGETAYNQQPYPSGQNGVCLTDATKLKQAVTYAKQQHLQVAIHAMGDAAIQLILDVTDKLQPWLSDRPSIRIEHASILSNQMLKQINMATMNYALVTQPIFFFAEDESYRHYLSPQQFNEAYRVKSMMNTKAEFALSSDAPCTPWAEPDSPFVNIYAAVTRTAVNGDVVNPEEAITVPDAVLAYTSWPARIGGFSDNGQLTPGYAGDFVVLDRDIFSVPHEELKDIRVAETWMGGEQVY
>NZ_CP043615.1|WP_013728641.1|338605_339790_-|DUF2075-domain-containing-protein
MESLESHTLNAFSKNIELTDHQKAVLKQIDAFSRQHLKEDGHAVFVLMGDAGTGKSLILNQLFTELAQVVDDAYFLVNHPELLKVYRELAGQTPHMLKKYYQRPTSFINQMHKQGKQVNLTVVDEAHLLLSKPDHYNNYYGDNQLQDIINLSRVTIVVFDPHQVLRTKSFWNKARLEKLIAPYPHDLVHLKQQFRMQAGPKLMNWLDHFIDGDVIPAIPSDVGDYDFRIFADAEKMFQTIIKKNDQYGLSRMTSTSGYPSTLDGGKHLVNEGNFHLPWDQYNFTSTPWAEQPQTIDEVGSIYTVQGFDLNYIGIIIGPPFYLTADNRLGVDPSKVTDVEIFKHRSDMSKKDYEESKVELLRNSLNVLLRRGIKGMYLHAHDPRLERYLEEMMPK
>NZ_CP043615.1|WP_013728640.1|338170_338527_-|YxeA-family-protein
MKKRTIIILAVLVVLGAIGGIWYHHNYARIFYYGQVGKLERTENSPGNNPDVHYYLIKAYNDKGQGKTLEVGSVDGKYFVKGHYIKIGYSRSKNVVDYEGIPYSQVPKAAKEKLNHSN
>NZ_CP043615.1|WP_149315546.1|337253_337928_+|CPBP-family-intramembrane-metalloprotease
MNPTRYLITKSTQILKFVGFLATYIVAESVFEIAGQYIKDPLSARHLLGLALVLIAGALALIGWRYGKQLAANNPRHFGRRHPTAKRIAQLLWIFILMTAIQILWQWLIANHVLTTPSNQQAVEAAEVKMPMWNIFFGGILAPIFEELIFRGIFMNYFFNKDNRLNNILAVIVSGSLFGFAHEMSFDLTWIMYSALGCCLSFAYMHFRDIRYSIALHMMNNLIP
>NZ_CP043615.1|WP_013728649.1|348817_349489_-|type-II-A-CRISPR-associated-protein-Csn2
MKISYAGHQEIELNSKNPTVIATNNPTVYHDLVVGLSSFSDKVKVFDDNFELVEVKDVIDWQGDVGLSDGVSDKYNSGIFKQLEAVLTDDQRKSITDINNQLYTVVQQCLFMIDLPLEVTYDWDLKRLFKYCKIHFNTDAMQNPYAIIESIIKIHLECGLKSAVGLTNVAHYLNQQQFIDLSNLASSTGISTLLVEFTDMKSQELYTNCDFYYIDEDFVDWHL
>NZ_CP043615.1|WP_013728650.1|349485_349791_-|CRISPR-associated-endonuclease-Cas2
MRLMVMFDLPVETSENRRNYRKFRKALINEGFLMIQFSVYVRVCVNKKSADFMEKRIAAIAPPEGLIQSLIMTEKQYNDMHFIAGKPKEDVRNSSERTIIL
>NZ_CP043615.1|WP_149315547.1|349768_350674_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRSVVISQHAKMSYSSRNMIVQTMDGINQVPIEDIDLLLVSTTQAVITTALISELVKSQVKIIFTDNANEPVCETVGYYPNSRDVDLIKKQFCWDEKRQQFLWTRIVVSKIVNQVNVLSIYGVENSDLIAELDKLEIDDVTNREAVVARKYFPLLFDNKFSRRDFSPVNAALNYGYSILLSNVNREIVSNGYLTYLGIHHHSNDNQFNLGSDLMEPFRPVIDYWLANQNFKELTPDVKFGLVDLLNLEMKFNGKEMLFRNIISEHVRNCLKYLSGETDEIQIEVELKNEVPNNAINGNV
>NZ_CP043615.1|WP_149315548.1|350880_351177_-|hypothetical-protein
MNKFRHKLNLGFSKFISFPNHNVFDGNTKASSGKREILEEVLNGLHANPTFGNLKDIGITTPFGQLQQPNGILLSDEAKIRYQSPTGLFERTVSLKDL
>NZ_CP043615.1|WP_011373852.1|351193_352114_-|IS30-like-element-ISLsa1-family-transposase
MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDRVKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIAAAYNLSTASIYNWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRACSD
>NZ_CP043615.1|WP_149315549.1|352178_356033_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKVNNYHIGLDIGTSSIGWVAIGEDGKPLRIKGKTAIGARLFQEGNPAADRRMFRTTRRRLSRRKWRLKLLEEIFDPYITPVDSTFFARLKQSNLSPKDSRKEFKGSMLFPDLTDMQYHKDYPTIYHLRHALMTQDEKFDIRMVYLAIHHIVKYRGNFLNSTPVDSFKASKVNFVDQFKKLNELYTAINPEESFQINLANSEDIGHQFLDPSIRKFDKKKQIPKIVPVSVDDKATDKINGKIASEIINAILGYKSKLDVVVQCTPVDSKSWALKFDEEDIDAKLQKILPEMDENQQSIIAILQNLYSQVTLNQIVPNGMSLSESMIEKYNDHHDHLKLYKKIIDQLADPKKKAALKKAYSQYVGDDGKVIEQADFWSSVKKNLDDSDLSKQIMDLIDAEKFMPKQRTSQNGVIPHQLHQRELDEIIEHQSKYYPWLAEINPNKHDLHLAKYKIEELVAFRVPYYVGPMITPDDQAKSAETVFSWMERKGKEAGQITPWNFDEKVDRNASANRFIKRMTTKDTYLIGEDVLPDESLLYEKFKVLNELNMVRVNGKLLKVADKQAIFQDLFENYKHISVKKLQNYIKSKTGLPSDPEISGLSDPEYFNNSLGTYNDFKKLFGNKVDEPDLQDDFEKIVEWSTVFEDKRILREKLNEITWLSDQQKDVLESSRYQGWGRLSKKLLTGIVNDQGERIIDELWNTNKNFMQIQSDNDFAKRIHEANADQMKAVDVEDVLADAYTSPQNKKAIRQVVKVVDDIQKAMGGVAPKYISIEFTRSEDRNPRRTISRQRQLENTLKDTAKSLAKSINPELLSELDNAAKSKKGLTDRLYLYFTQLGKDIYTGKPINIDEISTYDIDHILPQAFVKDDSLNNRVLVSKAINNGKSDNVPVQLFGAKMGHFWKQLAEAGLISKRKLKNLQTDPDTISKYAMHGFIRRQLVETSQVIKLVANILGDKYRNDNTKIIEITARMNHQMRDEFGFIKNREINDYHHAFDAYLTAFLGRYLYHRYIKLRPYFVYGDFKKFKEDKVTMRNFNFLHDLTDDTQEKIADAETGEVIWDRENSIQQLKDVYHYKFMLISHEVYTLRGAMFNQTVYPASDAGKRKLIPIKADRPINVYGGYSGSADAYMAIVRIHNKKGDKYRVVGVPMRARDRLDAAKKVSDADYDRALKDVLTPQLTKTKKSRKTGEITQVVEDFEIVLGKVMYRQLMIDGDKKFMLGSSTYQYNAKQLVLSDQSVKTLASKGRLDPLQESMDYNNVYTEILDKVNQYFSLYDMANSIINPNRN
>NZ_CP043615.1|WP_041805737.1|356336_356735_-|hypothetical-protein
MNADKLKRVKKRYKQSGHHKLQTRIFKTNDPRLRLFDFDYGVVMGLTSNTEGMSDVEMSDAIGYNSSQLGYDVYRMPDGQFLIDGVEKDQVFSQHDGCPVLLLVPPTLPEKSRIALENKIFEHRNEGPHPFY
>NZ_CP043615.1|WP_013728653.1|356989_357430_-|MerR-family-transcriptional-regulator
MTYSIKEVAEKTGLSIYTLRYYDKQGLLPFVSRNEAGYREFTDSDLNFIHTICCLKNTDMKIKDIKKYIGYCMQGAASIDDRKQLLLKHRQEVLAKQRLLADNLKEIDYKLNVYTDPNSQAIIDREVAYVQDEKAKNHLADPFAVK
>NZ_CP043615.1|WP_013728654.1|357518_358550_+|aldehyde-reductase
MIKKVLVTGGNGFLGLRIISQLLAKGYDVRTTLRSLDKQSLVLDTLAANNIANLDQLEFVRADLSKDDGWQEAMNGITDVMSVASPVFFGNTKDKNAAMRPAIDGITRNVQAAQNAGVKRLVMTANFGGVGFSNLDKNSITDENDWTNPDQKGLSLYEKSKLLAEKEAWKLVNESDNSMALTTINPVAILGPAMNGHISGSFGILENLMNGSMKHIPNIPLNIVDVRDVADLHIRAMENPNAAGERFIATADGQITMPEMATIIRQHYPQLKSEVADKILPNWVVRVGSLFNQQAKEGQLLLDVNRNVSNQKARDLLGWQPVGSIEKTILDTLQSMDKFDLLK
>NZ_CP043615.1|WP_013728655.1|358623_359793_-|hypothetical-protein
MKKLVKLVGVMLAFVVFAVVASPQPAQAAHNNYRVKTLKTYQNYSNYTEDVAFHAKAKTKASVWNNQEFDKNIKSNVFYKKGYKLANHKTTTWFVEKKVRIYHKLKSATYYYVANRTGNMQGYVRTNALTPGFSPYGYQIISTKWYNKYDYFHVKDSYKAKNVYVWNYTHTKKRANLKDYPGAVFQKTHTVVMQHNGKDTKYVYLSGTLNGTTKSTRGYVAESAITGGLNPDHTGMNYVDIGYFVNNTDFNQYLQTGKNQKLAREIIKLFPNSQPDLGLSKIAAYNYDSFDNDIDGDPSPISTTGYTDIKTFPAIQKWLYTNHNASNATKIAGVKKLLNAEGYTDSKRASLSGYKLGIQIVNNIVMPSGESGDLASRYGYVFILGKVDN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043615_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043615_2

1589128-1589260

Orphan

Consensus_repeat	Method
GAAACCGAGTCAGGTTTTCGGCTGGAGGGGCTTAAAATCCAAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043615_2

>merge|NZ_CP043615|2|1589128-1589260|CRISPRCasFinder
GAAACCGAGTCAGGTTTTCGGCTGGAGGGGCTTAAAATCCAATCGCTGTCCTCTTTCACACGTTTAATCAAGATAAAAGTGAGACACAACGAAACCGAGTCAGGTTTTCGGGTGGAGGGGCTTAAAATCCAAT

>NZ_CP043615|2|2|1589128-1589260|CRISPRCasFinder
GAAACCGAGTCAGGTTTTCGGCTGGAGGGGCTTAAAATCCAAT	CGCTGTCCTCTTTCACACGTTTAATCAAGATAAAAGTGAGACACAAC
GAAACCGAGTCAGGTTTTCGGGTGGAGGGGCTTAAAATCCAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043615.1\|WP_013727455.1\|1594671_1595229_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043615.1\|WP_133286481.1\|1593632_1594577_+\|phosphoglycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|240649
NZ_CP043615.1\|WP_049775766.1\|1588332_1589100_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP043615.1\|WP_013727447.1\|1587371_1588166_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP043615.1\|WP_013727458.1\|1597327_1598194_-\|DUF3737-family-protein	unknown	unknown	gnl\|CDD\|378875
NZ_CP043615.1\|WP_013727443.1\|1581208_1581589_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043615.1\|WP_013727445.1\|1583645_1584605_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214988
NZ_CP043615.1\|WP_013727444.1\|1581772_1583662_+\|beta-galactosidase	unknown	unknown	gnl\|CDD\|236548
NZ_CP043615.1\|WP_013727457.1\|1596155_1597328_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|224090
NZ_CP043615.1\|WP_013727453.1\|1593169_1593622_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP043615.1\|WP_013727452.1\|1592469_1592820_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043615.1\|WP_013727449.1\|1589373_1590201_-\|matrixin-family-metalloprotease	unknown	unknown	gnl\|CDD\|239796
NZ_CP043615.1\|WP_013727442.1\|1579887_1581180_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP043615.1\|WP_013727451.1\|1590898_1592356_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP043615.1\|WP_056938996.1\|1586744_1587266_+\|oligogalacturonide-transporter	unknown	unknown	gnl\|CDD\|225121
NZ_CP043615.1\|WP_041805854.1\|1584763_1586650_+\|DUF2264-domain-containing-protein	unknown	unknown	gnl\|CDD\|378358
NZ_CP043615.1\|WP_013727450.1\|1590316_1590811_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP043615.1\|WP_056938983.1\|1578446_1579310_+\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|379135
NZ_CP043615.1\|WP_149315685.1\|1595411_1596068_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NZ_CP043615.1\|WP_013727440.1\|1577055_1577964_+\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361

Protein	Function_ID	Function_description	E-value
NZ_CP043615.1\|WP_133286481.1\|1593632_1594577_+\|phosphoglycerate-dehydrogenase	gnl\|CDD\|240649	cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	4.20423e-130
NZ_CP043615.1\|WP_013727450.1\|1590316_1590811_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.10738e-11
NZ_CP043615.1\|WP_013727447.1\|1587371_1588166_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	8.88807e-13
NZ_CP043615.1\|WP_013727458.1\|1597327_1598194_-\|DUF3737-family-protein	gnl\|CDD\|378875	pfam12541, DUF3737, Protein of unknown function (DUF3737). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 281 and 297 amino acids in length.	5.26188e-169
NZ_CP043615.1\|WP_013727445.1\|1583645_1584605_+\|hypothetical-protein	gnl\|CDD\|214988	smart01038, Bgal_small_N, Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.	1.97946e-90
NZ_CP043615.1\|WP_013727444.1\|1581772_1583662_+\|beta-galactosidase	gnl\|CDD\|236548	PRK09525, lacZ, beta-galactosidase.	1.24403e-165
NZ_CP043615.1\|WP_013727457.1\|1596155_1597328_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	9.17572e-149
NZ_CP043615.1\|WP_013727453.1\|1593169_1593622_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.748e-55
NZ_CP043615.1\|WP_013727449.1\|1589373_1590201_-\|matrixin-family-metalloprotease	gnl\|CDD\|239796	cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.	2.9387e-09
NZ_CP043615.1\|WP_013727442.1\|1579887_1581180_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.57476e-23
NZ_CP043615.1\|WP_013727451.1\|1590898_1592356_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	8.64815e-54
NZ_CP043615.1\|WP_056938996.1\|1586744_1587266_+\|oligogalacturonide-transporter	gnl\|CDD\|225121	COG2211, MelB, Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism].	5.95447e-18
NZ_CP043615.1\|WP_041805854.1\|1584763_1586650_+\|DUF2264-domain-containing-protein	gnl\|CDD\|378358	pfam10022, DUF2264, Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.	1.43561e-126
NZ_CP043615.1\|WP_049775766.1\|1588332_1589100_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.16403e-09
NZ_CP043615.1\|WP_056938983.1\|1578446_1579310_+\|tyrosine-protein-phosphatase	gnl\|CDD\|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	1.46549e-69
NZ_CP043615.1\|WP_149315685.1\|1595411_1596068_+\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	5.38104e-09
NZ_CP043615.1\|WP_013727440.1\|1577055_1577964_+\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	7.2116e-90

>NZ_CP043615.1|WP_049775766.1|1588332_1589100_+|CPBP-family-intramembrane-metalloprotease
MIKNKMSWGKEFWLAALFLVLLMGVDFSVRGAGPLVCGGARLMFALVVAGIVFYVLGTMKIFQTKVKLGTFAKIWGFIFGICLGGLFLLISILGHTALMMHAKTVVADTMMALSAGIFEEFLCRGLLFSAFLSVFKQAKYKFTEAALASGIFFGLFHFMNLISGQGFLPTLQQATYAFVIGAIFASIRLTTNTLTWVVLIHALIDWQPGISVTHTVSALASWPVFLAVWGTILVVTVIFLISFDSSYRQSVKEDV
>NZ_CP043615.1|WP_013727447.1|1587371_1588166_+|alpha/beta-hydrolase
MTNLVIKKDVEYDAVHHQLTDIYYDGEKAQSKGAIIDIHGGGWFRGNKSKDEDSSIRFVEAGYLVVTPAYRITSAAFYPAPLEDMDHLYEWLKKSDLPFNHDHIGAFGSSAGGNMTVELAIKYGIPIASLSGILDIDKWLSEHEDVVAAEGDTSGFNSTASSNINQTGANDPFYKWFVTNYFNGRTDQYTEATPVHRVTDQTGQMYLANSLNEFVPTSGVLDMAQALTKHQIPYRTRMLTGSRHAKGYLDDVWDDVVGFFAQTL
>NZ_CP043615.1|WP_056938996.1|1586744_1587266_+|oligogalacturonide-transporter
MIWLVIFMIFWEVGLYILYFAPWNAFPFIPDLDTLVTGRNRAGLFASVMTFVNQISVGVAGVVAGYLLDFAHFRESASGAVVQPQSAINMIIFIVSGGVGLMIVLAMLFVGRFHLSKKTFMVLSAELVRLQKGGSMSDVDPHPKAVCEDLTGVKYDSIEVWKKDDQPQNKSRG
>NZ_CP043615.1|WP_041805854.1|1584763_1586650_+|DUF2264-domain-containing-protein
MKRKLFNEQIKDNPLRSKADVKAALVDILAPAMEVLAQQKRKGRFRMSDSGAVYLQDKTEVEGFMRLLWGLGPFFSDKKRVYERPDWYELVTQGILAGTDPDDPDYWGGDLGDYDQVFVEMGALTAFLYETKDYFWDNLTVKKQKTIVKWMDQVNHKVIPKTNWLFFRAMVNQFITDSGYMDNSELIDADYAITNKHYLGHGWSYDGYVNQIDNYIPFAYQFFTILTVGLAHTDNKQSQLLKERAQKFVPSYANWFAADGAALPYGRSLDYRFAQAAFWAAYAYAHVDMPEGYSLGDIKHLLLNNLRWWFQQNIFQTDGLIPIGYAYPNMNFAEGYNGPASAYWALKTFIFFALPDDDPFWTTKESDDFKFEALKKQPEPRMLIAHSQNGLEVQSFTAGQHSHEHAHGEAKYEKYVYSTTFGFSTPKGSVLLKQGAYDNTLAVAESENFWQTAFKYDDYAIHDNYVYSDWKPYDDVEIKNFVVPAMPWHVRVHEVNTGRELHLAEGSFSAPDSGAPDEYEMKTRAANAVFYHSRVGITGLVGLSKELTTELSTPEPNTNLYFNKTKIPLQTGVLAPGKYTLISLYLGDRELESLDDDGKIVIPEVKLDGNKLTISFNDHTVGADFDEF
>NZ_CP043615.1|WP_013727445.1|1583645_1584605_+|hypothetical-protein
MDNTNKQLHLVYGDGGLGVGGDNFHYIFNYTRGGMESMVVDGREWMYREPKPTFWRATTDNDRGNGFSKQAVQWYGADMFASADKVDIKINDQLIEFPSAPRNNQYSNHEYADKVEVIYHFATLTIPSTDVEVHYTVTGDGVISIHAHYAGNDQLPDLPVFGMRFILPTAATGYEYAGLSGETYPDRMAGGIPGEYRIDGLPVTNYMVPQDCGVHMKTDWVTVTRNATKVSSDHSDTPFSIKFESDGQPFAFSCLPYTAEELENATHQEELPLPRRTVVSILGAVRGVGGIDSWGRDVEEQYHIPAGKDIDFGFKITKA
>NZ_CP043615.1|WP_013727444.1|1581772_1583662_+|beta-galactosidase
MEPDIKWLDDPETFRVGMLPAHSDHQFYQSADEIRNNHSSYVQSLNGQWQFAYAKDPMHRIKNFYAADFDSSDFDAIQVPQHIEFAGYDDFHYINTMYPWEGKIYRRPAYALDQNDQEAGQFSEAVDNPVGHYIKKFTLNSAFKDKKVRVRFDGVEKAMYVWLNGHFLGYAEDSFTPSEFDLTPYLQDGENTLAVEVFKLSTAAWLEDQDMFRFFGIFRDVSLIAQPEAHIEDLSIKPTLSDDLKDGTLNVTTKMTVNKSGATAKVSVTDADGNGLYADSQSVDDAITLSNVSFKNVHLYDNHDPYLYQLTIEIDDQDGNVLEIVPYKFGFRKIEINQDKVITLNGKRLVINGVNRHEWDCHSGRVVSVDDMKADIRTFKQNNINAVRTCHYPDHTLWYHLCDINGIYVMAENNLESHGTWQKLGAVEPSYNVPGSVPQWKAAVIDRARNNYEMLKNHASILFWSLGNESYAGDDIAAMEQFYKQADPTRLVHYEGVVQNRKYEDVISDVESRMYASPDEIQDYLDHNPKKPFLLCEYMHDMGNSLGGMKSYIDLIDKYPMYAGGFIWDFIDQAIEVNDEITGQKVLRYGGDFDDRMSDYEFSGDGLMFADRTEKPAMQEVKYYYGQHK
>NZ_CP043615.1|WP_013727443.1|1581208_1581589_+|hypothetical-protein
MSVNSEDWKQALQSKEAFADFIYDYFKDHKDLTGNYETPSYYEYYVVTLDSKEGLIITLKTGLNQNTGDINAPLPFKDVEHISVEDFRQLVLNKKFEDQSESLTDVFSKMLASEPNARFNRGQDGK
>NZ_CP043615.1|WP_013727442.1|1579887_1581180_+|MFS-transporter
MAKKDEEKDAVKTTVGVVTNAKIKDEQQPKLPWMISSAMFLAPLCWYGPIGSTRSVLIPQLFAQLDPAHKVWAVGILATIASITGAVTNLLFGALSDVTRTRFGKRKPYIVLGTIAIAISLVLIANMKSIVAIIAIWIVAAAAENAIAAAIYPQISDRVAPKWRGTVSTFYGVGFTIAQQGFALLAAQFLGNVKFGIYFMAGCTVILALIHELLIQEKGNLDEPKVKFDKDSLKKYFFFPTHDARDFYLALFGKFFMVVGSTIVTTFLLFIFTDYIGQSTGQAGTSISIFSSIMLFIGVFFALVGGPLADKLGRVKAPVVIATFALGAAALFPLFVKEPWAMFAYAVIAAFGNGLYNSVDGALNMDVLPSSDTAGKDLGLINLANTLGQMLGAMVASAIVEAFGYGAIFIFAIGMELIGGIAIAMIKRVK
>NZ_CP043615.1|WP_056938983.1|1578446_1579310_+|tyrosine-protein-phosphatase
MKEQNESFVASALSEGAIPAAGEATNTFSVSQPALRTLKSVKEHEIHLQGAFNVRDMGGYPTKDGLVVKSHLLLRSARLNALTSADVNTLINTYNLGVDFDLRRPEEVSELPDRSLPGVKYINDSVDTRETYYYQINAENNRKHYRTYVTSEHARKVYHNLFMALLEKPMGKSLLWHCASGKDRTGVAAALILYVLGVDSRTIFKDYVASNDFLKPRIDARIARLKEKGATRSEIKFAKVDGGVDLSYLKAAIDEVKRDYGSVADFITNGLHITKEQQARLQEMYLA
>NZ_CP043615.1|WP_013727440.1|1577055_1577964_+|magnesium-transporter-CorA-family-protein
MIKPEKTINGTKWIETIQINAEERATLEDQYGIDEDIIEYVTDKDESTNYVYDINEDDQLFIFLAPYALDKDALRYITQPFGMLLHKGVLFTFNQSHIPEVNTALYSALDNPEVKSVDAFILETLFAVVDSFIPISRGITKKRNYLDKMLNRKTKNSDLVSLSHLQQTLTFLSSAVQTNLSELNRLPKTHFGVGADQDKIDLFEDVQIEGEQVQRMFEIETQVVDRIDHTFNSIANNNLNDTMKFLTIWSLTMAVPTIITGFYGMNVKLPLAGMQYAWMLTLGISVALIVAMLIMLKVRRKM
>NZ_CP043615.1|WP_013727449.1|1589373_1590201_-|matrixin-family-metalloprotease
MKKRSFILAAVASATFALAVPLTLNMPQSPITYAKSTQRIAGKTVAKAIKSTPDLNPTSSVRKYPAYIYDKYWQVFDRWYNVQPMSAQGIFKNHTAKVYVANQSLKSYTYAAMQNWNKALKTKAFKLGTKADHTITVGFKNAGTGQGSWDGYYITSKLYINYNFFDNTKYLPAVYKAETGHALPSADQPNSADYQALYDTYWKSVITHELGHSLGLDHTPYSNDIMEADSGTKSGDAKYSWSQSKVVNDDYAIFQDKLSSRDINRAKLTKVLGYW
>NZ_CP043615.1|WP_013727450.1|1590316_1590811_-|GNAT-family-N-acetyltransferase
MKLHYQPARMDELTAIMVIEEAGFSPAEAATKTAMAERIRLYPDTFIVATNEANQVVGYIVGPAFSQRYLTDELFEQAHANRRDDPYQTVLSLAVHPDFRGHGIASRLLSELAQVAKAQSRVAITLTCLADLIPFYESNGYQNEGISASSHAGETWYNLVYPLQ
>NZ_CP043615.1|WP_013727451.1|1590898_1592356_+|MFS-transporter
MNHSNIGHRNRGVILIAVFIATFMTSVEVTIVTTALPSIISELHGLAYQSWIMSAYLLTTAITTPIYGKLADTLGRRKVFQWGVTVFTIGSLLSGLSPSILFLIVARAIQGIGAGAVMPLTFTIIADIFSFEQRANVLALNNTAWGLSALVGPLIGGFLVDHLSWHWVFFVNVPLGIIVALLIWLGYQENIELKNQLIIDWLGIIWLAISLVSLLLGIQALDTLPLIAASLLIVTIVATWLFLRHEKHFADPLISPKMFHSKTFTIQIITATILSGVLIGYQMYFPIWLQSLYRVSATTAGLVVTSSSIMWLVASFFVGKLIAHFVPKQIAVTLIGVMLLSYLSLIFASQAFPVWAFYVIAMINGIGMGIVVSMNTILSQHLVPNEMVGSATSVLTLGRSLGQTVMAGVYGAILNLVIRLQLHGGITFSKVNNVISSKGAAVVANRSLIDPIILTALHMVFVGVVAMLVVVLVINILDPNKKIIR
>NZ_CP043615.1|WP_013727452.1|1592469_1592820_-|hypothetical-protein
MTNTDWKASLKSPKAFNDFIINYFKDHKELTGNYETPSYYEYYTVTLNSEKGLVITLVSSINPTVNADAPTIPFKDVETISVEEFRQLILNKKFADMHTSLADVFQTVAGVPGSTK
>NZ_CP043615.1|WP_013727453.1|1593169_1593622_+|NUDIX-hydrolase
MATGYIGRIRKRVGHMPLILNTAAGILLNDQYQVLLNLRTDSHNWSLPGGYMEFGETYAQTCVREYQEDSGVKVEIVRPLGLFDQGIFAYPNGDQVQTIDRLFLVRKVGGQLLSAETDETIRLDYFDFDDLPPLLNQQTEKMLAFAKENV
>NZ_CP043615.1|WP_133286481.1|1593632_1594577_+|phosphoglycerate-dehydrogenase
MMADKVLVPAQLHPDGKRYLREHGLEVVELMRANAENILKNGKDAAAMILFLDPVGENVISHMPNLKIIARHGVGYDSVDLDASANHGVWVTNTPNANAATVAETTLAEIMDVSKHITKNSMEMRDGNFTYPLAHLGFDLEGKTLGILGYGKIGRLVAKKASALGMRIMIHNRTPRESPYGEFVDLDTLVKSADILTLHLAANSQTRHIIGRKQLAEMKPTSVLINLGRGALVDTAALIDALKSGSISGAALDVFDEEPLPMNSGLFKLDNVLLTPHIGSSTVESFSRMATDAASEVVRVLNGQQPQWPVNQPH
>NZ_CP043615.1|WP_013727455.1|1594671_1595229_+|hypothetical-protein
MTKTYKAEITSLNGDKIGTHPTGEATFTIDGDTLTVEITMDHTSPNTQHWMHFHGFPDGRDAQPATAAQDTNHDGYVDLPETEPVSGTTMVPFNDAPEKMDIPTDTYPTSDADGHFHYEKTVPLGEISEKFKEVFNDADLHLEKRVVYIHGVPQSMDLPDTIQGAVGKYDQHTTLPIAVGKIVEA
>NZ_CP043615.1|WP_149315685.1|1595411_1596068_+|Fic-family-protein
MENKFNLTLKQNRFLTKKNLVNMVYSNSKFEGVNTTLPQTKTIIDGMSVAGVSIDDIQVIISLKKGLEFVLSHSEPFRLDICRQINRIVAAEDALVPGQIRTGSVQIGGVQYVPPVPDVNNVKSVIQKIMGDDQTATEKALQIMYEIMRQQIFWDGNKRTAILSANYILINAGARIVNINENQLETFNTLLADYYETGDLQAIMQWTYDNCLYGIEFK
>NZ_CP043615.1|WP_013727457.1|1596155_1597328_-|pyridoxal-phosphate-dependent-aminotransferase
MYDFTSMISRRNTDSVKWDVKPNELPMWVADMDFKVAPEILDAMRQKVDFGIFGYEEPHTDYFDAVAHWYQTEHHATINRDWMFFSTGVVPTISSAVRRVTNVGDNVLVQAPVYNIFYNSIVNNGRHVLSSDLVYDQKAHQYQIDWDDLDAKLAEPLTTMMILCNPHNPIGKVWTKAELIKINQLCLKHSVTLLSDEIHGDLVFKGADYTPVFSLPNELLQNVIVCVSPSKTFNVAALHAATVIVPNEALRSKVNRGINTDELGEPNLLAIPGTIAAYTKAGDWVHELRNQIRANYEMVVKFCQANIHEIVVVPSTATYLVWIDVSQLTDDSAKLAAFIRAQTGLYLSAGDVYGGDGNHFLRMNIASPKTMVEDGLNRLQQGIKEFKATN
>NZ_CP043615.1|WP_013727458.1|1597327_1598194_-|DUF3737-family-protein
MKQYTNQYFDGERPLFAETNADISGTTFGTGESPLKESRNIHLIDSIFTYKYPLWYSKHVKVDHSILETMARSGIWYTHDIEINDSAIQAPKIFRRCSDITLNNDHFSDAKETLWNCQNIKINNVQANGDYFGMNSENISVDHLNLIGNYVFDGAKNVEVHHSTLVSKDAFWNCENVKIVDSTINGEYLAWNTKNLTLINCTIESDQGLCYIDHLTMRNCRLLRTDLAFEYCSDIDAEINSNIMSVKNPISGTIHARSIGEVIIDPTKVDPSKTTIITDNKTSKKETA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP025208	Lactobacillus sakei strain WiKim0074 plasmid pLSW74_2, complete sequence	6165-6194	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017410	Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence	5983-6012	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	38857-38886	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	9347-9376	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_022114	Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 1, complete sequence	9584-9613	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_016608	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-5, complete sequence	9047-9076	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP033890	Lactobacillus plantarum strain LMT1-48 plasmid p_2, complete sequence	24198-24227	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	46045-46074	0	1.0
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_KM063576	Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence	9346-9375	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP040857	Lactobacillus plantarum strain 202195 plasmid unnamed, complete sequence	60380-60409	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP028979	Lactobacillus plantarum strain LQ80 plasmid pLQ802, complete sequence	21796-21825	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035557	Lactobacillus plantarum strain SRCM103297 plasmid unnamed1	4768-4797	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035557	Lactobacillus plantarum strain SRCM103297 plasmid unnamed1	47023-47052	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_015603	Lactobacillus kefiranofaciens ZW3 plasmid pWW2, complete sequence	6168-6197	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032746	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed2, complete sequence	9125-9154	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP012279	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence	11905-11934	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	13792-13821	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP016492	Lactobacillus pentosus strain BGM48 plasmid pBGM48-1, complete sequence	18229-18258	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_AP014682	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence	9161-9190	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032650	Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence	16678-16707	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_011839	Lactobacillus gasseri plasmid pLgLA39, complete sequence	21950-21979	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP046657	Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence	8911-8940	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP040377	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed3, complete sequence	42712-42741	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_LT907984	Lactobacillus sakei subsp. sakei 23K plasmid pJ23A1, complete sequence	12430-12459	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_LT907987	Lactobacillus sakei strain T332 plasmid p332A2, complete sequence	12148-12177	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	16361-16390	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP014891	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence	22379-22408	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP028242	Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence	6233-6262	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	42084-42113	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032752	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed1, complete sequence	46138-46167	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP015862	Lactobacillus plantarum strain LZ227 plasmid LZ227p5, complete sequence	31970-31999	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035574	Lactobacillus plantarum strain SRCM103303 plasmid unnamed3	70737-70766	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035177	Lactobacillus plantarum strain SRCM103426 plasmid unnamed3	15963-15992	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017376	Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence	23588-23617	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP021472	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-2, complete sequence	24210-24239	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	4481-4510	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP014885	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-4, complete sequence	23730-23759	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP023493	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence	31122-31151	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP016802	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence	51864-51893	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017356	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-2, complete sequence	2444-2473	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017366	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-3, complete sequence	5741-5770	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	22672-22701	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	18121-18150	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP019751	Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence	28473-28502	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017381	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence	7057-7086	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP015967	Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence	5393-5422	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP026509	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed4, complete sequence	5991-6020	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017699	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence	7981-8010	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP017699	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence	52888-52917	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP046661	Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence	14312-14341	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_021516	Lactobacillus plantarum 16 plasmid Lp16C, complete sequence	22394-22423	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP029967	Lactobacillus curvatus strain ZJUNIT8 plasmid pnunamed1, complete sequence	48934-48963	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP028231	Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence	9863-9892	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NC_020820	Lactobacillus brevis KB290 plasmid pKB290-1, complete sequence	11917-11946	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP018183	Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-3, complete sequence	23669-23698	1	0.967
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	41063-41092	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032634	Lactobacillus sakei strain ZFM220 plasmid unnamed1, complete sequence	49785-49814	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP021933	Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence	50879-50908	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035132	Lactobacillus plantarum strain SRCM103311 plasmid unnamed1	4943-4972	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035148	Lactobacillus plantarum strain SRCM103361 plasmid unnamed1	84447-84476	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP024061	Lactobacillus plantarum strain KACC 92189 plasmid unnamed3	32191-32220	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP020097	Lactobacillus plantarum strain K25 plasmid unnamed4, complete sequence	6053-6082	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035569	Lactobacillus plantarum strain SRCM103300 plasmid unnamed3	19282-19311	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP046038	Lactobacillus sakei strain CBA3614 plasmid unnamed1, complete sequence	25169-25198	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	23210-23239	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032636	Lactobacillus sakei strain ZFM225 plasmid unnamed1, complete sequence	2944-2973	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	25954-25983	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP040502	Lactobacillus paragasseri JV-V03 plasmid unnamed2, complete sequence	9510-9539	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032653	Lactobacillus sakei strain LZ217 plasmid unnamed1, complete sequence	2966-2995	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP050807	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence	5945-5974	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	10817-10846	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP028232	Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence	37576-37605	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	21984-22013	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_AP017932	Lactobacillus sakei strain LK-145 plasmid pLs145-a, complete sequence	11848-11877	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	1427-1456	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP022710	Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence	50103-50132	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP035176	Lactobacillus plantarum strain SRCM103426 plasmid unnamed2	54034-54063	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP052067	Lactobacillus paracasei strain 347-16 plasmid unnamed2, complete sequence	7256-7285	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP019031	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence	372-401	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	20220-20249	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP020098	Lactobacillus plantarum strain K25 plasmid unnamed5, complete sequence	5814-5843	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP048005	Lactobacillus paracasei strain CACC 566 plasmid p2CACC566, complete sequence	48024-48053	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	41342-41371	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP032641	Lactobacillus sakei strain ZFM229 plasmid unnamed1, complete sequence	3757-3786	2	0.933
NZ_CP043615_1	1.13\|348658\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348658-348687	30	NZ_CP025416	Lactobacillus plantarum strain X7021 plasmid unnamed4, complete sequence	28282-28311	2	0.933
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	MN693159	Marine virus AFVG_25M303, complete genome	2569-2598	6	0.8
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	MN693299	Marine virus AFVG_25M439, complete genome	19094-19123	6	0.8
NZ_CP043615_1	1.3\|347998\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	347998-348027	30	MK376956	Gordonia phage WilliamBoone, complete genome	15191-15220	7	0.767
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NC_015465	Synechococcus phage S-CBS3, complete genome	2439-2468	7	0.767
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	MN693287	Marine virus AFVG_25M168, complete genome	16359-16388	7	0.767
NZ_CP043615_1	1.10\|348460\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348460-348489	30	NC_047851	Brevibacterium phage LuckyBarnes, complete genome	28943-28972	7	0.767
NZ_CP043615_1	1.11\|348526\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348526-348555	30	MT773555	Myoviridae sp. isolate BML_3 genomic sequence	119694-119723	7	0.767
NZ_CP043615_1	1.2\|347932\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	347932-347961	30	NZ_CP032687	Rhizobium sp. CCGE531 plasmid pRCCGE531b, complete sequence	533583-533612	8	0.733
NZ_CP043615_1	1.2\|347932\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	347932-347961	30	NZ_CP032692	Rhizobium sp. CCGE532 plasmid pRCCGE532b, complete sequence	463720-463749	8	0.733
NZ_CP043615_1	1.2\|347932\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	347932-347961	30	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	679496-679525	8	0.733
NZ_CP043615_1	1.2\|347932\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	347932-347961	30	NC_020061	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899b, complete sequence	503425-503454	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NC_049466	Escherichia phage vB_EcoM_4HA13, complete genome	47590-47619	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NZ_CP014052	Vibrio alginolyticus strain FDAARGOS_108 plasmid unnamed1, complete sequence	181909-181938	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NZ_KP688397	Vibrio parahaemolyticus strain V36 plasmid pVPH1, complete sequence	93165-93194	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NZ_KP791968	Vibrio parahaemolyticus strain 2011VPH2 plasmid pVPH2, complete sequence	37481-37510	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NZ_CP025539	Vibrio harveyi strain 345 plasmid p345-185, complete sequence	161743-161772	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	MN865127	Vibrio alginolyticus strain C1579 plasmid pC1579, complete sequence	148880-148909	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NC_025127	Vibrio sp. 04Ya090 plasmid pAQU2 DNA, complete sequence	96865-96894	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NC_016983	Photobacterium damselae subsp. damselae plasmid pAQU1, complete sequence	117505-117534	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	NZ_CP034301	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-2, complete sequence	113772-113801	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	KX957970	Vibrio parahaemolyticus plasmid pVPS43, complete sequence	56761-56790	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	KX957971	Vibrio parahaemolyticus plasmid pVPS62, complete sequence	56830-56859	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	KX957972	Vibrio parahaemolyticus plasmid pVPS91, complete sequence	61863-61892	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	KX957968	Vibrio alginolyticus plasmid pVAS19, complete sequence	57413-57442	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	KX957969	Vibrio alginolyticus plasmid pVAS114, complete sequence	56761-56790	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	MN693652	Marine virus AFVG_250M189, complete genome	13912-13941	8	0.733
NZ_CP043615_1	1.4\|348064\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348064-348093	30	MH319751	Marine virus AG-345-F15 Ga0172271_13 genomic sequence	15269-15298	8	0.733
NZ_CP043615_1	1.5\|348130\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348130-348159	30	MN694068	Marine virus AFVG_250M543, complete genome	44102-44131	9	0.7
NZ_CP043615_1	1.7\|348262\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348262-348291	30	NZ_KP738729	Aeromonas sp. Ne-1 plasmid pNe-1, complete sequence	23054-23083	9	0.7
NZ_CP043615_1	1.9\|348394\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	348394-348423	30	NZ_CP049914	Vibrio sp. HDW18 plasmid p_unnamed1, complete sequence	277757-277786	9	0.7
NZ_CP043615_1	1.3\|347998\|30\|NZ_CP043615\|CRISPRCasFinder,CRT,PILER-CR	347998-348027	30	NZ_CP022420	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-5, complete sequence	11816-11845	10	0.667

1. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025208 (Lactobacillus sakei strain WiKim0074 plasmid pLSW74_2, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

2. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017410 (Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

3. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

4. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

5. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_022114 (Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

6. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_016608 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-5, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

7. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033890 (Lactobacillus plantarum strain LMT1-48 plasmid p_2, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

8. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 0, identity: 1.0

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgccacctttttcc	Protospacer
******************************

9. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KM063576 (Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

10. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040857 (Lactobacillus plantarum strain 202195 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

11. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028979 (Lactobacillus plantarum strain LQ80 plasmid pLQ802, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

12. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035557 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

13. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035557 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

14. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_015603 (Lactobacillus kefiranofaciens ZW3 plasmid pWW2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

15. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032746 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

16. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012279 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

17. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgctacctttttcc	Protospacer
*******************.**********

18. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016492 (Lactobacillus pentosus strain BGM48 plasmid pBGM48-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

19. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014682 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

20. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032650 (Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

21. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_011839 (Lactobacillus gasseri plasmid pLgLA39, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

22. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046657 (Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgctacctttttcc	Protospacer
*******************.**********

23. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040377 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

24. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT907984 (Lactobacillus sakei subsp. sakei 23K plasmid pJ23A1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggccgccacctttttcc	Protospacer
****.*************************

25. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LT907987 (Lactobacillus sakei strain T332 plasmid p332A2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggccgccacctttttcc	Protospacer
****.*************************

26. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

27. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014891 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

28. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028242 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgccgccacctttttcc	Protospacer
************* ****************

29. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggccgccacctttttcc	Protospacer
****.*************************

30. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032752 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

31. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015862 (Lactobacillus plantarum strain LZ227 plasmid LZ227p5, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

32. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035574 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

33. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035177 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

34. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017376 (Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

35. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021472 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

36. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

37. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014885 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

38. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023493 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

39. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016802 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

40. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017356 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

41. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017366 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

42. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcggccgctacctttttcc	Protospacer
*******************.**********

43. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

44. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019751 (Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

45. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017381 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

46. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015967 (Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

47. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026509 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagcagccgccacctttttcc	Protospacer
*************.****************

48. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017699 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

49. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017699 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

50. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046661 (Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

51. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_021516 (Lactobacillus plantarum 16 plasmid Lp16C, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

52. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029967 (Lactobacillus curvatus strain ZJUNIT8 plasmid pnunamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggccgccacctttttcc	Protospacer
****.*************************

53. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028231 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

54. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_020820 (Lactobacillus brevis KB290 plasmid pKB290-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccacctttttcc	Protospacer
*******.**********************

55. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018183 (Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcggccgccacctttttcc	Protospacer
*.****************************

56. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgccgccacttttttcc	Protospacer
************* ********.*******

57. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032634 (Lactobacillus sakei strain ZFM220 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

58. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021933 (Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggctgccacctttttcc	Protospacer
****.***********.*************

59. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035132 (Lactobacillus plantarum strain SRCM103311 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggctgccacctttttcc	Protospacer
****.***********.*************

60. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035148 (Lactobacillus plantarum strain SRCM103361 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

61. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024061 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgccgccacttttttcc	Protospacer
************* ********.*******

62. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020097 (Lactobacillus plantarum strain K25 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

63. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035569 (Lactobacillus plantarum strain SRCM103300 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttacacaaagcggccgccacctttttcc	Protospacer
*.**.*************************

64. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046038 (Lactobacillus sakei strain CBA3614 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

65. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

66. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032636 (Lactobacillus sakei strain ZFM225 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

67. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcacaaagcagccgccacctttttcc	Protospacer
*.***********.****************

68. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040502 (Lactobacillus paragasseri JV-V03 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccctgcacaaagctgccgccacctttttcc	Protospacer
**.********** ****************

69. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032653 (Lactobacillus sakei strain LZ217 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

70. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050807 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttacacaaagcggctgccacctttttcc	Protospacer
****.***********.*************

71. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

72. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028232 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

73. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

74. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP017932 (Lactobacillus sakei strain LK-145 plasmid pLs145-a, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

75. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

76. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022710 (Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

77. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035176 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttacacaaagcggccgccacctttttcc	Protospacer
*.**.*************************

78. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP052067 (Lactobacillus paracasei strain 347-16 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgccgccacttttttcc	Protospacer
************* ********.*******

79. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019031 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcataaagcggccgccaccttcttcc	Protospacer
*******.*****************.****

80. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

81. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020098 (Lactobacillus plantarum strain K25 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccctgcacaaagccgccgccacctttttcc	Protospacer
**.********** ****************

82. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048005 (Lactobacillus paracasei strain CACC 566 plasmid p2CACC566, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgccgccacttttttcc	Protospacer
************* ********.*******

83. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

84. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032641 (Lactobacillus sakei strain ZFM229 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ccttgcacaaagccgctgccacctttttcc	Protospacer
************* **.*************

85. spacer 1.13|348658|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025416 (Lactobacillus plantarum strain X7021 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcacaaagcggccgccacctttttcc	CRISPR spacer
ctttgcataaagcggccgccacctttttcc	Protospacer
*.*****.**********************

86. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MN693159 (Marine virus AFVG_25M303, complete genome) position: , mismatch: 6, identity: 0.8

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tcaggaacagcaacatcagcaacaaccaat	Protospacer
 * *.* ********** ******** ***

87. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MN693299 (Marine virus AFVG_25M439, complete genome) position: , mismatch: 6, identity: 0.8

gctgaaccagcaacatctgcaac-aacgaat	CRISPR spacer
agtgaagcagcaacatcagcaacaaacgca-	Protospacer
. **** ********** ***** **** *

88. spacer 1.3|347998|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MK376956 (Gordonia phage WilliamBoone, complete genome) position: , mismatch: 7, identity: 0.767

atgacggctggcaacctaagccaccttatg-	CRISPR spacer
cccacggctggcaacctcagcca-cggatga	Protospacer
 . ************** ***** *  ***

89. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_015465 (Synechococcus phage S-CBS3, complete genome) position: , mismatch: 7, identity: 0.767

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
ggtgatccagcaacatctgcaacctggacg	Protospacer
* *** *****************   **

90. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MN693287 (Marine virus AFVG_25M168, complete genome) position: , mismatch: 7, identity: 0.767

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
gctcaagcagcaacatctgcaacgaatgct	Protospacer
*** ** ****************.*  . *

91. spacer 1.10|348460|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_047851 (Brevibacterium phage LuckyBarnes, complete genome) position: , mismatch: 7, identity: 0.767

ttggctttagtttaggtgtcttttgatgaa	CRISPR spacer
taggctttagtgtaggtgtattttgacatg	Protospacer
* ********* ******* ******.. .

92. spacer 1.11|348526|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MT773555 (Myoviridae sp. isolate BML_3 genomic sequence) position: , mismatch: 7, identity: 0.767

tactaaaccggttaaagcttcgtatatttt	CRISPR spacer
aactaaacccgttaaagcgtcgtaacttgc	Protospacer
 ******** ******** *****  ** .

93. spacer 1.2|347932|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032687 (Rhizobium sp. CCGE531 plasmid pRCCGE531b, complete sequence) position: , mismatch: 8, identity: 0.733

ctttcaagtaggtgatttcgttagtggttc	CRISPR spacer
cgatcaggtaggtgatctcgttagtgaagg	Protospacer
*  ***.*********.*********.

94. spacer 1.2|347932|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032692 (Rhizobium sp. CCGE532 plasmid pRCCGE532b, complete sequence) position: , mismatch: 8, identity: 0.733

ctttcaagtaggtgatttcgttagtggttc	CRISPR spacer
cgatcaggtaggtgatctcgttagtgaagg	Protospacer
*  ***.*********.*********.

95. spacer 1.2|347932|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 8, identity: 0.733

ctttcaagtaggtgatttcgttagtggttc	CRISPR spacer
cgatcaagtaagtgacttcgttagtgaacg	Protospacer
*  *******.****.**********. .

96. spacer 1.2|347932|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_020061 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899b, complete sequence) position: , mismatch: 8, identity: 0.733

ctttcaagtaggtgatttcgttagtggttc	CRISPR spacer
cgatcaggtaggtgatctcgttagtgaagg	Protospacer
*  ***.*********.*********.

97. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_049466 (Escherichia phage vB_EcoM_4HA13, complete genome) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tatgcaccagcaacatctgcaacagcagtc	Protospacer
  ** *******************.*.. .

98. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014052 (Vibrio alginolyticus strain FDAARGOS_108 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

99. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KP688397 (Vibrio parahaemolyticus strain V36 plasmid pVPH1, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

100. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KP791968 (Vibrio parahaemolyticus strain 2011VPH2 plasmid pVPH2, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

101. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025539 (Vibrio harveyi strain 345 plasmid p345-185, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

102. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MN865127 (Vibrio alginolyticus strain C1579 plasmid pC1579, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

103. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_025127 (Vibrio sp. 04Ya090 plasmid pAQU2 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

104. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NC_016983 (Photobacterium damselae subsp. damselae plasmid pAQU1, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

105. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034301 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-2, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

106. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to KX957970 (Vibrio parahaemolyticus plasmid pVPS43, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

107. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to KX957971 (Vibrio parahaemolyticus plasmid pVPS62, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

108. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to KX957972 (Vibrio parahaemolyticus plasmid pVPS91, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

109. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to KX957968 (Vibrio alginolyticus plasmid pVAS19, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

110. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to KX957969 (Vibrio alginolyticus plasmid pVAS114, complete sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tgcaattctgcaacatctgcaacaacgtat	Protospacer
  ..* .* ****************** **

111. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MN693652 (Marine virus AFVG_250M189, complete genome) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
tctgcaccagcaacatctgcatcaccagga	Protospacer
 *** **************** ** *...

112. spacer 1.4|348064|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MH319751 (Marine virus AG-345-F15 Ga0172271_13 genomic sequence) position: , mismatch: 8, identity: 0.733

gctgaaccagcaacatctgcaacaacgaat	CRISPR spacer
actgaaccagcagcatcagcaacaccttga	Protospacer
.***********.**** ****** *  .

113. spacer 1.5|348130|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to MN694068 (Marine virus AFVG_250M543, complete genome) position: , mismatch: 9, identity: 0.7

tgtgatctcacgtgtttcgatcttgtaata	CRISPR spacer
gaagatctcaggcgtttcgatcttgtggac	Protospacer
 . ******* *.*************..

114. spacer 1.7|348262|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KP738729 (Aeromonas sp. Ne-1 plasmid pNe-1, complete sequence) position: , mismatch: 9, identity: 0.7

ctaagcaactagagaaaattgatggcaggg	CRISPR spacer
acaagcaaatagaaaaaattgatggattaa	Protospacer
 .****** ****.***********   ..

115. spacer 1.9|348394|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049914 (Vibrio sp. HDW18 plasmid p_unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

acctcgcagaggattatggcaacgggtaaa	CRISPR spacer
ttatcgcagagcattatggcaacggcatct	Protospacer
 . ******** *************

116. spacer 1.3|347998|30|NZ_CP043615|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022420 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-5, complete sequence) position: , mismatch: 10, identity: 0.667

atgacggctggcaacctaagccaccttatg	CRISPR spacer
ggcgcggctggcaacctatgccaccgcgat	Protospacer
.  .************** ****** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

440583 : 453291

Enterococcus_phage(36.36%)

portal,head,capsid,integrase,terminase,tail

attL 448873:448887|attR 464492:464506

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_149315518.1\|440583_440856_-\|head,tail	phage gp6-like head-tail connector protein	C0LZZ4	Enterococcus_phage	1.0e-05	32.3
WP_149315523.1\|440919_442434_-\|capsid	phage major capsid protein	A0A1Q1PVX2	Staphylococcus_phage	2.4e-40	33.1
WP_149315519.1\|442426_443530_-\|portal	phage portal protein	C0LZZ8	Enterococcus_phage	1.3e-43	32.6
WP_149315520.1\|443542_443737_-	hypothetical protein	NA	NA	NA	NA
WP_149315521.1\|443696_445517_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.6e-115	40.9
WP_149315522.1\|445513_445993_-\|terminase	phage terminase small subunit P27 family	A0A0R6PF88	Moraxella_phage	5.0e-08	27.5
WP_149315507.1\|446270_446678_-	HNH endonuclease	A0A2H4J4D3	uncultured_Caudovirales_phage	4.7e-07	33.3
WP_149315508.1\|446682_447015_-\|head	phage head closure protein	NA	NA	NA	NA
WP_149315509.1\|447021_447474_-	hypothetical protein	NA	NA	NA	NA
WP_149315510.1\|447466_447676_-	hypothetical protein	NA	NA	NA	NA
WP_149315511.1\|447974_449594_-	DNA primase	V5US55	Enterococcus_phage	1.0e-36	31.1
448873:448887	attL	NA	NA	NA	NA
WP_149315512.1\|449574_450378_-	DNA replication protein	A0A060ADS5	Enterococcus_phage	9.6e-20	32.0
WP_149315513.1\|450374_450620_-	hypothetical protein	NA	NA	NA	NA
WP_149315514.1\|450914_451190_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_040470554.1\|451189_451384_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	2.7e-05	45.5
WP_082402650.1\|451521_452094_+	helix-turn-helix transcriptional regulator	A0A1W6JQE6	Staphylococcus_phage	5.8e-11	28.6
WP_149315515.1\|452148_453291_+\|integrase	tyrosine-type recombinase/integrase	A0A172LN96	Lactococcus_phage	5.7e-50	35.1
464492:464506	attR	NA	NA	NA	NA

DBSCAN-SWA_2

908289 : 964345

Streptococcus_phage(26.67%)

transposase,tRNA,integrase

attL 917983:917997|attR 973811:973825

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013729113.1\|908289_910221_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_013729114.1\|910254_911649_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_149315607.1\|911847_912558_-	KH domain-containing protein	NA	NA	NA	NA
WP_013729116.1\|912813_913767_+	cation transporter	NA	NA	NA	NA
WP_013729117.1\|914129_914900_+	acetoin reductase	NA	NA	NA	NA
WP_013729118.1\|916473_917484_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_013729119.1\|917649_917988_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
917983:917997	attL	NA	NA	NA	NA
WP_013729120.1\|917984_918662_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_013729121.1\|918758_919886_-	glycerate kinase	W6LM47	Streptococcus_phage	2.0e-39	39.0
WP_013727284.1\|920102_921374_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_013729122.1\|921460_922297_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_149315608.1\|922293_922659_-	ribonuclease P protein component	NA	NA	NA	NA
WP_013729124.1\|922718_922853_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_013726859.1\|923358_924708_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_013726860.1\|924897_926037_+	DNA polymerase III subunit beta	D0R7I4	Paenibacillus_phage	1.6e-12	31.3
WP_013726861.1\|926328_926571_+	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_013726862.1\|926567_927686_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_013726863.1\|927701_929645_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.2e-146	46.0
WP_041805519.1\|929704_932272_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.2e-108	35.3
WP_013726865.1\|932457_933567_+	L-lactate oxidase	NA	NA	NA	NA
WP_013726866.1\|933772_933964_-	hypothetical protein	NA	NA	NA	NA
WP_013726867.1\|934365_934662_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_013726868.1\|934696_935263_+	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	2.7e-45	77.6
WP_013726869.1\|935299_935539_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_013727131.1\|937293_938223_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	1.5e-19	31.8
WP_013726871.1\|939591_940983_+	amino acid permease	NA	NA	NA	NA
WP_041805798.1\|941250_943191_+	DHH family phosphoesterase	NA	NA	NA	NA
WP_013726873.1\|943230_943683_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_013726874.1\|943842_945222_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.9e-130	54.5
WP_013726875.1\|945397_946291_+	hypothetical protein	NA	NA	NA	NA
WP_013726876.1\|946618_947923_-	ABC transporter permease	NA	NA	NA	NA
WP_013726877.1\|948068_948731_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_149315609.1\|948952_950104_-\|integrase	tyrosine-type recombinase/integrase	J7KBT5	Streptococcus_phage	1.2e-58	37.8
WP_148235600.1\|950156_951041_-	helix-turn-helix domain-containing protein	A0A2H4JBP6	uncultured_Caudovirales_phage	4.3e-05	35.5
WP_013726880.1\|951169_951352_+	hypothetical protein	NA	NA	NA	NA
WP_013726881.1\|951356_951653_+	hypothetical protein	NA	NA	NA	NA
WP_013726882.1\|951853_952552_+	hypothetical protein	I6R9D7	Salmonella_phage	1.1e-24	35.6
WP_149315610.1\|952799_953075_+	hypothetical protein	NA	NA	NA	NA
WP_003633939.1\|953079_953319_+	hypothetical protein	NA	NA	NA	NA
WP_013726885.1\|953334_953742_+	hypothetical protein	NA	NA	NA	NA
WP_013726886.1\|953734_954499_+	DNA primase	A0A060ADS5	Enterococcus_phage	1.4e-23	28.8
WP_013726887.1\|954532_955987_+	DNA primase	Q9G0E3	Lactococcus_phage	3.7e-94	43.1
WP_003633947.1\|956432_956852_+	hypothetical protein	NA	NA	NA	NA
WP_013726889.1\|956853_957273_+	HTH domain-containing protein	NA	NA	NA	NA
WP_013726890.1\|957534_958713_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1X9I6E7	Streptococcus_phage	3.6e-07	24.0
WP_149315611.1\|958737_958944_+	hypothetical protein	NA	NA	NA	NA
WP_081464573.1\|959431_959518_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_013726891.1\|959544_960474_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_013726892.1\|961055_961367_+	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_013726893.1\|961387_963133_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_149315612.1\|963415_964345_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
973811:973825	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2026629 : 2034949

Staphylococcus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013727856.1\|2026629_2026905_+	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	2.0e-25	67.4
WP_013727857.1\|2026972_2028226_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_013727858.1\|2028359_2029250_-	YitT family protein	M1Q1P6	Streptococcus_phage	5.8e-58	39.4
WP_013727859.1\|2029380_2030592_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.1e-43	48.8
WP_013727860.1\|2030599_2032516_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	7.1e-53	29.7
WP_056938601.1\|2032554_2033505_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	5.1e-121	63.1
WP_013727862.1\|2033515_2034001_+	dihydrofolate reductase	F8SJN4	Pseudomonas_phage	4.9e-19	39.8
WP_013727863.1\|2034100_2034949_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.9e-18	36.7

DBSCAN-SWA_4

2306834 : 2314716

Streptococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013728123.1\|2306834_2307428_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.0e-54	53.3
WP_013728124.1\|2307597_2308674_+	zinc-dependent alcohol dehydrogenase family protein	K7Z7U2	Megavirus	8.1e-30	33.3
WP_013728125.1\|2308794_2309739_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.6e-48	36.5
WP_013728126.1\|2309769_2310774_-	YvcK family protein	A1IMD5	Streptococcus_phage	3.9e-95	54.2
WP_013728127.1\|2310773_2311658_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.3e-09	31.4
WP_013728128.1\|2311839_2314716_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.6e-306	54.6

DBSCAN-SWA_5

2322526 : 2421211

107

Lactobacillus_phage(22.92%)

transposase,tRNA,holin,terminase,plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013728136.1\|2322526_2322874_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_013728137.1\|2322874_2323204_-	PspC domain-containing protein	NA	NA	NA	NA
WP_013728138.1\|2323292_2323949_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_013728139.1\|2323960_2324719_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-16	28.6
WP_149315747.1\|2324730_2325546_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-13	28.8
WP_013728141.1\|2325556_2326447_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_013728142.1\|2326443_2327373_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_013728143.1\|2327375_2328260_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_013728144.1\|2328453_2329845_-	histidine kinase	W8CYF6	Bacillus_phage	1.4e-26	28.5
WP_013728145.1\|2329831_2330557_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.1e-36	36.2
WP_013728146.1\|2330567_2331728_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_041805910.1\|2331982_2333047_-	peptide chain release factor 2	NA	NA	NA	NA
WP_013728148.1\|2333183_2335547_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_013728149.1\|2335835_2336402_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_013728150.1\|2336524_2337217_-	ComF family protein	NA	NA	NA	NA
WP_149315748.1\|2337213_2338536_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	1.5e-70	37.3
WP_013728152.1\|2338584_2339265_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.9e-41	41.3
WP_013728153.1\|2339358_2340450_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_013728154.1\|2340710_2341163_+	CidA/LrgA family protein	NA	NA	NA	NA
WP_013728155.1\|2341181_2341934_+\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_013728156.1\|2342160_2344002_-	APC family permease	NA	NA	NA	NA
WP_013728157.1\|2344303_2345926_-	chaperonin GroEL	A0A240F779	uncultured_virus	1.2e-154	52.2
WP_013728158.1\|2346019_2346340_-	co-chaperone GroES	A0A221S356	uncultured_virus	7.2e-11	34.1
WP_014940146.1\|2346530_2347163_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_041805682.1\|2347338_2349300_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.1e-52	31.4
WP_013727284.1\|2350964_2352236_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_013728161.1\|2352465_2353497_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.9e-59	40.0
WP_041805912.1\|2353516_2354092_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_013728163.1\|2354075_2354798_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_013728164.1\|2354800_2355574_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013728165.1\|2355589_2356465_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.4e-80	55.5
WP_013728166.1\|2356475_2356808_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_013728167.1\|2356830_2357841_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.3e-34	33.2
WP_013728168.1\|2357852_2358179_-	hypothetical protein	NA	NA	NA	NA
WP_013728169.1\|2358181_2358832_-	dTMP kinase	M1PSC7	Streptococcus_phage	6.3e-54	51.0
WP_013728170.1\|2358916_2359183_-	YaaL family protein	NA	NA	NA	NA
WP_013728171.1\|2359206_2359806_-	recombination protein RecR	NA	NA	NA	NA
WP_013728172.1\|2359830_2360142_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_013728173.1\|2360157_2361960_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.0e-57	38.7
WP_013728174.1\|2362227_2362725_-	nucleoside deaminase	NA	NA	NA	NA
WP_013728175.1\|2362734_2363346_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_013728176.1\|2363505_2363736_+	glutaredoxin-like protein NrdH	A0A218MND6	uncultured_virus	6.1e-12	41.9
WP_056939122.1\|2363838_2366004_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.1e-256	61.2
WP_013728178.1\|2366015_2366972_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	7.4e-120	65.0
WP_013728179.1\|2367050_2368046_-	D-2-hydroxyacid dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.1e-46	34.7
WP_013728180.1\|2368217_2369684_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_013728181.1\|2369686_2370691_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	3.7e-53	38.2
WP_041805685.1\|2370718_2371894_-	galactokinase	NA	NA	NA	NA
WP_013728183.1\|2372274_2374863_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_149315749.1\|2375097_2376369_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_149315750.1\|2376609_2377428_-	autolysin	A0A0A7DMK9	Lactobacillus_phage	8.3e-19	32.6
WP_149315751.1\|2377420_2377945_-	hypothetical protein	NA	NA	NA	NA
WP_149315752.1\|2377948_2378335_-	hypothetical protein	NA	NA	NA	NA
WP_149315815.1\|2378327_2378684_-	hypothetical protein	D6PSR9	Lactobacillus_phage	3.6e-11	40.2
WP_149315753.1\|2378897_2379263_-	hypothetical protein	NA	NA	NA	NA
WP_011373852.1\|2379234_2380155_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_149315754.1\|2380252_2381833_-	hypothetical protein	NA	NA	NA	NA
WP_149315755.1\|2381832_2382450_-	hypothetical protein	NA	NA	NA	NA
WP_149315756.1\|2382442_2383627_-\|plate	baseplate J/gp47 family protein	A0A291AYB2	Shigella_phage	2.2e-20	30.6
WP_149315757.1\|2383607_2384015_-	hypothetical protein	NA	NA	NA	NA
WP_149315758.1\|2384026_2384470_-	hypothetical protein	NA	NA	NA	NA
WP_149315759.1\|2384482_2385532_-	hypothetical protein	A0A1L2JY62	Aeribacillus_phage	1.0e-13	32.2
WP_149315760.1\|2385524_2385953_-	hypothetical protein	A8ATH8	Listeria_phage	1.0e-12	34.7
WP_149315761.1\|2385966_2386899_-	hypothetical protein	NA	NA	NA	NA
WP_149315762.1\|2386898_2392883_-\|tail	phage tail tape measure protein	Q9AZS0	Lactococcus_phage	2.4e-59	43.3
WP_149315763.1\|2392898_2393078_-	hypothetical protein	NA	NA	NA	NA
WP_013728201.1\|2393112_2393463_-	hypothetical protein	NA	NA	NA	NA
WP_149315764.1\|2393543_2393960_-	DUF3277 family protein	A8ATH3	Listeria_phage	1.0e-12	35.6
WP_149315765.1\|2393973_2395029_-	DUF3383 family protein	A0A1L2JZ70	Aeribacillus_phage	3.3e-52	37.1
WP_149315766.1\|2395031_2395514_-	hypothetical protein	NA	NA	NA	NA
WP_149315767.1\|2395497_2395878_-	hypothetical protein	NA	NA	NA	NA
WP_149315768.1\|2395879_2396470_-	hypothetical protein	D6PSY0	Lactobacillus_phage	2.4e-28	39.9
WP_149315769.1\|2396466_2396847_-	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_149315770.1\|2396860_2397241_-	hypothetical protein	NA	NA	NA	NA
WP_149315771.1\|2397253_2398141_-	DUF2184 domain-containing protein	D6PSX7	Lactobacillus_phage	2.1e-44	36.8
WP_149315772.1\|2398204_2398711_-	hypothetical protein	NA	NA	NA	NA
WP_149315773.1\|2398710_2399865_-	DUF2213 domain-containing protein	A8ATG4	Listeria_phage	2.0e-47	47.5
WP_149315774.1\|2399877_2400378_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_149315775.1\|2400500_2401343_-	hypothetical protein	D6PSX3	Lactobacillus_phage	6.3e-22	39.9
WP_149315776.1\|2401351_2402797_-	DUF1073 domain-containing protein	D6PSX2	Lactobacillus_phage	6.1e-65	36.0
WP_149315777.1\|2402808_2404260_-\|terminase	phage terminase large subunit	A5GYP8	Lactococcus_phage	1.2e-153	57.0
WP_149315778.1\|2404240_2404729_-	helix-turn-helix domain-containing protein	A0A2I7S016	Vibrio_phage	5.6e-15	39.8
WP_149315779.1\|2404818_2405121_-	hypothetical protein	NA	NA	NA	NA
WP_149315780.1\|2405134_2405662_-	hypothetical protein	NA	NA	NA	NA
WP_149315781.1\|2405859_2406171_+	hypothetical protein	NA	NA	NA	NA
WP_149315782.1\|2406652_2407684_-	hypothetical protein	Q7Y4L3	Streptococcus_phage	1.6e-06	30.2
WP_149315783.1\|2408121_2408586_-	hypothetical protein	NA	NA	NA	NA
WP_084989008.1\|2408686_2408956_-	hypothetical protein	Q5ULV5	Lactobacillus_virus	2.7e-19	54.7
WP_149315784.1\|2408952_2409411_-	hypothetical protein	NA	NA	NA	NA
WP_149315816.1\|2409453_2409843_-	hypothetical protein	A0A2P0ZLC1	Lactobacillus_phage	3.7e-09	38.1
WP_149315785.1\|2409896_2410571_-	N-6 DNA methylase	A0A2D1GPI7	Lactobacillus_phage	3.7e-65	54.6
WP_149315786.1\|2410567_2410753_-	hypothetical protein	NA	NA	NA	NA
WP_013728231.1\|2410919_2411162_-	hypothetical protein	NA	NA	NA	NA
WP_149315787.1\|2411174_2411606_-	DUF1064 domain-containing protein	A0A0P0IJU5	Lactobacillus_phage	1.5e-24	46.4
WP_149315788.1\|2411655_2411844_-	hypothetical protein	NA	NA	NA	NA
WP_149315789.1\|2412001_2412778_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	3.8e-66	51.3
WP_149315790.1\|2412777_2413530_-	replication protein	A0A1W6JNI1	Staphylococcus_phage	7.5e-59	52.3
WP_149315817.1\|2413507_2414101_-	DUF968 domain-containing protein	E9LUU3	Lactobacillus_phage	1.4e-76	69.8
WP_149315791.1\|2414236_2414956_-	MBL fold metallo-hydrolase	A0A0A0RVF5	Bacillus_phage	2.5e-51	41.9
WP_149315792.1\|2414952_2416038_-	hypothetical protein	NA	NA	NA	NA
WP_149315793.1\|2416041_2417985_-	hypothetical protein	A0A1L2K2K3	Aeribacillus_phage	1.3e-91	34.3
WP_149315794.1\|2418439_2418745_-	hypothetical protein	NA	NA	NA	NA
WP_149315795.1\|2418722_2419238_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_149315796.1\|2419318_2420056_-	phage antirepressor Ant	A0A0C5AFE7	Paenibacillus_phage	2.3e-52	46.3
WP_149315797.1\|2420105_2420288_-	hypothetical protein	NA	NA	NA	NA
WP_149315798.1\|2420472_2420673_-	helix-turn-helix domain-containing protein	A8ATK0	Listeria_phage	5.0e-10	55.9
WP_149315799.1\|2420830_2421211_+	helix-turn-helix domain-containing protein	A0A0B5CYL9	Listeria_phage	5.0e-11	37.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP043613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

344 : 29800

Lactobacillus_phage(87.5%)

capsid,protease,tail,portal,head,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008213898.1\|344_671_+	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	2.9e-23	47.2
WP_149315475.1\|676_952_-	hypothetical protein	NA	NA	NA	NA
WP_149315476.1\|1201_1414_-	hypothetical protein	A0A0A7RTK6	Clostridium_phage	6.7e-05	39.4
WP_008857063.1\|1680_1950_+	hypothetical protein	NA	NA	NA	NA
WP_149315477.1\|1969_2827_+	DUF1351 domain-containing protein	U5U3Y3	Lactobacillus_phage	7.1e-37	33.2
WP_149315478.1\|2829_3507_+	AAA family ATPase	B4XYS4	Lactobacillus_phage	3.2e-77	60.2
WP_149315479.1\|3509_4865_+	DEAD/DEAH box helicase family protein	Q9T0Y3	Lactobacillus_phage	3.8e-154	61.3
WP_149315480.1\|4880_5474_+	DUF669 domain-containing protein	Q9T0Y2	Lactobacillus_phage	1.7e-50	51.0
WP_149315481.1\|5485_7786_+	DNA primase	Q9T0Y1	Lactobacillus_phage	2.4e-297	63.5
WP_039933389.1\|8072_8387_+	VRR-NUC domain-containing protein	A0A1B0YA93	Lactobacillus_phage	1.4e-30	56.9
WP_149315482.1\|8388_8802_+	hypothetical protein	NA	NA	NA	NA
WP_149315483.1\|8895_9087_+	hypothetical protein	NA	NA	NA	NA
WP_149315484.1\|9145_10042_+	hypothetical protein	NA	NA	NA	NA
WP_149315485.1\|10019_10475_+	HNH endonuclease	B8R694	Lactobacillus_phage	7.8e-27	40.3
WP_003636406.1\|11100_11619_+\|terminase	phage terminase small subunit P27 family	Q5K5J8	Oenococcus_phage	1.7e-25	47.7
WP_149315486.1\|11618_13514_+\|terminase	terminase large subunit	A0A0M7RDK9	Lactobacillus_phage	2.1e-137	41.0
WP_149315487.1\|13752_14901_+\|portal	phage portal protein	A0A0M9JJ63	Lactobacillus_phage	6.9e-88	45.4
WP_149315488.1\|14875_15583_+\|protease	Clp protease ClpP	Q9T1F7	Lactobacillus_phage	4.4e-53	51.9
WP_149315489.1\|15586_16828_+\|capsid	phage major capsid protein	Q9T1F6	Lactobacillus_phage	2.0e-85	44.5
WP_039933407.1\|16915_17182_+	DNA-packaging protein	A0A2P0ZLF2	Lactobacillus_phage	9.9e-06	36.7
WP_070366820.1\|17171_17534_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	3.1e-18	42.3
WP_003636422.1\|17526_17925_+\|head,tail	head-tail joining protein	A0A0M7RDL2	Lactobacillus_phage	3.4e-18	37.6
WP_057911232.1\|17924_18314_+	DUF806 family protein	A0A0M7RE53	Lactobacillus_phage	4.2e-13	35.8
WP_149315490.1\|18314_18965_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	2.8e-38	44.9
WP_149315491.1\|19023_19401_+	molecular chaperone	A8YQJ8	Lactobacillus_phage	4.0e-08	35.1
WP_149315492.1\|19609_25186_+\|tail	phage tail tape measure protein	Q9AZS0	Lactococcus_phage	5.2e-104	35.4
WP_149315493.1\|25178_26414_+\|tail	phage tail protein	E9LUR2	Lactobacillus_phage	1.4e-49	32.4
WP_149315494.1\|26419_27169_+	hypothetical protein	E9LUR2	Lactobacillus_phage	1.4e-12	31.4
WP_149315495.1\|27217_29800_+	hypothetical protein	E9LUR3	Lactobacillus_phage	2.7e-92	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP043614

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13801

uncultured_Caudovirales_phage(36.36%)

portal,head,tail,capsid,integrase,terminase

attL 3107:3120|attR 12257:12270

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_149315508.1\|174_507_-\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	2.7e-08	31.8
WP_149315509.1\|513_966_-	hypothetical protein	A0A2H4JHE6	uncultured_Caudovirales_phage	3.0e-10	40.2
WP_149315510.1\|958_1168_-	hypothetical protein	NA	NA	NA	NA
WP_149315511.1\|1466_3086_-	DNA primase	A0A1B1P7L5	Bacillus_phage	2.5e-27	31.0
WP_149315512.1\|3066_3870_-	DNA replication protein	A0A2I7QJ82	Vibrio_phage	9.3e-07	27.1
3107:3120	attL	NA	NA	NA	NA
WP_149315513.1\|3866_4112_-	hypothetical protein	NA	NA	NA	NA
WP_149315514.1\|4406_4682_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_040470554.1\|4681_4876_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_082402650.1\|5013_5586_+	helix-turn-helix transcriptional regulator	A0A1W6JQE6	Staphylococcus_phage	5.8e-11	28.6
WP_149315515.1\|5640_6783_+\|integrase	tyrosine-type recombinase/integrase	A0A2P0ZL94	Lactobacillus_phage	1.6e-60	38.6
WP_149315516.1\|7099_7747_+	hypothetical protein	NA	NA	NA	NA
WP_149315517.1\|7743_8106_-	hypothetical protein	NA	NA	NA	NA
WP_149315518.1\|8391_8664_-\|head,tail	phage gp6-like head-tail connector protein	A0A060ADP5	Enterococcus_phage	3.8e-05	32.6
WP_149315523.1\|8727_10242_-\|capsid	phage major capsid protein	A0A1Q1PVX2	Staphylococcus_phage	2.4e-40	33.1
WP_149315519.1\|10234_11338_-\|portal	phage portal protein	A0A2H4JB06	uncultured_Caudovirales_phage	2.2e-46	33.3
WP_149315520.1\|11350_11545_-	hypothetical protein	NA	NA	NA	NA
WP_149315521.1\|11504_13325_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.6e-115	40.9
12257:12270	attR	NA	NA	NA	NA
WP_149315522.1\|13321_13801_-\|terminase	phage terminase small subunit P27 family	A0A2H4J4D1	uncultured_Caudovirales_phage	1.0e-13	32.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP043616

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 39369

Lactobacillus_phage(54.29%)

capsid,integrase,portal,tail,head,terminase

attL 2622:2635|attR 39384:39397

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_149315818.1\|354_579_-	hypothetical protein	NA	NA	NA	NA
WP_149315819.1\|594_1017_-	ImmA/IrrE family metallo-endopeptidase	A0A1B0Y2S4	Lactobacillus_phage	6.8e-17	35.6
WP_149315820.1\|1022_1340_-	helix-turn-helix domain-containing protein	A0A1B0Y3N1	Lactobacillus_phage	2.8e-23	52.4
WP_149315869.1\|1770_1989_+	hypothetical protein	NA	NA	NA	NA
WP_149315821.1\|2218_2425_+	transcriptional regulator	NA	NA	NA	NA
WP_149315822.1\|2437_2617_+	DNA-binding protein	NA	NA	NA	NA
2622:2635	attL	NA	NA	NA	NA
WP_084988953.1\|2871_3138_+	hypothetical protein	NA	NA	NA	NA
WP_149315823.1\|3127_3775_-	hypothetical protein	NA	NA	NA	NA
WP_149315824.1\|4018_4237_+	helix-turn-helix domain-containing protein	H9A0L8	Staphylococcus_phage	4.3e-07	44.6
WP_149315825.1\|4489_5347_+	DUF1351 domain-containing protein	U5U3Y3	Lactobacillus_phage	4.3e-42	37.0
WP_149315826.1\|5347_6094_+	AAA family ATPase	A0A0P0IJT7	Lactobacillus_phage	3.4e-80	60.4
WP_149315827.1\|6026_7535_+	DEAD/DEAH box helicase family protein	Q9T0Y3	Lactobacillus_phage	4.3e-130	58.3
WP_149315828.1\|7547_8072_+	DUF669 domain-containing protein	Q8W5V8	Listeria_phage	7.1e-32	42.5
WP_149315829.1\|8083_10414_+	DNA primase	Q9T0Y1	Lactobacillus_phage	8.9e-183	43.1
WP_149315830.1\|10670_10985_+	VRR-NUC domain-containing protein	A0A0M7RDN7	Lactobacillus_phage	2.3e-41	74.8
WP_149315831.1\|10990_11455_+	hypothetical protein	NA	NA	NA	NA
WP_149315832.1\|11429_11810_+	hypothetical protein	NA	NA	NA	NA
WP_149315833.1\|11806_12205_+	hypothetical protein	NA	NA	NA	NA
WP_149315834.1\|12201_12396_+	hypothetical protein	NA	NA	NA	NA
WP_149315835.1\|12392_12602_+	hypothetical protein	NA	NA	NA	NA
WP_149315836.1\|12613_13108_+	hypothetical protein	A0A097BY45	Enterococcus_phage	2.1e-17	31.8
WP_149315837.1\|13380_13884_+	hypothetical protein	NA	NA	NA	NA
WP_149315838.1\|14417_14780_+	hypothetical protein	A0A0S2MYF8	Enterococcus_phage	1.0e-21	46.2
WP_149315839.1\|14772_16020_+\|terminase	PBSX family phage terminase large subunit	B6CXD2	Clostridium_phage	2.3e-97	44.9
WP_149315840.1\|16010_17465_+\|portal	phage portal protein	X2CY64	Lactobacillus_phage	7.5e-148	56.8
WP_149315841.1\|17481_18522_+\|head	phage head morphogenesis protein	A9D9S7	Lactobacillus_prophage	6.9e-87	45.1
WP_149315842.1\|18616_19168_+\|capsid	phage capsid protein	A9D9T0	Lactobacillus_prophage	1.6e-21	53.3
WP_149315843.1\|19186_20101_+\|capsid	capsid protein	Q20DD4	Lactobacillus_phage	6.0e-135	79.9
WP_149315844.1\|20184_20637_+	Ig domain-containing protein	NA	NA	NA	NA
WP_149315845.1\|20656_21040_+	hypothetical protein	X2CXX4	Lactobacillus_phage	2.5e-26	50.4
WP_149315870.1\|21060_21438_+	hypothetical protein	Q20DD2	Lactobacillus_phage	3.0e-32	57.7
WP_149315846.1\|21391_21823_+	HK97 gp10 family phage protein	A9D9U1	Lactobacillus_prophage	1.5e-24	42.8
WP_149315847.1\|21819_22230_+	hypothetical protein	L0P6G4	Lactobacillus_phage	2.1e-18	40.8
WP_149315848.1\|22380_23802_+\|tail	phage tail protein	Q20DC8	Lactobacillus_phage	2.6e-113	48.7
WP_149315849.1\|23819_24317_+\|tail	phage tail protein	Q20DC7	Lactobacillus_phage	2.6e-60	71.9
WP_149315850.1\|24329_24746_+	hypothetical protein	A9D9V7	Lactobacillus_prophage	1.1e-22	47.9
WP_149315871.1\|25060_28075_+	tape measure protein	I7A9A7	Enterococcus_phage	8.5e-61	58.4
WP_149315851.1\|28085_28826_+	hypothetical protein	A9D9W2	Lactobacillus_prophage	2.1e-29	34.5
WP_149315852.1\|28828_29878_+	late control protein D	X2CXX6	Lactobacillus_phage	7.1e-47	34.1
WP_149315853.1\|29877_30219_+	DUF2577 family protein	L0P6Y6	Lactobacillus_phage	7.9e-24	50.4
WP_149315854.1\|30221_30656_+	DUF2634 domain-containing protein	X2CXN6	Lactobacillus_phage	2.1e-37	63.9
WP_149315855.1\|30645_31788_+	hypothetical protein	X2CYG4	Lactobacillus_phage	1.1e-120	56.3
WP_149315856.1\|31784_32411_+	DUF2313 domain-containing protein	Q20DB9	Lactobacillus_phage	2.0e-28	42.3
WP_149315857.1\|32407_33433_+	hypothetical protein	Q9AZ87	Lactobacillus_prophage	1.5e-25	38.8
WP_149315858.1\|33441_33903_+	hypothetical protein	NA	NA	NA	NA
WP_149315859.1\|34020_34458_+	hypothetical protein	NA	NA	NA	NA
WP_149315860.1\|34491_34941_+	hypothetical protein	NA	NA	NA	NA
WP_149315861.1\|34952_35099_+	XkdX family protein	NA	NA	NA	NA
WP_149315862.1\|35113_35509_+	hypothetical protein	K4HZJ4	Lactobacillus_virus	6.8e-11	36.6
WP_149315863.1\|35511_35697_+	hypothetical protein	NA	NA	NA	NA
WP_149315864.1\|35697_35979_+	hypothetical protein	NA	NA	NA	NA
WP_149315865.1\|35979_36954_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6JN27	Lactococcus_phage	1.7e-50	56.3
WP_149315866.1\|37023_37632_-	hypothetical protein	A0A0H4TI24	Erysipelothrix_phage	8.1e-11	29.2
WP_149315867.1\|38208_39369_-\|integrase	tyrosine-type recombinase/integrase	Q6SEG4	Lactobacillus_prophage	2.1e-60	34.0
39384:39397	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043615

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP043613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP043614

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP043616

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection